F311631
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 203 | 142 | 201 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0675006|Ga0495628_0675006_97_654 |
| Length | 185 |
| Sequence | MKSKRMLVGAGISSALIILAAGAALSGQDRYSLAVPGGLAFSEFRGYENWQVISVSNGGLLAVILGNPAMIAAYKAGIPANGKPVPDGAKMAKIHWNPKKDPAIPGQPFMPDTLHDVDFMVKDSKRFADSGGWGYGEFEYDAASSTFRPGTTADKPPQKNDAKCGFACHTHVKQRDYVFTEYPSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 108 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 111 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 112 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 113 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 114 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 115 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 116 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 117 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 118 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 119 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 132 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 133 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 140 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 141 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 142 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0 |
| Isolates | 0.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.96 |
| Nodule | 0.99 |
| Rhizoplane | 1.48 |
| Rhizosphere | 91.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1032060 | 3300001977 | Bacteria | 725 |
| 2 | Ga0065707_10081725 | 3300005295 | Bacteria | 60705 |
| 3 | Ga0070658_10792881 | 3300005327 | Unclassified | 823 |
| 4 | Ga0070683_100013398 | 3300005329 | Bacteria | 7151 |
| 5 | Ga0070683_100473431 | 3300005329 | Bacteria | 1196 |
| 6 | Ga0070677_10272096 | 3300005333 | Bacteria | 850 |
| 7 | Ga0068869_100475782 | 3300005334 | Unclassified | 1039 |
| 8 | Ga0070666_10094107 | 3300005335 | Bacteria | 2061 |
| 9 | Ga0070680_100100810 | 3300005336 | Bacteria | 2397 |
| 10 | Ga0068868_100001469 | 3300005338 | Bacteria | 16273 |
| 11 | Ga0068868_100476918 | 3300005338 | Bacteria | 1089 |
| 12 | Ga0070660_100226629 | 3300005339 | Bacteria | 1520 |
| 13 | Ga0070661_100182306 | 3300005344 | Bacteria | 1598 |
| 14 | Ga0070661_100550370 | 3300005344 | Unclassified | 928 |
| 15 | Ga0070668_100038491 | 3300005347 | Bacteria | 3655 |
| 16 | Ga0070673_100018152 | 3300005364 | Bacteria | 5021 |
| 17 | Ga0070659_100082707 | 3300005366 | Bacteria | 2565 |
| 18 | Ga0070659_100592552 | 3300005366 | Bacteria | 952 |
| 19 | Ga0070667_100271098 | 3300005367 | Bacteria | 1522 |
| 20 | Ga0070705_100273357 | 3300005440 | Bacteria | 1198 |
| 21 | Ga0070700_100085437 | 3300005441 | Bacteria | 2047 |
| 22 | Ga0070694_100192653 | 3300005444 | Bacteria | 1515 |
| 23 | Ga0070708_100505449 | 3300005445 | Unclassified | 1140 |
| 24 | Ga0070663_100032369 | 3300005455 | Bacteria | 3604 |
| 25 | Ga0070663_100876096 | 3300005455 | Bacteria | 774 |
| 26 | Ga0070678_100198072 | 3300005456 | Bacteria | 1656 |
| 27 | Ga0070662_100044732 | 3300005457 | Bacteria | 3173 |
| 28 | Ga0070662_100136701 | 3300005457 | Bacteria | 1895 |
| 29 | Ga0070681_10140595 | 3300005458 | Bacteria | 2344 |
| 30 | Ga0070679_100085352 | 3300005530 | Bacteria | 3144 |
| 31 | Ga0070679_100767367 | 3300005530 | Bacteria | 907 |
| 32 | Ga0070693_100746176 | 3300005547 | Bacteria | 721 |
| 33 | Ga0068855_100195640 | 3300005563 | Bacteria | 2278 |
| 34 | Ga0068855_100657316 | 3300005563 | Bacteria | 1125 |
| 35 | Ga0070664_100334216 | 3300005564 | Bacteria | 1375 |
| 36 | Ga0068857_100180008 | 3300005577 | Bacteria | 1924 |
| 37 | Ga0068856_100039048 | 3300005614 | Bacteria | 4661 |
