F311631

General Info

Members Datasets Scaffolds Average Seq Length
203 142 201 186

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0675006|Ga0495628_0675006_97_654
Length 185
Sequence MKSKRMLVGAGISSALIILAAGAALSGQDRYSLAVPGGLAFSEFRGYENWQVISVSNGGLLAVILGNPAMIAAYKAGIPANGKPVPDGAKMAKIHWNPKKDPAIPGQPFMPDTLHDVDFMVKDSKRFADSGGWGYGEFEYDAASSTFRPGTTADKPPQKNDAKCGFACHTHVKQRDYVFTEYPSR

Samples

Sample ID Description Type Environment
1 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
114 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
115 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
116 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0.99
Rhizoplane 1.48
Rhizosphere 91.63
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1032060 3300001977 Bacteria 725
2 Ga0065707_10081725 3300005295 Bacteria 60705
3 Ga0070658_10792881 3300005327 Unclassified 823
4 Ga0070683_100013398 3300005329 Bacteria 7151
5 Ga0070683_100473431 3300005329 Bacteria 1196
6 Ga0070677_10272096 3300005333 Bacteria 850
7 Ga0068869_100475782 3300005334 Unclassified 1039
8 Ga0070666_10094107 3300005335 Bacteria 2061
9 Ga0070680_100100810 3300005336 Bacteria 2397
10 Ga0068868_100001469 3300005338 Bacteria 16273
11 Ga0068868_100476918 3300005338 Bacteria 1089
12 Ga0070660_100226629 3300005339 Bacteria 1520
13 Ga0070661_100182306 3300005344 Bacteria 1598
14 Ga0070661_100550370 3300005344 Unclassified 928
15 Ga0070668_100038491 3300005347 Bacteria 3655
16 Ga0070673_100018152 3300005364 Bacteria 5021
17 Ga0070659_100082707 3300005366 Bacteria 2565
18 Ga0070659_100592552 3300005366 Bacteria 952
19 Ga0070667_100271098 3300005367 Bacteria 1522
20 Ga0070705_100273357 3300005440 Bacteria 1198
21 Ga0070700_100085437 3300005441 Bacteria 2047
22 Ga0070694_100192653 3300005444 Bacteria 1515
23 Ga0070708_100505449 3300005445 Unclassified 1140
24 Ga0070663_100032369 3300005455 Bacteria 3604
25 Ga0070663_100876096 3300005455 Bacteria 774
26 Ga0070678_100198072 3300005456 Bacteria 1656
27 Ga0070662_100044732 3300005457 Bacteria 3173
28 Ga0070662_100136701 3300005457 Bacteria 1895
29 Ga0070681_10140595 3300005458 Bacteria 2344
30 Ga0070679_100085352 3300005530 Bacteria 3144
31 Ga0070679_100767367 3300005530 Bacteria 907
32 Ga0070693_100746176 3300005547 Bacteria 721
33 Ga0068855_100195640 3300005563 Bacteria 2278
34 Ga0068855_100657316 3300005563 Bacteria 1125
35 Ga0070664_100334216 3300005564 Bacteria 1375
36 Ga0068857_100180008 3300005577 Bacteria 1924
37 Ga0068856_100039048 3300005614 Bacteria 4661
38 Ga0070702_100432576 3300005615 Unclassified 950
39 Ga0068864_100004436 3300005618 Bacteria 11530
40 Ga0068864_100045770 3300005618 Bacteria 3753
41 Ga0068861_100024158 3300005719 Bacteria 4392
42 Ga0068861_100035653 3300005719 Bacteria 3686
43 Ga0068851_10214886 3300005834 Unclassified 1078
44 Ga0068863_100520233 3300005841 Bacteria 1173
45 Ga0068858_100028484 3300005842 Bacteria 5189
46 Ga0068858_100770277 3300005842 Bacteria 938
47 Ga0068860_100382405 3300005843 Bacteria 1390
