F311652

General Info

Members Datasets Scaffolds Average Seq Length
203 111 194 267

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0001150|Ga0495625_0001150_10034_10999
Length 321
Sequence LLARNRVAFYLNLHILLNIFDLHLNGINRTNKIKIFFVRIFKASRLSHKNVHPMSKFMKSFKIIAFAAGLAVAVMVSSAFINAKNNAKKIKGKFAGNGFAVIELFTSEGCSSCPPADELVARIQKEYSDKPVYILAFHVDYWNRLGWKDPFSNAGYSKRQNDYANWLKLKSVYTPQIVVNGRKEFVGSEEGTLRNATTAGLHMTPTAKLTLNAQNAPGHIILQYKAEGAGNNTTLLLALVQKAAQTKVQRGENGGRTLSHVQIVTKVQSTPLNISGSGSATIAVPDGFTTQGYEVIGLVQNTGNGAIVAAAKSGFETGMSK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
109 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
110 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
111 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.07
Metatranscriptomes 0.49
Isolates 4.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 0.99
Rhizosphere 86.21
Stem 0
Stem Tuber 0
Unclassified 7.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000955 3300001904 Bacteria 5336
2 JGI24740J21852_10019368 3300001979 Bacteria 2398
3 JGI24739J22299_10005326 3300001989 Bacteria 4899
4 JGI24739J22299_10007026 3300001989 Bacteria 4238
5 JGI24737J22298_10000457 3300001990 Bacteria 14037
6 JGI24737J22298_10001803 3300001990 Bacteria 7671
7 JGI24737J22298_10021010 3300001990 Bacteria 2082
8 JGI24743J22301_10013281 3300001991 Bacteria 1507
9 JGI24735J21928_10000008 3300002067 Bacteria 319819
10 JGI24735J21928_10000084 3300002067 Bacteria 35383
11 JGI25162J39368_1000056 3300002737 Bacteria 146755
12 rootH1_10112531 3300003316 Bacteria 6059
13 rootH2_10015983 3300003320 Bacteria 11340
14 rootH2_10254663 3300003320 Bacteria 2065
15 rootL2_10049568 3300003322 Bacteria 7025
16 rootL2_10140154 3300003322 Bacteria 5499
17 rootH1_10014855 3300003323 Bacteria 3610
18 rootH1_10016558 3300003323 Bacteria 1870
19 Ga0065714_10112022 3300005288 Unclassified 1461
20 Ga0070676_10105375 3300005328 Bacteria 1748
21 Ga0068868_100037056 3300005338 Bacteria 3779
22 Ga0070660_100014823 3300005339 Bacteria 5626
23 Ga0070659_100035884 3300005366 Bacteria 3863
24 Ga0070678_100176578 3300005456 Bacteria 1745
25 Ga0070662_100003641 3300005457 Bacteria 9620
26 Ga0068867_100010706 3300005459 Bacteria 6467
27 Ga0068853_100041589 3300005539 Bacteria 3927
28 Ga0068853_100060654 3300005539 Bacteria 3269
29 Ga0068855_100000290 3300005563 Bacteria 62292
30 Ga0068855_100002062 3300005563 Bacteria 24904
31 Ga0068855_100158846 3300005563 Bacteria 2567
32 Ga0068855_100217907 3300005563 Bacteria 2142
33 Ga0068855_100526645 3300005563 Bacteria 1282
34 Ga0068857_100161251 3300005577 Bacteria 2035
35 Ga0068856_100059911 3300005614 Bacteria 3760
36 Ga0068856_100568418 3300005614 Bacteria 1155
37 Ga0068852_100085653 3300005616 Bacteria 2807
38 Ga0068852_100155924 3300005616 Bacteria 2127
39 Ga0068852_100314705 3300005616 Bacteria 1519
40 Ga0068866_10153913 3300005718 Unclassified 1334
41 Ga0068863_100258170 3300005841 Bacteria 1684
42 Ga0068858_100247640 3300005842 Bacteria 1692
43 Ga0075366_10000442 3300006195 Bacteria 19347