| 38 | Ga0070702_100432576 | 3300005615 | Unclassified | 950 |
| 39 | Ga0068864_100004436 | 3300005618 | Bacteria | 11530 |
| 40 | Ga0068864_100045770 | 3300005618 | Bacteria | 3753 |
| 41 | Ga0068861_100024158 | 3300005719 | Bacteria | 4392 |
| 42 | Ga0068861_100035653 | 3300005719 | Bacteria | 3686 |
| 43 | Ga0068851_10214886 | 3300005834 | Unclassified | 1078 |
| 44 | Ga0068863_100520233 | 3300005841 | Bacteria | 1173 |
| 45 | Ga0068858_100028484 | 3300005842 | Bacteria | 5189 |
| 46 | Ga0068858_100770277 | 3300005842 | Bacteria | 938 |
| 47 | Ga0068860_100382405 | 3300005843 | Bacteria | 1390 |
| 48 | Ga0068862_100006355 | 3300005844 | Bacteria | 9825 |
| 49 | Ga0068862_100615993 | 3300005844 | Bacteria | 1044 |
| 50 | Ga0075366_10542134 | 3300006195 | Bacteria | 720 |
| 51 | Ga0097621_100123311 | 3300006237 | Bacteria | 2199 |
| 52 | Ga0068871_100119096 | 3300006358 | Bacteria | 2228 |
| 53 | Ga0068871_100817836 | 3300006358 | Bacteria | 860 |
| 54 | Ga0075428_100176870 | 3300006844 | Bacteria | 2311 |
| 55 | Ga0075430_100003195 | 3300006846 | Bacteria | 13726 |
| 56 | Ga0075430_100366282 | 3300006846 | Bacteria | 1190 |
| 57 | Ga0075431_100011577 | 3300006847 | Bacteria | 8894 |
| 58 | Ga0068865_100056271 | 3300006881 | Bacteria | 2740 |
| 59 | Ga0068865_100310947 | 3300006881 | Bacteria | 1264 |
| 60 | Ga0105240_10002303 | 3300009093 | Bacteria | 30876 |
| 61 | Ga0105240_10050440 | 3300009093 | Bacteria | 5247 |
| 62 | Ga0105240_10621392 | 3300009093 | Bacteria | 1187 |
| 63 | Ga0111539_10012422 | 3300009094 | Bacteria | 10678 |
| 64 | Ga0111539_10102095 | 3300009094 | Bacteria | 3366 |
| 65 | Ga0111539_10342071 | 3300009094 | Bacteria | 1741 |
| 66 | Ga0105247_10411057 | 3300009101 | Unclassified | 966 |
| 67 | Ga0114129_11015534 | 3300009147 | Bacteria | 1044 |
| 68 | Ga0114129_11302703 | 3300009147 | Bacteria | 900 |
| 69 | Ga0105242_10320770 | 3300009176 | Bacteria | 1421 |
| 70 | Ga0105248_10003266 | 3300009177 | Bacteria | 17984 |
| 71 | Ga0105248_10498744 | 3300009177 | Bacteria | 1372 |
| 72 | Ga0105237_10121422 | 3300009545 | Bacteria | 2607 |
| 73 | Ga0105237_10396474 | 3300009545 | Bacteria | 1385 |
| 74 | Ga0105249_10049460 | 3300009553 | Bacteria | 3834 |
| 75 | Ga0105239_10060503 | 3300010375 | Bacteria | 4157 |
| 76 | Ga0105239_10825460 | 3300010375 | Bacteria | 1062 |
| 77 | Ga0105246_10468364 | 3300011119 | Bacteria | 1063 |
| 78 | Ga0157373_10053523 | 3300013100 | Bacteria | 2870 |
| 79 | Ga0157369_10783771 | 3300013105 | Unclassified | 980 |
| 80 | Ga0157374_10014657 | 3300013296 | Bacteria | 6862 |
| 81 | Ga0157374_10059348 | 3300013296 | Bacteria | 3577 |
| 82 | Ga0157374_10478606 | 3300013296 | Bacteria | 1248 |
| 83 | Ga0157374_11663227 | 3300013296 | Bacteria | 663 |
| 84 | Ga0163162_10055561 | 3300013306 | Bacteria | 3987 |
| 85 | Ga0163162_10486967 | 3300013306 | Bacteria | 1365 |
| 86 | Ga0157372_10004955 | 3300013307 | Bacteria | 14145 |
| 87 | Ga0157372_10032158 | 3300013307 | Bacteria | 5750 |
| 88 | Ga0157375_10020613 | 3300013308 | Bacteria | 6026 |
| 89 | Ga0157375_10131481 | 3300013308 | Bacteria | 2622 |
| 90 | Ga0157377_10167748 | 3300014745 | Unclassified | 1370 |
| 91 | Ga0157379_10008231 | 3300014968 | Bacteria | 9055 |
| 92 | Ga0157379_10075983 | 3300014968 | Bacteria | 3008 |
| 93 | Ga0163161_10009193 | 3300017792 | Bacteria | 6831 |
| 94 | Ga0163161_10959420 | 3300017792 | Bacteria | 728 |
| 95 | Ga0209759_1022947 | 3300025256 | Bacteria | 1385 |
| 96 | Ga0207656_10101515 | 3300025321 | Bacteria | 1319 |
| 97 | Ga0207682_10075285 | 3300025893 | Bacteria | 1437 |
| 98 | Ga0207680_10665124 | 3300025903 | Bacteria | 746 |
| 99 | Ga0207645_10048936 | 3300025907 | Bacteria | 2700 |
| 100 | Ga0207645_10163440 | 3300025907 | Unclassified | 1457 |