48 Ga0068862_100006355 3300005844 Bacteria 9825
49 Ga0068862_100615993 3300005844 Bacteria 1044
50 Ga0075366_10542134 3300006195 Bacteria 720
51 Ga0097621_100123311 3300006237 Bacteria 2199
52 Ga0068871_100119096 3300006358 Bacteria 2228
53 Ga0068871_100817836 3300006358 Bacteria 860
54 Ga0075428_100176870 3300006844 Bacteria 2311
55 Ga0075430_100003195 3300006846 Bacteria 13726
56 Ga0075430_100366282 3300006846 Bacteria 1190
57 Ga0075431_100011577 3300006847 Bacteria 8894
58 Ga0068865_100056271 3300006881 Bacteria 2740
59 Ga0068865_100310947 3300006881 Bacteria 1264
60 Ga0105240_10002303 3300009093 Bacteria 30876
61 Ga0105240_10050440 3300009093 Bacteria 5247
62 Ga0105240_10621392 3300009093 Bacteria 1187
63 Ga0111539_10012422 3300009094 Bacteria 10678
64 Ga0111539_10102095 3300009094 Bacteria 3366
65 Ga0111539_10342071 3300009094 Bacteria 1741
66 Ga0105247_10411057 3300009101 Unclassified 966
67 Ga0114129_11015534 3300009147 Bacteria 1044
68 Ga0114129_11302703 3300009147 Bacteria 900
69 Ga0105242_10320770 3300009176 Bacteria 1421
70 Ga0105248_10003266 3300009177 Bacteria 17984
71 Ga0105248_10498744 3300009177 Bacteria 1372
72 Ga0105237_10121422 3300009545 Bacteria 2607
73 Ga0105237_10396474 3300009545 Bacteria 1385
74 Ga0105249_10049460 3300009553 Bacteria 3834
75 Ga0105239_10060503 3300010375 Bacteria 4157
76 Ga0105239_10825460 3300010375 Bacteria 1062
77 Ga0105246_10468364 3300011119 Bacteria 1063
78 Ga0157373_10053523 3300013100 Bacteria 2870
79 Ga0157369_10783771 3300013105 Unclassified 980
80 Ga0157374_10014657 3300013296 Bacteria 6862
81 Ga0157374_10059348 3300013296 Bacteria 3577
82 Ga0157374_10478606 3300013296 Bacteria 1248
83 Ga0157374_11663227 3300013296 Bacteria 663
84 Ga0163162_10055561 3300013306 Bacteria 3987
85 Ga0163162_10486967 3300013306 Bacteria 1365
86 Ga0157372_10004955 3300013307 Bacteria 14145
87 Ga0157372_10032158 3300013307 Bacteria 5750
88 Ga0157375_10020613 3300013308 Bacteria 6026
89 Ga0157375_10131481 3300013308 Bacteria 2622
90 Ga0157377_10167748 3300014745 Unclassified 1370
91 Ga0157379_10008231 3300014968 Bacteria 9055
92 Ga0157379_10075983 3300014968 Bacteria 3008
93 Ga0163161_10009193 3300017792 Bacteria 6831
94 Ga0163161_10959420 3300017792 Bacteria 728
95 Ga0209759_1022947 3300025256 Bacteria 1385
96 Ga0207656_10101515 3300025321 Bacteria 1319
97 Ga0207682_10075285 3300025893 Bacteria 1437
98 Ga0207680_10665124 3300025903 Bacteria 746
99 Ga0207645_10048936 3300025907 Bacteria 2700
100 Ga0207645_10163440 3300025907 Unclassified 1457
101 Ga0207645_10295328 3300025907 Bacteria 1078
102 Ga0207705_10155381 3300025909 Bacteria 1716
103 Ga0207705_10425870 3300025909 Unclassified 1028
104 Ga0207654_10108571 3300025911 Bacteria 1722
105 Ga0207695_10176199 3300025913 Bacteria 2061
106 Ga0207695_10479914 3300025913 Bacteria 1125
107 Ga0207671_10018036 3300025914 Bacteria 5427
108 Ga0207671_10035130 3300025914 Bacteria 3722
109 Ga0207671_10201052 3300025914 Bacteria 1556
110 Ga0207671_10319188 3300025914 Bacteria 1229