44 Ga0075366_10007174 3300006195 Bacteria 6139
45 Ga0097621_100000478 3300006237 Bacteria 28105
46 Ga0097621_100224829 3300006237 Bacteria 1636
47 Ga0068871_100000353 3300006358 Bacteria 31920
48 Ga0068871_100279275 3300006358 Bacteria 1461
49 Ga0105240_10000321 3300009093 Bacteria 90931
50 Ga0105240_10003566 3300009093 Bacteria 24139
51 Ga0105240_10019454 3300009093 Bacteria 9070
52 Ga0105240_10338130 3300009093 Bacteria 1711
53 Ga0105240_10422057 3300009093 Bacteria 1498
54 Ga0105241_10005156 3300009174 Bacteria 9639
55 Ga0105241_10006818 3300009174 Bacteria 8396
56 Ga0105241_10032854 3300009174 Bacteria 3893
57 Ga0105242_10105695 3300009176 Bacteria 2391
58 Ga0105237_10102462 3300009545 Bacteria 2854
59 Ga0105237_10110454 3300009545 Bacteria 2741
60 Ga0105237_10167251 3300009545 Bacteria 2198
61 Ga0105237_10205731 3300009545 Bacteria 1969
62 Ga0105238_10152029 3300009551 Bacteria 2290
63 Ga0105238_10159567 3300009551 Bacteria 2230
64 Ga0105239_10000014 3300010375 Bacteria 325391
65 Ga0105239_10000355 3300010375 Bacteria 67024
66 Ga0105239_10004274 3300010375 Bacteria 17134
67 Ga0105239_10089486 3300010375 Bacteria 3394
68 Ga0105239_10118469 3300010375 Bacteria 2938
69 Ga0105246_10077398 3300011119 Bacteria 2360
70 Ga0157373_10156531 3300013100 Bacteria 1603
71 Ga0157371_10009491 3300013102 Bacteria 7653
72 Ga0157370_10116398 3300013104 Bacteria 2497
73 Ga0157370_10423078 3300013104 Bacteria 1225
74 Ga0157369_10092243 3300013105 Bacteria 3232
75 Ga0157369_10125197 3300013105 Bacteria 2726
76 Ga0157374_10000180 3300013296 Bacteria 58547
77 Ga0157374_10057056 3300013296 Bacteria 3646
78 Ga0157374_10066751 3300013296 Bacteria 3381
79 Ga0157374_10446221 3300013296 Bacteria 1295
80 Ga0157378_10222600 3300013297 Bacteria 1794
81 Ga0157378_10255704 3300013297 Unclassified 1678
82 Ga0163162_10001839 3300013306 Bacteria 19962
83 Ga0163162_10025955 3300013306 Bacteria 5790
84 Ga0163162_10119854 3300013306 Bacteria 2734
85 Ga0163162_10152323 3300013306 Bacteria 2430
86 Ga0157372_10007329 3300013307 Bacteria 11743
87 Ga0157372_10011278 3300013307 Bacteria 9508
88 Ga0157372_10040956 3300013307 Bacteria 5120
89 Ga0157375_10742274 3300013308 Unclassified 1133
90 Ga0157377_10019893 3300014745 Bacteria 3511
91 Ga0157376_10255708 3300014969 Bacteria 1638
92 Ga0206351_10467652 3300020077 Bacteria 1337
93 Ga0209437_100124 3300025233 Bacteria 199789
94 Ga0207642_10120349 3300025899 Bacteria 1353
95 Ga0207647_10004540 3300025904 Bacteria 10291
96 Ga0207647_10046469 3300025904 Bacteria 2705
97 Ga0207645_10052548 3300025907 Bacteria 2604
98 Ga0207705_10058488 3300025909 Bacteria 2781
99 Ga0207654_10003331 3300025911 Bacteria 8134
100 Ga0207654_10016048 3300025911 Bacteria 3895
101 Ga0207695_10000197 3300025913 Bacteria 168837
102 Ga0207695_10019146 3300025913 Bacteria 7888
103 Ga0207695_10331164 3300025913 Bacteria 1411
104 Ga0207671_10031774 3300025914 Bacteria 3933
105 Ga0207671_10103244 3300025914 Bacteria 2162
106 Ga0207657_10050072 3300025919 Bacteria 3637
107 Ga0207690_10034171 3300025932 Bacteria 3275