| 101 | Ga0207645_10295328 | 3300025907 | Bacteria | 1078 |
| 102 | Ga0207705_10155381 | 3300025909 | Bacteria | 1716 |
| 103 | Ga0207705_10425870 | 3300025909 | Unclassified | 1028 |
| 104 | Ga0207654_10108571 | 3300025911 | Bacteria | 1722 |
| 105 | Ga0207695_10176199 | 3300025913 | Bacteria | 2061 |
| 106 | Ga0207695_10479914 | 3300025913 | Bacteria | 1125 |
| 107 | Ga0207671_10018036 | 3300025914 | Bacteria | 5427 |
| 108 | Ga0207671_10035130 | 3300025914 | Bacteria | 3722 |
| 109 | Ga0207671_10201052 | 3300025914 | Bacteria | 1556 |
| 110 | Ga0207671_10319188 | 3300025914 | Bacteria | 1229 |
| 111 | Ga0207660_10047161 | 3300025917 | Bacteria | 3044 |
| 112 | Ga0207652_10066994 | 3300025921 | Bacteria | 3113 |
| 113 | Ga0207652_10869057 | 3300025921 | Bacteria | 798 |
| 114 | Ga0207694_10584193 | 3300025924 | Unclassified | 939 |
| 115 | Ga0207650_10436496 | 3300025925 | Bacteria | 1088 |
| 116 | Ga0207659_10787659 | 3300025926 | Bacteria | 816 |
| 117 | Ga0207644_10488366 | 3300025931 | Bacteria | 1015 |
| 118 | Ga0207644_10874267 | 3300025931 | Bacteria | 753 |
| 119 | Ga0207690_10039403 | 3300025932 | Bacteria | 3083 |
| 120 | Ga0207690_10380551 | 3300025932 | Bacteria | 1122 |
| 121 | Ga0207706_10065667 | 3300025933 | Bacteria | 3195 |
| 122 | Ga0207706_10073839 | 3300025933 | Bacteria | 2999 |
| 123 | Ga0207706_10840416 | 3300025933 | Bacteria | 778 |
| 124 | Ga0207704_10213083 | 3300025938 | Bacteria | 1423 |
| 125 | Ga0207704_11171995 | 3300025938 | Unclassified | 654 |
| 126 | Ga0207711_10017704 | 3300025941 | Bacteria | 5920 |
| 127 | Ga0207711_10469516 | 3300025941 | Bacteria | 1172 |
| 128 | Ga0207689_10003719 | 3300025942 | Bacteria | 13903 |
| 129 | Ga0207689_11084918 | 3300025942 | Bacteria | 675 |
| 130 | Ga0207661_10012673 | 3300025944 | Bacteria | 6137 |
| 131 | Ga0207661_10625315 | 3300025944 | Bacteria | 989 |
| 132 | Ga0207679_10158676 | 3300025945 | Bacteria | 1849 |
| 133 | Ga0207679_10605529 | 3300025945 | Unclassified | 988 |
| 134 | Ga0207667_10186857 | 3300025949 | Bacteria | 2127 |
| 135 | Ga0207651_10885761 | 3300025960 | Bacteria | 794 |
| 136 | Ga0207712_10009436 | 3300025961 | Bacteria | 6175 |
| 137 | Ga0207712_10190210 | 3300025961 | Bacteria | 1619 |
| 138 | Ga0207668_10003776 | 3300025972 | Bacteria | 8921 |
| 139 | Ga0207668_10998970 | 3300025972 | Unclassified | 748 |
| 140 | Ga0207677_10008846 | 3300026023 | Bacteria | 5645 |
| 141 | Ga0207677_10250245 | 3300026023 | Bacteria | 1439 |
| 142 | Ga0207703_10480459 | 3300026035 | Unclassified | 1164 |
| 143 | Ga0207678_10056206 | 3300026067 | Bacteria | 3388 |
| 144 | Ga0207708_10149768 | 3300026075 | Bacteria | 1836 |
| 145 | Ga0207702_10030700 | 3300026078 | Bacteria | 4477 |
| 146 | Ga0207676_10050083 | 3300026095 | Bacteria | 3254 |
| 147 | Ga0207676_10173266 | 3300026095 | Bacteria | 1882 |
| 148 | Ga0207674_10230530 | 3300026116 | Bacteria | 1799 |
| 149 | Ga0207675_100000379 | 3300026118 | Bacteria | 42654 |
| 150 | Ga0207683_10027392 | 3300026121 | Bacteria | 4924 |
| 151 | Ga0207683_10333950 | 3300026121 | Bacteria | 1389 |
| 152 | Ga0207698_11173496 | 3300026142 | Bacteria | 782 |
| 153 | Ga0268266_10055159 | 3300028379 | Bacteria | 3416 |
| 154 | Ga0268265_10098910 | 3300028380 | Bacteria | 2350 |
| 155 | Ga0268265_10847802 | 3300028380 | Bacteria | 894 |
| 156 | Ga0268264_10430013 | 3300028381 | Bacteria | 1275 |
| 157 | Ga0307413_10188149 | 3300031824 | Bacteria | 1480 |
| 158 | Ga0307410_10163426 | 3300031852 | Bacteria | 1671 |
| 159 | Ga0373940_0071108 | 3300035088 | Unclassified | 1013 |
| 160 | Ga0373961_0238387 | 3300035241 | Unclassified | 654 |
| 161 | Ga0373931_0051232 | 3300035691 | Bacteria | 2198 |