111 Ga0207660_10047161 3300025917 Bacteria 3044
112 Ga0207652_10066994 3300025921 Bacteria 3113
113 Ga0207652_10869057 3300025921 Bacteria 798
114 Ga0207694_10584193 3300025924 Unclassified 939
115 Ga0207650_10436496 3300025925 Bacteria 1088
116 Ga0207659_10787659 3300025926 Bacteria 816
117 Ga0207644_10488366 3300025931 Bacteria 1015
118 Ga0207644_10874267 3300025931 Bacteria 753
119 Ga0207690_10039403 3300025932 Bacteria 3083
120 Ga0207690_10380551 3300025932 Bacteria 1122
121 Ga0207706_10065667 3300025933 Bacteria 3195
122 Ga0207706_10073839 3300025933 Bacteria 2999
123 Ga0207706_10840416 3300025933 Bacteria 778
124 Ga0207704_10213083 3300025938 Bacteria 1423
125 Ga0207704_11171995 3300025938 Unclassified 654
126 Ga0207711_10017704 3300025941 Bacteria 5920
127 Ga0207711_10469516 3300025941 Bacteria 1172
128 Ga0207689_10003719 3300025942 Bacteria 13903
129 Ga0207689_11084918 3300025942 Bacteria 675
130 Ga0207661_10012673 3300025944 Bacteria 6137
131 Ga0207661_10625315 3300025944 Bacteria 989
132 Ga0207679_10158676 3300025945 Bacteria 1849
133 Ga0207679_10605529 3300025945 Unclassified 988
134 Ga0207667_10186857 3300025949 Bacteria 2127
135 Ga0207651_10885761 3300025960 Bacteria 794
136 Ga0207712_10009436 3300025961 Bacteria 6175
137 Ga0207712_10190210 3300025961 Bacteria 1619
138 Ga0207668_10003776 3300025972 Bacteria 8921
139 Ga0207668_10998970 3300025972 Unclassified 748
140 Ga0207677_10008846 3300026023 Bacteria 5645
141 Ga0207677_10250245 3300026023 Bacteria 1439
142 Ga0207703_10480459 3300026035 Unclassified 1164
143 Ga0207678_10056206 3300026067 Bacteria 3388
144 Ga0207708_10149768 3300026075 Bacteria 1836
145 Ga0207702_10030700 3300026078 Bacteria 4477
146 Ga0207676_10050083 3300026095 Bacteria 3254
147 Ga0207676_10173266 3300026095 Bacteria 1882
148 Ga0207674_10230530 3300026116 Bacteria 1799
149 Ga0207675_100000379 3300026118 Bacteria 42654
150 Ga0207683_10027392 3300026121 Bacteria 4924
151 Ga0207683_10333950 3300026121 Bacteria 1389
152 Ga0207698_11173496 3300026142 Bacteria 782
153 Ga0268266_10055159 3300028379 Bacteria 3416
154 Ga0268265_10098910 3300028380 Bacteria 2350
155 Ga0268265_10847802 3300028380 Bacteria 894
156 Ga0268264_10430013 3300028381 Bacteria 1275
157 Ga0307413_10188149 3300031824 Bacteria 1480
158 Ga0307410_10163426 3300031852 Bacteria 1671
159 Ga0373940_0071108 3300035088 Unclassified 1013
160 Ga0373961_0238387 3300035241 Unclassified 654
161 Ga0373931_0051232 3300035691 Bacteria 2198
162 Ga0395905_0569723 3300037471 Bacteria 1034
163 Ga0436363_0645676 3300039450 Bacteria 755
164 Ga0436363_1672590 3300039450 Bacteria 1048
165 Ga0451847_0619807 3300041503 Bacteria 535
166 Ga0439455_0017839 3300042012 Bacteria 1659
167 Ga0450914_017031 3300042118 Bacteria 776
168 Ga0439459_0034440 3300042438 Bacteria 1047
169 Ga0439460_0114051 3300042461 Bacteria 879
170 Ga0439440_0048118 3300042993 Bacteria 1059
171 Ga0466971_0253682 3300044719 Bacteria 838
172 Ga0451576_0390626 3300045051 Bacteria 1459