108 Ga0207706_10003806 3300025933 Bacteria 14379
109 Ga0207704_10000972 3300025938 Bacteria 12695
110 Ga0207667_10000341 3300025949 Bacteria 63843
111 Ga0207667_10001302 3300025949 Bacteria 31255
112 Ga0207667_10129470 3300025949 Bacteria 2599
113 Ga0207667_10387129 3300025949 Bacteria 1424
114 Ga0207677_10029709 3300026023 Bacteria 3478
115 Ga0207677_10047599 3300026023 Bacteria 2880
116 Ga0207703_10196763 3300026035 Bacteria 1789
117 Ga0207702_10112069 3300026078 Bacteria 2427
118 Ga0207702_10666600 3300026078 Bacteria 1024
119 Ga0207648_10026794 3300026089 Bacteria 5120
120 Ga0207674_10012156 3300026116 Bacteria 9637
121 Ga0207683_10037699 3300026121 Bacteria 4210
122 Ga0207698_10098478 3300026142 Bacteria 2416
123 Ga0207698_10154531 3300026142 Bacteria 1997
124 Ga0207698_10305712 3300026142 Unclassified 1482
125 Ga0307517_10000212 3300028786 Bacteria 99215
126 Ga0307515_10002585 3300028794 Bacteria 39041
127 Ga0307515_10007801 3300028794 Bacteria 21063
128 Ga0307507_10000111 3300033179 Bacteria 134722
129 Ga0307510_10000231 3300033180 Bacteria 50152
130 Ga0395899_0017912 3300037312 Bacteria 5390
131 Ga0395900_0016320 3300037418 Bacteria 7569
132 Ga0395898_0022387 3300037466 Bacteria 6400
133 Ga0395901_0095493 3300038443 Bacteria 3115
134 Ga0436361_0484721 3300039447 Bacteria 5458
135 Ga0495592_0229142 3300046454 Bacteria 1238
136 Ga0495650_0000025 3300046471 Bacteria 486001
137 Ga0495650_0000095 3300046471 Bacteria 218020
138 Ga0495650_0074022 3300046471 Bacteria 1329
139 Ga0495585_0000017 3300046492 Bacteria 164054
140 Ga0495585_0000057 3300046492 Bacteria 113069
141 Ga0495607_0069336 3300046501 Bacteria 1974
142 Ga0495606_0000009 3300046507 Bacteria 306313
143 Ga0495606_0000026 3300046507 Bacteria 259118
144 Ga0495606_0050532 3300046507 Bacteria 2719
145 Ga0495606_0080495 3300046507 Bacteria 2027
146 Ga0495606_0106535 3300046507 Bacteria 1697
147 Ga0495606_0146350 3300046507 Bacteria 1391
148 Ga0495610_0001154 3300046512 Bacteria 24024
149 Ga0495610_0005897 3300046512 Bacteria 8583
150 Ga0495616_0002689 3300046513 Bacteria 11654
151 Ga0495616_0003284 3300046513 Bacteria 10400
152 Ga0495616_0004048 3300046513 Bacteria 9315
153 Ga0495631_0128669 3300046518 Unclassified 1088
154 Ga0495644_0001405 3300046523 Bacteria 9829
155 Ga0495648_0068047 3300046524 Bacteria 2080
156 Ga0495609_0015004 3300046538 Bacteria 3630
157 Ga0495633_0000785 3300046558 Bacteria 28402
158 Ga0495633_0004626 3300046558 Bacteria 8669
159 Ga0495633_0012788 3300046558 Bacteria 4447
160 Ga0495625_0000007 3300046660 Bacteria 565749
161 Ga0495625_0000008 3300046660 Bacteria 536165
162 Ga0495625_0001150 3300046660 Bacteria 34053
163 Ga0495625_0004476 3300046660 Bacteria 13194
164 Ga0495625_0014906 3300046660 Bacteria 6181
165 Ga0495625_0037087 3300046660 Bacteria 3578
166 Ga0495625_0050071 3300046660 Bacteria 2999
167 Ga0495625_0076917 3300046660 Bacteria 2332
168 Ga0495625_0113763 3300046660 Bacteria 1847
169 Ga0495661_0004315 3300046665 Bacteria 10297