| 162 | Ga0395905_0569723 | 3300037471 | Bacteria | 1034 |
| 163 | Ga0436363_0645676 | 3300039450 | Bacteria | 755 |
| 164 | Ga0436363_1672590 | 3300039450 | Bacteria | 1048 |
| 165 | Ga0451847_0619807 | 3300041503 | Bacteria | 535 |
| 166 | Ga0439455_0017839 | 3300042012 | Bacteria | 1659 |
| 167 | Ga0450914_017031 | 3300042118 | Bacteria | 776 |
| 168 | Ga0439459_0034440 | 3300042438 | Bacteria | 1047 |
| 169 | Ga0439460_0114051 | 3300042461 | Bacteria | 879 |
| 170 | Ga0439440_0048118 | 3300042993 | Bacteria | 1059 |
| 171 | Ga0466971_0253682 | 3300044719 | Bacteria | 838 |
| 172 | Ga0451576_0390626 | 3300045051 | Bacteria | 1459 |
| 173 | Ga0495638_0000808 | 3300046460 | Bacteria | 33041 |
| 174 | Ga0495594_0152245 | 3300046499 | Bacteria | 1313 |
| 175 | Ga0495594_0193295 | 3300046499 | Bacteria | 1159 |
| 176 | Ga0495628_0675006 | 3300046516 | Bacteria | 732 |
| 177 | Ga0495665_0286976 | 3300046531 | Bacteria | 844 |
| 178 | Ga0495625_0003352 | 3300046660 | Bacteria | 16114 |
| 179 | Ga0495635_0319264 | 3300046663 | Bacteria | 1040 |
| 180 | Ga0495613_0400796 | 3300046689 | Bacteria | 936 |
| 181 | Ga0495676_0425835 | 3300047321 | Bacteria | 878 |
| 182 | Ga0495680_0512863 | 3300047322 | Bacteria | 812 |
| 183 | Ga0495686_0012943 | 3300047472 | Bacteria | 5817 |
| 184 | Ga0496113_0650532 | 3300048916 | Bacteria | 843 |
| 185 | Ga0496114_0419716 | 3300048917 | Unclassified | 1185 |
| 186 | Ga0496114_1150847 | 3300048917 | Unclassified | 661 |
| 187 | Ga0496121_0034917 | 3300048924 | Bacteria | 4515 |
| 188 | Ga0496121_0073997 | 3300048924 | Bacteria | 2727 |
| 189 | nmdc:mga0k408_397924_c1 | 3300050493 | Bacteria | 820 |
| 190 | nmdc:mga0k408_446360_c1 | 3300050493 | Bacteria | 768 |
| 191 | nmdc:mga05p37_620940_c2 | 3300050507 | Bacteria | 920 |
| 192 | nmdc:mga09592_158489_c1 | 3300050508 | Bacteria | 1954 |
| 193 | nmdc:mga0qj67_5895_c1 | 3300050509 | Bacteria | 8977 |
| 194 | nmdc:mga0qj67_736716_c1 | 3300050509 | Bacteria | 783 |
| 195 | nmdc:mga06r32_3731_c1 | 3300050510 | Bacteria | 13635 |
| 196 | nmdc:mga08y16_11485_c1 | 3300050511 | Bacteria | 9304 |
| 197 | nmdc:mga08y16_173396_c1 | 3300050511 | Bacteria | 2240 |
| 198 | nmdc:mga0rr50_242203_c1 | 3300050513 | Bacteria | 1495 |
| 199 | Ga0500610_0068358 | 3300053079 | Bacteria | 1853 |
| 200 | Ga0500568_0032577 | 3300053139 | Bacteria | 2142 |
| 201 | Ga0500604_0163126 | 3300053151 | Bacteria | 760 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041503 | Ga0451847_0619807 | Ga0451847_0619807_33_521 | 158 |
| 2 | 3300050508 | nmdc:mga09592_158489_c1 | nmdc:mga09592_158489_c1_1454_1942 | 161 |
| 3 | 3300050513 | nmdc:mga0rr50_242203_c1 | nmdc:mga0rr50_242203_c1_959_1444 | 161 |
| 4 | 3300048916 | Ga0496113_0650532 | Ga0496113_0650532_11_502 | 163 |
| 5 | 3300046531 | Ga0495665_0286976 | Ga0495665_0286976_312_812 | 166 |
| 6 | 3300047472 | Ga0495686_0012943 | Ga0495686_0012943_1610_2134 | 167 |
| 7 | 3300028380 | Ga0268265_10847802 | Ga0268265_108478022 | 168 |
| 8 | 3300042118 | Ga0450914_017031 | Ga0450914_017031_168_740 | 168 |
| 9 | 3300042993 | Ga0439440_0048118 | Ga0439440_0048118_224_796 | 168 |
| 10 | 3300044719 | Ga0466971_0253682 | Ga0466971_0253682_221_760 | 171 |
| 11 | 3300005329 | Ga0070683_100473431 | Ga0070683_1004734312 | 173 |
| 12 | 3300025944 | Ga0207661_10625315 | Ga0207661_106253152 | 173 |
| 13 | 3300009093 | Ga0105240_10002303 | Ga0105240_1000230326 | 175 |
| 14 | 3300005366 | Ga0070659_100592552 | Ga0070659_1005925521 | 179 |
| 15 | 3300009094 | Ga0111539_10102095 | Ga0111539_101020951 | 179 |
| 16 | 3300025909 | Ga0207705_10155381 | Ga0207705_101553812 | 179 |
| 17 | 3300025932 | Ga0207690_10380551 | Ga0207690_103805512 | 179 |
| 18 | 3300026142 | Ga0207698_11173496 | Ga0207698_111734961 | 179 |