173 Ga0495638_0000808 3300046460 Bacteria 33041
174 Ga0495594_0152245 3300046499 Bacteria 1313
175 Ga0495594_0193295 3300046499 Bacteria 1159
176 Ga0495628_0675006 3300046516 Bacteria 732
177 Ga0495665_0286976 3300046531 Bacteria 844
178 Ga0495625_0003352 3300046660 Bacteria 16114
179 Ga0495635_0319264 3300046663 Bacteria 1040
180 Ga0495613_0400796 3300046689 Bacteria 936
181 Ga0495676_0425835 3300047321 Bacteria 878
182 Ga0495680_0512863 3300047322 Bacteria 812
183 Ga0495686_0012943 3300047472 Bacteria 5817
184 Ga0496113_0650532 3300048916 Bacteria 843
185 Ga0496114_0419716 3300048917 Unclassified 1185
186 Ga0496114_1150847 3300048917 Unclassified 661
187 Ga0496121_0034917 3300048924 Bacteria 4515
188 Ga0496121_0073997 3300048924 Bacteria 2727
189 nmdc:mga0k408_397924_c1 3300050493 Bacteria 820
190 nmdc:mga0k408_446360_c1 3300050493 Bacteria 768
191 nmdc:mga05p37_620940_c2 3300050507 Bacteria 920
192 nmdc:mga09592_158489_c1 3300050508 Bacteria 1954
193 nmdc:mga0qj67_5895_c1 3300050509 Bacteria 8977
194 nmdc:mga0qj67_736716_c1 3300050509 Bacteria 783
195 nmdc:mga06r32_3731_c1 3300050510 Bacteria 13635
196 nmdc:mga08y16_11485_c1 3300050511 Bacteria 9304
197 nmdc:mga08y16_173396_c1 3300050511 Bacteria 2240
198 nmdc:mga0rr50_242203_c1 3300050513 Bacteria 1495
199 Ga0500610_0068358 3300053079 Bacteria 1853
200 Ga0500568_0032577 3300053139 Bacteria 2142
201 Ga0500604_0163126 3300053151 Bacteria 760

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041503 Ga0451847_0619807 Ga0451847_0619807_33_521 158
2 3300050508 nmdc:mga09592_158489_c1 nmdc:mga09592_158489_c1_1454_1942 161
3 3300050513 nmdc:mga0rr50_242203_c1 nmdc:mga0rr50_242203_c1_959_1444 161
4 3300048916 Ga0496113_0650532 Ga0496113_0650532_11_502 163
5 3300046531 Ga0495665_0286976 Ga0495665_0286976_312_812 166
6 3300047472 Ga0495686_0012943 Ga0495686_0012943_1610_2134 167
7 3300028380 Ga0268265_10847802 Ga0268265_108478022 168
8 3300042118 Ga0450914_017031 Ga0450914_017031_168_740 168
9 3300042993 Ga0439440_0048118 Ga0439440_0048118_224_796 168
10 3300044719 Ga0466971_0253682 Ga0466971_0253682_221_760 171
11 3300005329 Ga0070683_100473431 Ga0070683_1004734312 173
12 3300025944 Ga0207661_10625315 Ga0207661_106253152 173
13 3300009093 Ga0105240_10002303 Ga0105240_1000230326 175
14 3300005366 Ga0070659_100592552 Ga0070659_1005925521 179
15 3300009094 Ga0111539_10102095 Ga0111539_101020951 179
16 3300025909 Ga0207705_10155381 Ga0207705_101553812 179
17 3300025932 Ga0207690_10380551 Ga0207690_103805512 179
18 3300026142 Ga0207698_11173496 Ga0207698_111734961 179
19 3300035691 Ga0373931_0051232 Ga0373931_0051232_1242_1784 179
20 3300005530 Ga0070679_100767367 Ga0070679_1007673671 180
21 3300013296 Ga0157374_11663227 Ga0157374_116632271 180
22 3300025914 Ga0207671_10035130 Ga0207671_100351303 180
23 3300025914 Ga0207671_10319188 Ga0207671_103191881 180
24 3300025921 Ga0207652_10869057 Ga0207652_108690571 180
25 3300005333 Ga0070677_10272096 Ga0070677_102720962 182
26 3300005364 Ga0070673_100018152 Ga0070673_1000181525 182