170 Ga0495661_0006630 3300046665 Bacteria 8130
171 Ga0495661_0057341 3300046665 Bacteria 2326
172 Ga0495661_0078297 3300046665 Bacteria 1913
173 Ga0495670_0164619 3300046691 Bacteria 1166
174 Ga0495671_0043894 3300046692 Bacteria 2243
175 Ga0495649_0000006 3300046694 Bacteria 542188
176 Ga0495649_0000007 3300046694 Bacteria 518037
177 Ga0495683_0036941 3300047323 Bacteria 2478
178 Ga0495687_002743 3300047443 Bacteria 13651
179 Ga0495687_007395 3300047443 Bacteria 6471
180 Ga0495685_010946 3300047447 Bacteria 3051
181 Ga0495673_0022215 3300047469 Bacteria 3114
182 Ga0495686_0000113 3300047472 Bacteria 168307
183 Ga0495686_0000402 3300047472 Bacteria 68501
184 Ga0495686_0000748 3300047472 Bacteria 43100
185 Ga0495686_0016615 3300047472 Bacteria 4986
186 Ga0495686_0219553 3300047472 Bacteria 1082
187 Ga0495678_002752 3300049459 Bacteria 11535
188 Ga0495678_028919 3300049459 Bacteria 2332
189 nmdc:mga0k408_162880_c1 3300050493 Bacteria 1329
190 Ga0500635_0001585 3300053080 Bacteria 5484
191 Ga0500608_005418 3300053122 Bacteria 5067
192 Ga0500608_035122 3300053122 Unclassified 2390
193 Ga0500618_000006 3300053125 Bacteria 239188
194 Ga0500622_0173504 3300053156 Bacteria 1002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047443 Ga0495687_007395 Ga0495687_007395_5451_6305 221
2 3300006237 Ga0097621_100224829 Ga0097621_1002248292 227
3 3300006358 Ga0068871_100279275 Ga0068871_1002792751 227
4 3300013306 Ga0163162_10119854 Ga0163162_101198542 233
5 3300003320 rootH2_10015983 rootH2_100159834 243
6 3300003320 rootH2_10254663 rootH2_102546633 243
7 3300013306 Ga0163162_10152323 Ga0163162_101523232 243
8 3300046665 Ga0495661_0006630 Ga0495661_0006630_6611_7411 249
9 3300009093 Ga0105240_10000321 Ga0105240_100003217 250
10 3300009174 Ga0105241_10032854 Ga0105241_100328544 250
11 3300009545 Ga0105237_10167251 Ga0105237_101672512 250
12 3300010375 Ga0105239_10004274 Ga0105239_1000427417 250
13 3300025911 Ga0207654_10016048 Ga0207654_100160483 250
14 3300025913 Ga0207695_10000197 Ga0207695_1000019776 250
15 3300046691 Ga0495670_0164619 Ga0495670_0164619_61_837 250
16 3300005616 Ga0068852_100155924 Ga0068852_1001559242 251
17 3300013296 Ga0157374_10066751 Ga0157374_100667512 251
18 3300026142 Ga0207698_10154531 Ga0207698_101545312 251
19 3300028794 Ga0307515_10002585 Ga0307515_1000258526 253
20 3300005563 Ga0068855_100000290 Ga0068855_10000029031 254
21 3300005614 Ga0068856_100568418 Ga0068856_1005684182 254
22 3300025949 Ga0207667_10000341 Ga0207667_1000034130 254
23 3300026078 Ga0207702_10666600 Ga0207702_106666001 254
24 3300047472 Ga0495686_0000402 Ga0495686_0000402_16888_17673 254
25 3300005288 Ga0065714_10112022 Ga0065714_101120222 255
26 3300006195 Ga0075366_10007174 Ga0075366_100071745 255
27 3300013297 Ga0157378_10222600 Ga0157378_102226002 255
28 3300014969 Ga0157376_10255708 Ga0157376_102557082 255
29 3300005841 Ga0068863_100258170 Ga0068863_1002581703 256
30 3300028794 Ga0307515_10007801 Ga0307515_1000780114 256
31 3300046471 Ga0495650_0074022 Ga0495650_0074022_276_1070 257