| 19 | 3300035691 | Ga0373931_0051232 | Ga0373931_0051232_1242_1784 | 179 |
| 20 | 3300005530 | Ga0070679_100767367 | Ga0070679_1007673671 | 180 |
| 21 | 3300013296 | Ga0157374_11663227 | Ga0157374_116632271 | 180 |
| 22 | 3300025914 | Ga0207671_10035130 | Ga0207671_100351303 | 180 |
| 23 | 3300025914 | Ga0207671_10319188 | Ga0207671_103191881 | 180 |
| 24 | 3300025921 | Ga0207652_10869057 | Ga0207652_108690571 | 180 |
| 25 | 3300005333 | Ga0070677_10272096 | Ga0070677_102720962 | 182 |
| 26 | 3300005364 | Ga0070673_100018152 | Ga0070673_1000181525 | 182 |
| 27 | 3300006844 | Ga0075428_100176870 | Ga0075428_1001768703 | 182 |
| 28 | 3300006846 | Ga0075430_100003195 | Ga0075430_1000031955 | 182 |
| 29 | 3300006847 | Ga0075431_100011577 | Ga0075431_1000115775 | 182 |
| 30 | 3300025893 | Ga0207682_10075285 | Ga0207682_100752851 | 182 |
| 31 | 3300025907 | Ga0207645_10295328 | Ga0207645_102953282 | 182 |
| 32 | 3300025931 | Ga0207644_10488366 | Ga0207644_104883661 | 182 |
| 33 | 3300025933 | Ga0207706_10840416 | Ga0207706_108404161 | 182 |
| 34 | 3300025960 | Ga0207651_10885761 | Ga0207651_108857611 | 182 |
| 35 | 3300042012 | Ga0439455_0017839 | Ga0439455_0017839_389_937 | 182 |
| 36 | 3300042438 | Ga0439459_0034440 | Ga0439459_0034440_263_811 | 182 |
| 37 | 3300046499 | Ga0495594_0193295 | Ga0495594_0193295_421_969 | 182 |
| 38 | 3300050509 | nmdc:mga0qj67_5895_c1 | nmdc:mga0qj67_5895_c1_7307_7855 | 182 |
| 39 | 3300050510 | nmdc:mga06r32_3731_c1 | nmdc:mga06r32_3731_c1_3267_3815 | 182 |
| 40 | 3300005295 | Ga0065707_10081725 | Ga0065707_1008172512 | 183 |
| 41 | 3300005334 | Ga0068869_100475782 | Ga0068869_1004757821 | 183 |
| 42 | 3300005335 | Ga0070666_10094107 | Ga0070666_100941072 | 183 |
| 43 | 3300005336 | Ga0070680_100100810 | Ga0070680_1001008102 | 183 |
| 44 | 3300005338 | Ga0068868_100001469 | Ga0068868_10000146914 | 183 |
| 45 | 3300005339 | Ga0070660_100226629 | Ga0070660_1002266291 | 183 |
| 46 | 3300005344 | Ga0070661_100182306 | Ga0070661_1001823061 | 183 |
| 47 | 3300005344 | Ga0070661_100550370 | Ga0070661_1005503701 | 183 |
| 48 | 3300005347 | Ga0070668_100038491 | Ga0070668_1000384914 | 183 |
| 49 | 3300005367 | Ga0070667_100271098 | Ga0070667_1002710983 | 183 |
| 50 | 3300005441 | Ga0070700_100085437 | Ga0070700_1000854372 | 183 |
| 51 | 3300005445 | Ga0070708_100505449 | Ga0070708_1005054492 | 183 |
| 52 | 3300005455 | Ga0070663_100032369 | Ga0070663_1000323693 | 183 |
| 53 | 3300005455 | Ga0070663_100876096 | Ga0070663_1008760961 | 183 |
| 54 | 3300005457 | Ga0070662_100044732 | Ga0070662_1000447322 | 183 |
| 55 | 3300005457 | Ga0070662_100136701 | Ga0070662_1001367012 | 183 |
| 56 | 3300005458 | Ga0070681_10140595 | Ga0070681_101405952 | 183 |
| 57 | 3300005530 | Ga0070679_100085352 | Ga0070679_1000853522 | 183 |
| 58 | 3300005547 | Ga0070693_100746176 | Ga0070693_1007461761 | 183 |
| 59 | 3300005563 | Ga0068855_100195640 | Ga0068855_1001956402 | 183 |
| 60 | 3300005564 | Ga0070664_100334216 | Ga0070664_1003342162 | 183 |
| 61 | 3300005577 | Ga0068857_100180008 | Ga0068857_1001800081 | 183 |
| 62 | 3300005615 | Ga0070702_100432576 | Ga0070702_1004325761 | 183 |
| 63 | 3300005618 | Ga0068864_100004436 | Ga0068864_1000044362 | 183 |
| 64 | 3300005618 | Ga0068864_100045770 | Ga0068864_1000457703 | 183 |
| 65 | 3300005719 | Ga0068861_100024158 | Ga0068861_1000241586 | 183 |
| 66 | 3300005719 | Ga0068861_100035653 | Ga0068861_1000356532 | 183 |
| 67 | 3300005834 | Ga0068851_10214886 | Ga0068851_102148861 | 183 |
| 68 | 3300005841 | Ga0068863_100520233 | Ga0068863_1005202331 | 183 |
| 69 | 3300005842 | Ga0068858_100028484 | Ga0068858_1000284846 | 183 |
| 70 | 3300005842 | Ga0068858_100770277 | Ga0068858_1007702771 | 183 |