27 3300006844 Ga0075428_100176870 Ga0075428_1001768703 182
28 3300006846 Ga0075430_100003195 Ga0075430_1000031955 182
29 3300006847 Ga0075431_100011577 Ga0075431_1000115775 182
30 3300025893 Ga0207682_10075285 Ga0207682_100752851 182
31 3300025907 Ga0207645_10295328 Ga0207645_102953282 182
32 3300025931 Ga0207644_10488366 Ga0207644_104883661 182
33 3300025933 Ga0207706_10840416 Ga0207706_108404161 182
34 3300025960 Ga0207651_10885761 Ga0207651_108857611 182
35 3300042012 Ga0439455_0017839 Ga0439455_0017839_389_937 182
36 3300042438 Ga0439459_0034440 Ga0439459_0034440_263_811 182
37 3300046499 Ga0495594_0193295 Ga0495594_0193295_421_969 182
38 3300050509 nmdc:mga0qj67_5895_c1 nmdc:mga0qj67_5895_c1_7307_7855 182
39 3300050510 nmdc:mga06r32_3731_c1 nmdc:mga06r32_3731_c1_3267_3815 182
40 3300005295 Ga0065707_10081725 Ga0065707_1008172512 183
41 3300005334 Ga0068869_100475782 Ga0068869_1004757821 183
42 3300005335 Ga0070666_10094107 Ga0070666_100941072 183
43 3300005336 Ga0070680_100100810 Ga0070680_1001008102 183
44 3300005338 Ga0068868_100001469 Ga0068868_10000146914 183
45 3300005339 Ga0070660_100226629 Ga0070660_1002266291 183
46 3300005344 Ga0070661_100182306 Ga0070661_1001823061 183
47 3300005344 Ga0070661_100550370 Ga0070661_1005503701 183
48 3300005347 Ga0070668_100038491 Ga0070668_1000384914 183
49 3300005367 Ga0070667_100271098 Ga0070667_1002710983 183
50 3300005441 Ga0070700_100085437 Ga0070700_1000854372 183
51 3300005445 Ga0070708_100505449 Ga0070708_1005054492 183
52 3300005455 Ga0070663_100032369 Ga0070663_1000323693 183
53 3300005455 Ga0070663_100876096 Ga0070663_1008760961 183
54 3300005457 Ga0070662_100044732 Ga0070662_1000447322 183
55 3300005457 Ga0070662_100136701 Ga0070662_1001367012 183
56 3300005458 Ga0070681_10140595 Ga0070681_101405952 183
57 3300005530 Ga0070679_100085352 Ga0070679_1000853522 183
58 3300005547 Ga0070693_100746176 Ga0070693_1007461761 183
59 3300005563 Ga0068855_100195640 Ga0068855_1001956402 183
60 3300005564 Ga0070664_100334216 Ga0070664_1003342162 183
61 3300005577 Ga0068857_100180008 Ga0068857_1001800081 183
62 3300005615 Ga0070702_100432576 Ga0070702_1004325761 183
63 3300005618 Ga0068864_100004436 Ga0068864_1000044362 183
64 3300005618 Ga0068864_100045770 Ga0068864_1000457703 183
65 3300005719 Ga0068861_100024158 Ga0068861_1000241586 183
66 3300005719 Ga0068861_100035653 Ga0068861_1000356532 183
67 3300005834 Ga0068851_10214886 Ga0068851_102148861 183
68 3300005841 Ga0068863_100520233 Ga0068863_1005202331 183
69 3300005842 Ga0068858_100028484 Ga0068858_1000284846 183
70 3300005842 Ga0068858_100770277 Ga0068858_1007702771 183
71 3300005843 Ga0068860_100382405 Ga0068860_1003824051 183
72 3300005844 Ga0068862_100006355 Ga0068862_1000063554 183
73 3300005844 Ga0068862_100615993 Ga0068862_1006159932 183
74 3300006237 Ga0097621_100123311 Ga0097621_1001233113 183
75 3300006358 Ga0068871_100119096 Ga0068871_1001190963 183
76 3300006358 Ga0068871_100817836 Ga0068871_1008178361 183