32 3300046524 Ga0495648_0068047 Ga0495648_0068047_952_1737 257
33 3300053125 Ga0500618_000006 Ga0500618_000006_232549_233334 257
34 iso_pu_bacteria 2599185184 2599481177 257
35 iso_pu_bacteria 2919437846 2919439119 257
36 iso_pu_bacteria 2928078545 2928081770 257
37 iso_pu_bacteria 2928147474 2928151797 257
38 iso_pu_bacteria 2932082852 2932087107 257
39 3300003316 rootH1_10112531 rootH1_101125312 258
40 3300003322 rootL2_10140154 rootL2_101401546 258
41 3300046471 Ga0495650_0000095 Ga0495650_0000095_92822_93658 258
42 3300046492 Ga0495585_0000057 Ga0495585_0000057_92438_93274 258
43 3300046507 Ga0495606_0000009 Ga0495606_0000009_156992_157828 258
44 3300046507 Ga0495606_0050532 Ga0495606_0050532_443_1234 258
45 3300046512 Ga0495610_0005897 Ga0495610_0005897_1845_2681 258
46 3300046513 Ga0495616_0003284 Ga0495616_0003284_8319_9155 258
47 3300046523 Ga0495644_0001405 Ga0495644_0001405_5225_6007 258
48 3300046538 Ga0495609_0015004 Ga0495609_0015004_1831_2667 258
49 3300046558 Ga0495633_0004626 Ga0495633_0004626_792_1628 258
50 3300046660 Ga0495625_0000007 Ga0495625_0000007_175835_176671 258
51 3300046665 Ga0495661_0004315 Ga0495661_0004315_7876_8748 258
52 3300046665 Ga0495661_0057341 Ga0495661_0057341_1244_2080 258
53 3300046692 Ga0495671_0043894 Ga0495671_0043894_845_1681 258
54 3300046694 Ga0495649_0000007 Ga0495649_0000007_258483_259319 258
55 3300047447 Ga0495685_010946 Ga0495685_010946_1482_2264 258
56 3300047469 Ga0495673_0022215 Ga0495673_0022215_1720_2592 258
57 3300047472 Ga0495686_0000748 Ga0495686_0000748_272_1051 258
58 3300053156 Ga0500622_0173504 Ga0500622_0173504_147_983 258
59 3300006195 Ga0075366_10000442 Ga0075366_100004426 259
60 3300009093 Ga0105240_10422057 Ga0105240_104220572 259
61 3300010375 Ga0105239_10000014 Ga0105239_10000014270 259
62 3300033179 Ga0307507_10000111 Ga0307507_1000011153 259
63 3300046454 Ga0495592_0229142 Ga0495592_0229142_280_1074 259
64 3300046501 Ga0495607_0069336 Ga0495607_0069336_857_1651 259
65 3300046558 Ga0495633_0000785 Ga0495633_0000785_15035_15829 259
66 3300046660 Ga0495625_0001150 Ga0495625_0001150_10034_10999 259
67 3300053080 Ga0500635_0001585 Ga0500635_0001585_2599_3384 259
68 3300053122 Ga0500608_005418 Ga0500608_005418_2641_3435 259
69 iso_pu_bacteria 2599185184 2599476668 259
70 iso_pu_bacteria 2928078545 2928078618 259
71 iso_pu_bacteria 2928147474 2928151705 259
72 iso_pu_bacteria 2932082852 2932084322 259
73 3300003323 rootH1_10016558 rootH1_100165582 260
74 3300025909 Ga0207705_10058488 Ga0207705_100584882 260
75 3300046507 Ga0495606_0106535 Ga0495606_0106535_724_1515 260
76 3300046660 Ga0495625_0113763 Ga0495625_0113763_679_1476 260
77 3300001990 JGI24737J22298_10001803 JGI24737J22298_100018034 261
78 3300002067 JGI24735J21928_10000084 JGI24735J21928_1000008418 261
79 3300002737 JGI25162J39368_1000056 JGI25162J39368_10000564 261
80 3300005563 Ga0068855_100217907 Ga0068855_1002179071 261
81 3300005563 Ga0068855_100526645 Ga0068855_1005266451 261
82 3300005577 Ga0068857_100161251 Ga0068857_1001612512 261