| 71 | 3300005843 | Ga0068860_100382405 | Ga0068860_1003824051 | 183 |
| 72 | 3300005844 | Ga0068862_100006355 | Ga0068862_1000063554 | 183 |
| 73 | 3300005844 | Ga0068862_100615993 | Ga0068862_1006159932 | 183 |
| 74 | 3300006237 | Ga0097621_100123311 | Ga0097621_1001233113 | 183 |
| 75 | 3300006358 | Ga0068871_100119096 | Ga0068871_1001190963 | 183 |
| 76 | 3300006358 | Ga0068871_100817836 | Ga0068871_1008178361 | 183 |
| 77 | 3300006881 | Ga0068865_100056271 | Ga0068865_1000562712 | 183 |
| 78 | 3300009093 | Ga0105240_10050440 | Ga0105240_100504401 | 183 |
| 79 | 3300009094 | Ga0111539_10012422 | Ga0111539_100124228 | 183 |
| 80 | 3300009094 | Ga0111539_10342071 | Ga0111539_103420712 | 183 |
| 81 | 3300009101 | Ga0105247_10411057 | Ga0105247_104110571 | 183 |
| 82 | 3300009147 | Ga0114129_11302703 | Ga0114129_113027032 | 183 |
| 83 | 3300009177 | Ga0105248_10003266 | Ga0105248_100032662 | 183 |
| 84 | 3300009545 | Ga0105237_10121422 | Ga0105237_101214222 | 183 |
| 85 | 3300009545 | Ga0105237_10396474 | Ga0105237_103964742 | 183 |
| 86 | 3300009553 | Ga0105249_10049460 | Ga0105249_100494602 | 183 |
| 87 | 3300010375 | Ga0105239_10060503 | Ga0105239_100605033 | 183 |
| 88 | 3300011119 | Ga0105246_10468364 | Ga0105246_104683642 | 183 |
| 89 | 3300013296 | Ga0157374_10059348 | Ga0157374_100593481 | 183 |
| 90 | 3300013296 | Ga0157374_10478606 | Ga0157374_104786062 | 183 |
| 91 | 3300013306 | Ga0163162_10055561 | Ga0163162_100555614 | 183 |
| 92 | 3300013306 | Ga0163162_10486967 | Ga0163162_104869672 | 183 |
| 93 | 3300013307 | Ga0157372_10032158 | Ga0157372_100321582 | 183 |
| 94 | 3300013308 | Ga0157375_10020613 | Ga0157375_100206137 | 183 |
| 95 | 3300013308 | Ga0157375_10131481 | Ga0157375_101314813 | 183 |
| 96 | 3300014745 | Ga0157377_10167748 | Ga0157377_101677482 | 183 |
| 97 | 3300014968 | Ga0157379_10008231 | Ga0157379_100082312 | 183 |
| 98 | 3300014968 | Ga0157379_10075983 | Ga0157379_100759835 | 183 |
| 99 | 3300017792 | Ga0163161_10009193 | Ga0163161_100091938 | 183 |
| 100 | 3300025256 | Ga0209759_1022947 | Ga0209759_10229472 | 183 |
| 101 | 3300025321 | Ga0207656_10101515 | Ga0207656_101015151 | 183 |
| 102 | 3300025907 | Ga0207645_10048936 | Ga0207645_100489363 | 183 |
| 103 | 3300025907 | Ga0207645_10163440 | Ga0207645_101634402 | 183 |
| 104 | 3300025911 | Ga0207654_10108571 | Ga0207654_101085712 | 183 |
| 105 | 3300025913 | Ga0207695_10176199 | Ga0207695_101761992 | 183 |
| 106 | 3300025914 | Ga0207671_10018036 | Ga0207671_100180361 | 183 |
| 107 | 3300025914 | Ga0207671_10201052 | Ga0207671_102010521 | 183 |
| 108 | 3300025917 | Ga0207660_10047161 | Ga0207660_100471612 | 183 |
| 109 | 3300025921 | Ga0207652_10066994 | Ga0207652_100669942 | 183 |
| 110 | 3300025924 | Ga0207694_10584193 | Ga0207694_105841931 | 183 |
| 111 | 3300025925 | Ga0207650_10436496 | Ga0207650_104364962 | 183 |
| 112 | 3300025926 | Ga0207659_10787659 | Ga0207659_107876592 | 183 |
| 113 | 3300025931 | Ga0207644_10874267 | Ga0207644_108742672 | 183 |
| 114 | 3300025933 | Ga0207706_10065667 | Ga0207706_100656672 | 183 |
| 115 | 3300025933 | Ga0207706_10073839 | Ga0207706_100738393 | 183 |
| 116 | 3300025938 | Ga0207704_10213083 | Ga0207704_102130831 | 183 |
| 117 | 3300025938 | Ga0207704_11171995 | Ga0207704_111719951 | 183 |
| 118 | 3300025941 | Ga0207711_10017704 | Ga0207711_100177042 | 183 |
| 119 | 3300025942 | Ga0207689_10003719 | Ga0207689_1000371911 | 183 |
| 120 | 3300025945 | Ga0207679_10158676 | Ga0207679_101586761 | 183 |
| 121 | 3300025945 | Ga0207679_10605529 | Ga0207679_106055292 | 183 |
| 122 | 3300025949 | Ga0207667_10186857 | Ga0207667_101868573 | 183 |
| 123 | 3300025961 | Ga0207712_10009436 | Ga0207712_100094363 | 183 |