77 3300006881 Ga0068865_100056271 Ga0068865_1000562712 183
78 3300009093 Ga0105240_10050440 Ga0105240_100504401 183
79 3300009094 Ga0111539_10012422 Ga0111539_100124228 183
80 3300009094 Ga0111539_10342071 Ga0111539_103420712 183
81 3300009101 Ga0105247_10411057 Ga0105247_104110571 183
82 3300009147 Ga0114129_11302703 Ga0114129_113027032 183
83 3300009177 Ga0105248_10003266 Ga0105248_100032662 183
84 3300009545 Ga0105237_10121422 Ga0105237_101214222 183
85 3300009545 Ga0105237_10396474 Ga0105237_103964742 183
86 3300009553 Ga0105249_10049460 Ga0105249_100494602 183
87 3300010375 Ga0105239_10060503 Ga0105239_100605033 183
88 3300011119 Ga0105246_10468364 Ga0105246_104683642 183
89 3300013296 Ga0157374_10059348 Ga0157374_100593481 183
90 3300013296 Ga0157374_10478606 Ga0157374_104786062 183
91 3300013306 Ga0163162_10055561 Ga0163162_100555614 183
92 3300013306 Ga0163162_10486967 Ga0163162_104869672 183
93 3300013307 Ga0157372_10032158 Ga0157372_100321582 183
94 3300013308 Ga0157375_10020613 Ga0157375_100206137 183
95 3300013308 Ga0157375_10131481 Ga0157375_101314813 183
96 3300014745 Ga0157377_10167748 Ga0157377_101677482 183
97 3300014968 Ga0157379_10008231 Ga0157379_100082312 183
98 3300014968 Ga0157379_10075983 Ga0157379_100759835 183
99 3300017792 Ga0163161_10009193 Ga0163161_100091938 183
100 3300025256 Ga0209759_1022947 Ga0209759_10229472 183
101 3300025321 Ga0207656_10101515 Ga0207656_101015151 183
102 3300025907 Ga0207645_10048936 Ga0207645_100489363 183
103 3300025907 Ga0207645_10163440 Ga0207645_101634402 183
104 3300025911 Ga0207654_10108571 Ga0207654_101085712 183
105 3300025913 Ga0207695_10176199 Ga0207695_101761992 183
106 3300025914 Ga0207671_10018036 Ga0207671_100180361 183
107 3300025914 Ga0207671_10201052 Ga0207671_102010521 183
108 3300025917 Ga0207660_10047161 Ga0207660_100471612 183
109 3300025921 Ga0207652_10066994 Ga0207652_100669942 183
110 3300025924 Ga0207694_10584193 Ga0207694_105841931 183
111 3300025925 Ga0207650_10436496 Ga0207650_104364962 183
112 3300025926 Ga0207659_10787659 Ga0207659_107876592 183
113 3300025931 Ga0207644_10874267 Ga0207644_108742672 183
114 3300025933 Ga0207706_10065667 Ga0207706_100656672 183
115 3300025933 Ga0207706_10073839 Ga0207706_100738393 183
116 3300025938 Ga0207704_10213083 Ga0207704_102130831 183
117 3300025938 Ga0207704_11171995 Ga0207704_111719951 183
118 3300025941 Ga0207711_10017704 Ga0207711_100177042 183
119 3300025942 Ga0207689_10003719 Ga0207689_1000371911 183
120 3300025945 Ga0207679_10158676 Ga0207679_101586761 183
121 3300025945 Ga0207679_10605529 Ga0207679_106055292 183
122 3300025949 Ga0207667_10186857 Ga0207667_101868573 183
123 3300025961 Ga0207712_10009436 Ga0207712_100094363 183
124 3300025972 Ga0207668_10003776 Ga0207668_100037762 183
125 3300025972 Ga0207668_10998970 Ga0207668_109989701 183
126 3300026023 Ga0207677_10008846 Ga0207677_100088466 183
127 3300026023 Ga0207677_10250245 Ga0207677_102502451 183
128 3300026035 Ga0207703_10480459 Ga0207703_104804591 183