83 3300005614 Ga0068856_100059911 Ga0068856_1000599112 261
84 3300009093 Ga0105240_10338130 Ga0105240_103381302 261
85 3300009545 Ga0105237_10102462 Ga0105237_101024621 261
86 3300009545 Ga0105237_10110454 Ga0105237_101104544 261
87 3300010375 Ga0105239_10000355 Ga0105239_100003554 261
88 3300010375 Ga0105239_10089486 Ga0105239_100894864 261
89 3300010375 Ga0105239_10118469 Ga0105239_101184693 261
90 3300013104 Ga0157370_10423078 Ga0157370_104230782 261
91 3300013306 Ga0163162_10025955 Ga0163162_100259554 261
92 3300013307 Ga0157372_10011278 Ga0157372_100112789 261
93 3300020077 Ga0206351_10467652 Ga0206351_104676521 261
94 3300025233 Ga0209437_100124 Ga0209437_1001249 261
95 3300025913 Ga0207695_10331164 Ga0207695_103311641 261
96 3300025914 Ga0207671_10031774 Ga0207671_100317744 261
97 3300025949 Ga0207667_10387129 Ga0207667_103871292 261
98 3300026078 Ga0207702_10112069 Ga0207702_101120693 261
99 3300026116 Ga0207674_10012156 Ga0207674_100121562 261
100 3300046507 Ga0495606_0080495 Ga0495606_0080495_116_997 261
101 3300046507 Ga0495606_0146350 Ga0495606_0146350_262_1098 261
102 3300046513 Ga0495616_0002689 Ga0495616_0002689_6748_7569 261
103 3300046513 Ga0495616_0004048 Ga0495616_0004048_2518_3324 261
104 3300046518 Ga0495631_0128669 Ga0495631_0128669_109_930 261
105 3300046660 Ga0495625_0004476 Ga0495625_0004476_3280_4086 261
106 3300046660 Ga0495625_0014906 Ga0495625_0014906_131_952 261
107 3300046660 Ga0495625_0037087 Ga0495625_0037087_1618_2424 261
108 3300046660 Ga0495625_0050071 Ga0495625_0050071_721_1542 261
109 3300046660 Ga0495625_0076917 Ga0495625_0076917_223_1029 261
110 3300047472 Ga0495686_0000113 Ga0495686_0000113_54775_55656 261
111 3300047472 Ga0495686_0219553 Ga0495686_0219553_156_959 261
112 3300049459 Ga0495678_002752 Ga0495678_002752_747_1553 261
113 3300049459 Ga0495678_028919 Ga0495678_028919_579_1400 261
114 3300005563 Ga0068855_100002062 Ga0068855_1000020629 262
115 3300025949 Ga0207667_10001302 Ga0207667_1000130230 262
116 3300001979 JGI24740J21852_10019368 JGI24740J21852_100193684 263
117 3300001989 JGI24739J22299_10005326 JGI24739J22299_100053264 263
118 3300001989 JGI24739J22299_10007026 JGI24739J22299_100070265 263
119 3300001990 JGI24737J22298_10000457 JGI24737J22298_100004577 263
120 3300001991 JGI24743J22301_10013281 JGI24743J22301_100132811 263
121 3300002067 JGI24735J21928_10000008 JGI24735J21928_10000008194 263
122 3300003322 rootL2_10049568 rootL2_100495684 263
123 3300003323 rootH1_10014855 rootH1_100148553 263
124 3300005328 Ga0070676_10105375 Ga0070676_101053752 263
125 3300005456 Ga0070678_100176578 Ga0070678_1001765782 263
126 3300005459 Ga0068867_100010706 Ga0068867_1000107062 263
127 3300005539 Ga0068853_100041589 Ga0068853_1000415893 263
128 3300005539 Ga0068853_100060654 Ga0068853_1000606543 263
129 3300005563 Ga0068855_100158846 Ga0068855_1001588462 263
130 3300005616 Ga0068852_100314705 Ga0068852_1003147052 263
131 3300005718 Ga0068866_10153913 Ga0068866_101539132 263
132 3300006237 Ga0097621_100000478 Ga0097621_10000047831 263