| 124 | 3300025972 | Ga0207668_10003776 | Ga0207668_100037762 | 183 |
| 125 | 3300025972 | Ga0207668_10998970 | Ga0207668_109989701 | 183 |
| 126 | 3300026023 | Ga0207677_10008846 | Ga0207677_100088466 | 183 |
| 127 | 3300026023 | Ga0207677_10250245 | Ga0207677_102502451 | 183 |
| 128 | 3300026035 | Ga0207703_10480459 | Ga0207703_104804591 | 183 |
| 129 | 3300026067 | Ga0207678_10056206 | Ga0207678_100562063 | 183 |
| 130 | 3300026075 | Ga0207708_10149768 | Ga0207708_101497682 | 183 |
| 131 | 3300026095 | Ga0207676_10050083 | Ga0207676_100500833 | 183 |
| 132 | 3300026095 | Ga0207676_10173266 | Ga0207676_101732662 | 183 |
| 133 | 3300026116 | Ga0207674_10230530 | Ga0207674_102305302 | 183 |
| 134 | 3300026118 | Ga0207675_100000379 | Ga0207675_10000037933 | 183 |
| 135 | 3300026121 | Ga0207683_10333950 | Ga0207683_103339502 | 183 |
| 136 | 3300028380 | Ga0268265_10098910 | Ga0268265_100989102 | 183 |
| 137 | 3300031824 | Ga0307413_10188149 | Ga0307413_101881492 | 183 |
| 138 | 3300031852 | Ga0307410_10163426 | Ga0307410_101634262 | 183 |
| 139 | 3300035088 | Ga0373940_0071108 | Ga0373940_0071108_376_945 | 183 |
| 140 | 3300035241 | Ga0373961_0238387 | Ga0373961_0238387_47_616 | 183 |
| 141 | 3300037471 | Ga0395905_0569723 | Ga0395905_0569723_389_964 | 183 |
| 142 | 3300039450 | Ga0436363_1672590 | Ga0436363_1672590_256_828 | 183 |
| 143 | 3300045051 | Ga0451576_0390626 | Ga0451576_0390626_654_1223 | 183 |
| 144 | 3300046460 | Ga0495638_0000808 | Ga0495638_0000808_15850_16422 | 183 |
| 145 | 3300046499 | Ga0495594_0152245 | Ga0495594_0152245_585_1148 | 183 |
| 146 | 3300046516 | Ga0495628_0675006 | Ga0495628_0675006_97_654 | 183 |
| 147 | 3300046660 | Ga0495625_0003352 | Ga0495625_0003352_13364_13936 | 183 |
| 148 | 3300046663 | Ga0495635_0319264 | Ga0495635_0319264_141_704 | 183 |
| 149 | 3300046689 | Ga0495613_0400796 | Ga0495613_0400796_129_692 | 183 |
| 150 | 3300047321 | Ga0495676_0425835 | Ga0495676_0425835_134_697 | 183 |
| 151 | 3300047322 | Ga0495680_0512863 | Ga0495680_0512863_86_649 | 183 |
| 152 | 3300048917 | Ga0496114_0419716 | Ga0496114_0419716_267_836 | 183 |
| 153 | 3300048924 | Ga0496121_0034917 | Ga0496121_0034917_348_935 | 183 |
| 154 | 3300048924 | Ga0496121_0073997 | Ga0496121_0073997_1067_1666 | 183 |
| 155 | 3300050507 | nmdc:mga05p37_620940_c2 | nmdc:mga05p37_620940_c2_148_720 | 183 |
| 156 | 3300050511 | nmdc:mga08y16_11485_c1 | nmdc:mga08y16_11485_c1_6678_7250 | 183 |
| 157 | 3300050511 | nmdc:mga08y16_173396_c1 | nmdc:mga08y16_173396_c1_204_779 | 183 |
| 158 | 3300053079 | Ga0500610_0068358 | Ga0500610_0068358_31_645 | 183 |
| 159 | 3300053139 | Ga0500568_0032577 | Ga0500568_0032577_663_1235 | 183 |
| 160 | 3300053151 | Ga0500604_0163126 | Ga0500604_0163126_161_733 | 183 |
| 161 | 3300001977 | JGI24746J21847_1032060 | JGI24746J21847_10320601 | 184 |
| 162 | 3300005327 | Ga0070658_10792881 | Ga0070658_107928812 | 184 |
| 163 | 3300005329 | Ga0070683_100013398 | Ga0070683_1000133984 | 184 |
| 164 | 3300005338 | Ga0068868_100476918 | Ga0068868_1004769182 | 184 |
| 165 | 3300005366 | Ga0070659_100082707 | Ga0070659_1000827074 | 184 |
| 166 | 3300005440 | Ga0070705_100273357 | Ga0070705_1002733571 | 184 |
| 167 | 3300005444 | Ga0070694_100192653 | Ga0070694_1001926532 | 184 |
| 168 | 3300005456 | Ga0070678_100198072 | Ga0070678_1001980722 | 184 |
| 169 | 3300005563 | Ga0068855_100657316 | Ga0068855_1006573162 | 184 |
| 170 | 3300005614 | Ga0068856_100039048 | Ga0068856_1000390484 | 184 |
| 171 | 3300006195 | Ga0075366_10542134 | Ga0075366_105421341 | 184 |
| 172 | 3300006846 | Ga0075430_100366282 | Ga0075430_1003662821 | 184 |
| 173 | 3300006881 | Ga0068865_100310947 | Ga0068865_1003109472 | 184 |
| 174 | 3300009093 | Ga0105240_10621392 | Ga0105240_106213922 | 184 |