129 3300026067 Ga0207678_10056206 Ga0207678_100562063 183
130 3300026075 Ga0207708_10149768 Ga0207708_101497682 183
131 3300026095 Ga0207676_10050083 Ga0207676_100500833 183
132 3300026095 Ga0207676_10173266 Ga0207676_101732662 183
133 3300026116 Ga0207674_10230530 Ga0207674_102305302 183
134 3300026118 Ga0207675_100000379 Ga0207675_10000037933 183
135 3300026121 Ga0207683_10333950 Ga0207683_103339502 183
136 3300028380 Ga0268265_10098910 Ga0268265_100989102 183
137 3300031824 Ga0307413_10188149 Ga0307413_101881492 183
138 3300031852 Ga0307410_10163426 Ga0307410_101634262 183
139 3300035088 Ga0373940_0071108 Ga0373940_0071108_376_945 183
140 3300035241 Ga0373961_0238387 Ga0373961_0238387_47_616 183
141 3300037471 Ga0395905_0569723 Ga0395905_0569723_389_964 183
142 3300039450 Ga0436363_1672590 Ga0436363_1672590_256_828 183
143 3300045051 Ga0451576_0390626 Ga0451576_0390626_654_1223 183
144 3300046460 Ga0495638_0000808 Ga0495638_0000808_15850_16422 183
145 3300046499 Ga0495594_0152245 Ga0495594_0152245_585_1148 183
146 3300046516 Ga0495628_0675006 Ga0495628_0675006_97_654 183
147 3300046660 Ga0495625_0003352 Ga0495625_0003352_13364_13936 183
148 3300046663 Ga0495635_0319264 Ga0495635_0319264_141_704 183
149 3300046689 Ga0495613_0400796 Ga0495613_0400796_129_692 183
150 3300047321 Ga0495676_0425835 Ga0495676_0425835_134_697 183
151 3300047322 Ga0495680_0512863 Ga0495680_0512863_86_649 183
152 3300048917 Ga0496114_0419716 Ga0496114_0419716_267_836 183
153 3300048924 Ga0496121_0034917 Ga0496121_0034917_348_935 183
154 3300048924 Ga0496121_0073997 Ga0496121_0073997_1067_1666 183
155 3300050507 nmdc:mga05p37_620940_c2 nmdc:mga05p37_620940_c2_148_720 183
156 3300050511 nmdc:mga08y16_11485_c1 nmdc:mga08y16_11485_c1_6678_7250 183
157 3300050511 nmdc:mga08y16_173396_c1 nmdc:mga08y16_173396_c1_204_779 183
158 3300053079 Ga0500610_0068358 Ga0500610_0068358_31_645 183
159 3300053139 Ga0500568_0032577 Ga0500568_0032577_663_1235 183
160 3300053151 Ga0500604_0163126 Ga0500604_0163126_161_733 183
161 3300001977 JGI24746J21847_1032060 JGI24746J21847_10320601 184
162 3300005327 Ga0070658_10792881 Ga0070658_107928812 184
163 3300005329 Ga0070683_100013398 Ga0070683_1000133984 184
164 3300005338 Ga0068868_100476918 Ga0068868_1004769182 184
165 3300005366 Ga0070659_100082707 Ga0070659_1000827074 184
166 3300005440 Ga0070705_100273357 Ga0070705_1002733571 184
167 3300005444 Ga0070694_100192653 Ga0070694_1001926532 184
168 3300005456 Ga0070678_100198072 Ga0070678_1001980722 184
169 3300005563 Ga0068855_100657316 Ga0068855_1006573162 184
170 3300005614 Ga0068856_100039048 Ga0068856_1000390484 184
171 3300006195 Ga0075366_10542134 Ga0075366_105421341 184
172 3300006846 Ga0075430_100366282 Ga0075430_1003662821 184
173 3300006881 Ga0068865_100310947 Ga0068865_1003109472 184
174 3300009093 Ga0105240_10621392 Ga0105240_106213922 184
175 3300009147 Ga0114129_11015534 Ga0114129_110155342 184
176 3300009176 Ga0105242_10320770 Ga0105242_103207702 184
177 3300009177 Ga0105248_10498744 Ga0105248_104987442 184
178 3300010375 Ga0105239_10825460 Ga0105239_108254602 184
179 3300013100 Ga0157373_10053523 Ga0157373_100535233 184
180 3300013105 Ga0157369_10783771 Ga0157369_107837712 184
181 3300013296 Ga0157374_10014657 Ga0157374_100146573 184
182 3300013307 Ga0157372_10004955 Ga0157372_1000495514 184
183 3300017792 Ga0163161_10959420 Ga0163161_109594201 184
184 3300025903 Ga0207680_10665124 Ga0207680_106651242 184
185 3300025909 Ga0207705_10425870 Ga0207705_104258702 184
186 3300025913 Ga0207695_10479914 Ga0207695_104799142 184
187 3300025932 Ga0207690_10039403 Ga0207690_100394035 184
188 3300025941 Ga0207711_10469516 Ga0207711_104695161 184
189 3300025942 Ga0207689_11084918 Ga0207689_110849181 184
190 3300025944 Ga0207661_10012673 Ga0207661_100126736 184
191 3300025961 Ga0207712_10190210 Ga0207712_101902103 184
192 3300026078 Ga0207702_10030700 Ga0207702_100307005 184
193 3300026121 Ga0207683_10027392 Ga0207683_100273923 184
194 3300028379 Ga0268266_10055159 Ga0268266_100551593 184
195 3300028381 Ga0268264_10430013 Ga0268264_104300132 184
196 3300039450 Ga0436363_0645676 Ga0436363_0645676_171_731 184
197 3300042461 Ga0439460_0114051 Ga0439460_0114051_231_785 184
198 3300048917 Ga0496114_1150847 Ga0496114_1150847_75_629 184
199 3300050493 nmdc:mga0k408_397924_c1 nmdc:mga0k408_397924_c1_49_603 184
200 3300050493 nmdc:mga0k408_446360_c1 nmdc:mga0k408_446360_c1_110_670 184
201 3300050509 nmdc:mga0qj67_736716_c1 nmdc:mga0qj67_736716_c1_92_646 184
202 iso_pu_bacteria 2545555834 2545675752 184
203 iso_pu_bacteria 641522639 641641646 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

44

180

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7606 44 178
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7587 44 180
8gar-assembly1.cif.gz_A nitrosomonas europaea cytochrome p460 arg44ala 0.731 44 180
2je2-assembly1.cif.gz_A cytochrome p460 from nitrosomonas europaea - probable nonphysiological oxidized form 0.7275 44 180
7zrw-assembly1.cif.gz_B f61v cytochrome c prime beta from methylococcus capsulatus (bath) 0.7181 44 177
ID Description Score Start End Superfamily
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.7363 44 180 3.50.70.20
3nuzD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6898 50 100 3.40.50.1820
af_Q5ABB2_14_164_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.6754 43 65 3.10.180.10
af_Q54JM4_61_178_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.6681 49 69 2.70.130.10
af_Q9FKW3_7_181_3.50.70.10 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase; 0.6667 49 96 3.50.70.10
ID Description Score Start End GO Terms
AF-A0A2U0XWL8-F1-model_v4 deleted 0.9626 93 140
AF-A0A147GMS0-F1-model_v4 deleted 0.9182 21 171
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.8975 28 183
AF-A0A2V2R107-F1-model_v4 deleted 0.8942 27 180
AF-A0A7Y5RHC4-F1-model_v4 Cytochrome P460 family protein 0.8938 25 183

Feature Viewer

pLDDT pTM Quality
81.58 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map