133 3300006358 Ga0068871_100000353 Ga0068871_10000035313 263
134 3300009093 Ga0105240_10019454 Ga0105240_100194545 263
135 3300009174 Ga0105241_10006818 Ga0105241_100068182 263
136 3300009176 Ga0105242_10105695 Ga0105242_101056955 263
137 3300009545 Ga0105237_10205731 Ga0105237_102057312 263
138 3300009551 Ga0105238_10152029 Ga0105238_101520292 263
139 3300009551 Ga0105238_10159567 Ga0105238_101595672 263
140 3300013102 Ga0157371_10009491 Ga0157371_100094913 263
141 3300013104 Ga0157370_10116398 Ga0157370_101163983 263
142 3300013105 Ga0157369_10125197 Ga0157369_101251973 263
143 3300013296 Ga0157374_10057056 Ga0157374_100570566 263
144 3300013296 Ga0157374_10446221 Ga0157374_104462211 263
145 3300013297 Ga0157378_10255704 Ga0157378_102557042 263
146 3300013306 Ga0163162_10001839 Ga0163162_100018392 263
147 3300013307 Ga0157372_10007329 Ga0157372_100073297 263
148 3300013308 Ga0157375_10742274 Ga0157375_107422742 263
149 3300025899 Ga0207642_10120349 Ga0207642_101203492 263
150 3300025904 Ga0207647_10046469 Ga0207647_100464693 263
151 3300025907 Ga0207645_10052548 Ga0207645_100525485 263
152 3300025914 Ga0207671_10103244 Ga0207671_101032442 263
153 3300025938 Ga0207704_10000972 Ga0207704_1000097214 263
154 3300025949 Ga0207667_10129470 Ga0207667_101294702 263
155 3300026023 Ga0207677_10047599 Ga0207677_100475995 263
156 3300026089 Ga0207648_10026794 Ga0207648_100267948 263
157 3300026121 Ga0207683_10037699 Ga0207683_100376993 263
158 3300026142 Ga0207698_10305712 Ga0207698_103057122 263
159 3300028786 Ga0307517_10000212 Ga0307517_1000021266 263
160 3300046471 Ga0495650_0000025 Ga0495650_0000025_25552_26352 263
161 3300046492 Ga0495585_0000017 Ga0495585_0000017_50447_51247 263
162 3300046507 Ga0495606_0000026 Ga0495606_0000026_36341_37141 263
163 3300046512 Ga0495610_0001154 Ga0495610_0001154_22348_23148 263
164 3300046558 Ga0495633_0012788 Ga0495633_0012788_2416_3216 263
165 3300046660 Ga0495625_0000008 Ga0495625_0000008_270000_270800 263
166 3300046665 Ga0495661_0078297 Ga0495661_0078297_835_1635 263
167 3300046694 Ga0495649_0000006 Ga0495649_0000006_495501_496301 263
168 3300047443 Ga0495687_002743 Ga0495687_002743_952_1752 263
169 3300047472 Ga0495686_0016615 Ga0495686_0016615_611_1411 263
170 3300050493 nmdc:mga0k408_162880_c1 nmdc:mga0k408_162880_c1_143_943 263
171 3300001904 JGI24736J21556_1000955 JGI24736J21556_10009557 264
172 3300001990 JGI24737J22298_10021010 JGI24737J22298_100210103 264
173 3300005338 Ga0068868_100037056 Ga0068868_1000370564 264
174 3300005339 Ga0070660_100014823 Ga0070660_1000148234 264
175 3300005366 Ga0070659_100035884 Ga0070659_1000358845 264
176 3300005457 Ga0070662_100003641 Ga0070662_1000036418 264
177 3300005616 Ga0068852_100085653 Ga0068852_1000856532 264
178 3300005842 Ga0068858_100247640 Ga0068858_1002476401 264
179 3300009093 Ga0105240_10003566 Ga0105240_1000356617 264
180 3300009174 Ga0105241_10005156 Ga0105241_100051568 264
181 3300011119 Ga0105246_10077398 Ga0105246_100773982 264
182 3300013100 Ga0157373_10156531 Ga0157373_101565312 264
183 3300013105 Ga0157369_10092243 Ga0157369_100922432 264
184 3300013296 Ga0157374_10000180 Ga0157374_1000018014 264
185 3300013307 Ga0157372_10040956 Ga0157372_100409568 264
186 3300014745 Ga0157377_10019893 Ga0157377_100198933 264
187 3300025904 Ga0207647_10004540 Ga0207647_100045408 264
188 3300025911 Ga0207654_10003331 Ga0207654_100033315 264
189 3300025913 Ga0207695_10019146 Ga0207695_100191462 264
190 3300025919 Ga0207657_10050072 Ga0207657_100500722 264
191 3300025932 Ga0207690_10034171 Ga0207690_100341715 264
192 3300025933 Ga0207706_10003806 Ga0207706_1000380613 264
193 3300026023 Ga0207677_10029709 Ga0207677_100297092 264
194 3300026035 Ga0207703_10196763 Ga0207703_101967631 264
195 3300026142 Ga0207698_10098478 Ga0207698_100984781 264
196 3300033180 Ga0307510_10000231 Ga0307510_1000023111 264
197 3300037312 Ga0395899_0017912 Ga0395899_0017912_3188_3994 264
198 3300037418 Ga0395900_0016320 Ga0395900_0016320_1842_2648 264
199 3300037466 Ga0395898_0022387 Ga0395898_0022387_2846_3652 264
200 3300038443 Ga0395901_0095493 Ga0395901_0095493_596_1402 264
201 3300039447 Ga0436361_0484721 Ga0436361_0484721_1383_2183 264
202 3300047323 Ga0495683_0036941 Ga0495683_0036941_1234_2040 264
203 3300053122 Ga0500608_035122 Ga0500608_035122_1167_1973 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06764

DUF1223

Protein of unknown function (DUF1223)

101

300

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u4m-assembly1.cif.gz_A crystal structure of human gpx4-u46c in complex with loc1886 0.7741 39 81
2f8a-assembly1.cif.gz_A crystal structure of the selenocysteine to glycine mutant of human glutathione peroxidase 1 0.7736 39 81
6hkq-assembly1.cif.gz_A human gpx4 in complex with covalent inhibitor ml162 (s enantiomer) 0.7714 39 81
7u4k-assembly1.cif.gz_A crystal structure of human gpx4-u46c-r152h in complex with ml162 0.7698 39 81
7u4j-assembly1.cif.gz_A crystal structure of human gpx4-u46c-r152h in complex with tmt10 0.7692 39 81
ID Description Score Start End Superfamily
af_I1LUV6_45_256_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8399 44 241 2.60.40.640
af_Q9VGV0_159_276_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8224 40 80 3.40.30.10
af_Q6Z402_152_270_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7919 150 257 2.60.40.10
af_I1LUV6_45_256_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7856 44 241 2.60.40.640
2g59B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7746 145 171 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A495LZF4-F1-model_v4 Uncharacterized protein DUF1223 0.9425 38 257 GO:0016020
AF-V6SK93-F1-model_v4 DUF1223 domain-containing protein 0.9423 40 257
AF-A0A4Q1EPF3-F1-model_v4 DUF1223 domain-containing protein 0.9398 39 257
AF-A0A4Q7UBL7-F1-model_v4 DUF1223 domain-containing protein 0.9343 37 255
AF-A0A7D4UNN8-F1-model_v4 DUF1223 domain-containing protein 0.9278 38 260

Feature Viewer

pLDDT pTM Quality
79.35 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map