| 175 | 3300009147 | Ga0114129_11015534 | Ga0114129_110155342 | 184 |
| 176 | 3300009176 | Ga0105242_10320770 | Ga0105242_103207702 | 184 |
| 177 | 3300009177 | Ga0105248_10498744 | Ga0105248_104987442 | 184 |
| 178 | 3300010375 | Ga0105239_10825460 | Ga0105239_108254602 | 184 |
| 179 | 3300013100 | Ga0157373_10053523 | Ga0157373_100535233 | 184 |
| 180 | 3300013105 | Ga0157369_10783771 | Ga0157369_107837712 | 184 |
| 181 | 3300013296 | Ga0157374_10014657 | Ga0157374_100146573 | 184 |
| 182 | 3300013307 | Ga0157372_10004955 | Ga0157372_1000495514 | 184 |
| 183 | 3300017792 | Ga0163161_10959420 | Ga0163161_109594201 | 184 |
| 184 | 3300025903 | Ga0207680_10665124 | Ga0207680_106651242 | 184 |
| 185 | 3300025909 | Ga0207705_10425870 | Ga0207705_104258702 | 184 |
| 186 | 3300025913 | Ga0207695_10479914 | Ga0207695_104799142 | 184 |
| 187 | 3300025932 | Ga0207690_10039403 | Ga0207690_100394035 | 184 |
| 188 | 3300025941 | Ga0207711_10469516 | Ga0207711_104695161 | 184 |
| 189 | 3300025942 | Ga0207689_11084918 | Ga0207689_110849181 | 184 |
| 190 | 3300025944 | Ga0207661_10012673 | Ga0207661_100126736 | 184 |
| 191 | 3300025961 | Ga0207712_10190210 | Ga0207712_101902103 | 184 |
| 192 | 3300026078 | Ga0207702_10030700 | Ga0207702_100307005 | 184 |
| 193 | 3300026121 | Ga0207683_10027392 | Ga0207683_100273923 | 184 |
| 194 | 3300028379 | Ga0268266_10055159 | Ga0268266_100551593 | 184 |
| 195 | 3300028381 | Ga0268264_10430013 | Ga0268264_104300132 | 184 |
| 196 | 3300039450 | Ga0436363_0645676 | Ga0436363_0645676_171_731 | 184 |
| 197 | 3300042461 | Ga0439460_0114051 | Ga0439460_0114051_231_785 | 184 |
| 198 | 3300048917 | Ga0496114_1150847 | Ga0496114_1150847_75_629 | 184 |
| 199 | 3300050493 | nmdc:mga0k408_397924_c1 | nmdc:mga0k408_397924_c1_49_603 | 184 |
| 200 | 3300050493 | nmdc:mga0k408_446360_c1 | nmdc:mga0k408_446360_c1_110_670 | 184 |
| 201 | 3300050509 | nmdc:mga0qj67_736716_c1 | nmdc:mga0qj67_736716_c1_92_646 | 184 |
| 202 | iso_pu_bacteria | 2545555834 | 2545675752 | 184 |
| 203 | iso_pu_bacteria | 641522639 | 641641646 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hiu-assembly1.cif.gz_A | cytochrome p460 from methylococcus capsulatus (bath) | 0.7606 | 44 | 178 |
| 8brk-assembly1.cif.gz_A | room temperature crystal structure of cytochrome c' from thermus thermophilus | 0.7587 | 44 | 180 |
| 8gar-assembly1.cif.gz_A | nitrosomonas europaea cytochrome p460 arg44ala | 0.731 | 44 | 180 |
| 2je2-assembly1.cif.gz_A | cytochrome p460 from nitrosomonas europaea - probable nonphysiological oxidized form | 0.7275 | 44 | 180 |
| 7zrw-assembly1.cif.gz_B | f61v cytochrome c prime beta from methylococcus capsulatus (bath) | 0.7181 | 44 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2je3A00 | Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 | 0.7363 | 44 | 180 | 3.50.70.20 |
| 3nuzD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.6898 | 50 | 100 | 3.40.50.1820 |
| af_Q5ABB2_14_164_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.6754 | 43 | 65 | 3.10.180.10 |
| af_Q54JM4_61_178_2.70.130.10 | Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain | 0.6681 | 49 | 69 | 2.70.130.10 |
| af_Q9FKW3_7_181_3.50.70.10 | Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase; | 0.6667 | 49 | 96 | 3.50.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U0XWL8-F1-model_v4 | deleted | 0.9626 | 93 | 140 |
|
| AF-A0A147GMS0-F1-model_v4 | deleted | 0.9182 | 21 | 171 |
|
| AF-A0A2V7MFV7-F1-model_v4 | Cytochrome P460 | 0.8975 | 28 | 183 |
|
| AF-A0A2V2R107-F1-model_v4 | deleted | 0.8942 | 27 | 180 |
|
| AF-A0A7Y5RHC4-F1-model_v4 | Cytochrome P460 family protein | 0.8938 | 25 | 183 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar