F311626

General Info

Members Datasets Scaffolds Average Seq Length
203 170 406 186

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0072117|Ga0495610_0072117_140_823
Length 227
Sequence MAGVSPPGRGEATSIATSGRPGFPRADAMPACWKSVAKDSVMARPRKKTDFPVHEVRRYLEPGPIVLVSSRWRDRTNIMTLGWHTVMEFSPSLVGCMISGGNHSFRLIRDSGECVINLPTTALTDTVVGIGNTSGAKIDKFQEFGLSAGEAQEVGAPLIRECHANFECRLHDDALVDRYNFFIFEVVKAHVAPVPKHPRTLHYTGGGVFVTAGGVVDRKALFRPGML

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
112 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
156 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
164 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
165 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
166 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
167 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
168 2855730933 Achromobacter sp. HZ28 Isolate Nodule
169 2855767633 Achromobacter sp. HZ34 Isolate Nodule
170 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0.49
Isolates 3.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 1.97
Rhizoplane 5.91
Rhizosphere 81.28
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0072117 3300046512 Bacteria 1608
2 JGI24739J22299_10175673 3300001989 Bacteria 631
3 JGI25159J45721_1021030 3300002987 Bacteria 1241
4 JGI25151J46595_10000938 3300003187 Bacteria 22546
5 rootH1_10096973 3300003316 Bacteria 2835
6 rootL2_10223069 3300003322 Bacteria 1574
7 JGI25160J50197_1012467 3300003354 Bacteria 2949
8 Ga0058692_1000997 3300003856 Bacteria 11134
9 Ga0068869_100036020 3300005334 Bacteria 3512
10 Ga0070680_100119163 3300005336 Bacteria 2202
11 Ga0068868_100695870 3300005338 Bacteria 909
12 Ga0070660_100204910 3300005339 Bacteria 1601
13 Ga0070691_10022985 3300005341 Bacteria 2895
14 Ga0070661_100102571 3300005344 Bacteria 2130
15 Ga0070668_100354094 3300005347 Bacteria 1243
16 Ga0070673_101011177 3300005364 Bacteria 774
17 Ga0070659_100010946 3300005366 Bacteria 6695
18 Ga0070659_100869499 3300005366 Bacteria 787
19 Ga0070709_10228526 3300005434 Bacteria 1330
20 Ga0070714_100928873 3300005435 Bacteria 845
21 Ga0070713_100381322 3300005436 Bacteria 1314
22 Ga0070710_10249701 3300005437 Bacteria 1140
23 Ga0070705_100223315 3300005440 Bacteria 1306
24 Ga0070694_100072716 3300005444 Bacteria 2373
25 Ga0070663_100022911 3300005455 Bacteria 4180
26 Ga0070681_10037891 3300005458 Bacteria 4835
27 Ga0070681_10223108 3300005458 Bacteria 1800
28 Ga0070679_100241775 3300005530 Bacteria 1762
29 Ga0070679_100777762 3300005530 Bacteria 900
30 Ga0068853_100056248 3300005539 Bacteria 3392
31 Ga0070696_100133014 3300005546 Bacteria 1812
32 Ga0070693_100159105 3300005547 Bacteria 1437
33 Ga0070704_100086656 3300005549 Bacteria 2322
34 Ga0068855_100049336 3300005563 Bacteria 4965
35 Ga0068856_101311650 3300005614 Bacteria 739
36 Ga0068852_100854744 3300005616 Bacteria 926
37 Ga0068864_100268105 3300005618 Bacteria 1590
38 Ga0068860_100264015 3300005843 Bacteria 1679
39 Ga0081540_1000642 3300005983 Bacteria 33163
40 Ga0070717_10148273 3300006028 Bacteria 2028
41 Ga0070717_10369562 3300006028 Bacteria 1285
42 Ga0070716_100750287 3300006173 Bacteria 751
43 Ga0070712_100340156 3300006175 Bacteria 1225
44 Ga0097621_100149487 3300006237 Bacteria 2002
45 Ga0075431_100010742 3300006847 Bacteria 9204
46 Ga0075434_100021784 3300006871 Bacteria 6233
47 Ga0068865_100420756 3300006881 Bacteria 1098
48 Ga0079104_1005952 3300006946 Bacteria 4733
49 Ga0075435_100185957 3300007076 Unclassified 1757
50 Ga0105240_10410365 3300009093 Unclassified 1524
51 Ga0111539_10077793 3300009094 Bacteria 3904
52 Ga0111539_10114642 3300009094 Bacteria 3161
53 Ga0105245_10606431 3300009098 Bacteria 1122
54 Ga0114129_10260729 3300009147 Bacteria 2323
55 Ga0114129_10351359 3300009147 Bacteria 1953
56 Ga0105237_10014006 3300009545 Bacteria 8392
57 Ga0105249_10119629 3300009553 Bacteria 2502
58 Ga0105033_102017 3300009986 Bacteria 1678
59 Ga0105239_10334740 3300010375 Bacteria 1708
60 Ga0105246_10007792 3300011119 Bacteria 6572
61 Ga0157370_10087586 3300013104 Bacteria 2925
62 Ga0157374_10598180 3300013296 Bacteria 1113
63 Ga0157378_10067458 3300013297 Bacteria 3206
64 Ga0163162_10849842 3300013306 Bacteria 1028
65 Ga0157375_10304107 3300013308 Bacteria 1758
66 Ga0163163_11003554 3300014325 Bacteria 898
67 Ga0157380_10921335 3300014326 Bacteria 901
68 Ga0228598_1020814 3300024227 Bacteria 1292
69 Ga0209130_1000473 3300025284 Bacteria 41414
70 Ga0209025_1002075 3300025294 Bacteria 22753
71 Ga0209758_1019358 3300025297 Bacteria 3285
72 Ga0207426_1000548 3300025302 Bacteria 52429
73 Ga0207642_10305390 3300025899 Bacteria 924
74 Ga0207647_10054229 3300025904 Bacteria 2467
75 Ga0207699_10011832 3300025906 Bacteria 4421
76 Ga0207671_10226489 3300025914 Bacteria 1466
77 Ga0207660_10148651 3300025917 Bacteria 1798
78 Ga0207657_10027750 3300025919 Bacteria 5179
79 Ga0207652_10311258 3300025921 Bacteria 1421
80 Ga0207687_10548706 3300025927 Bacteria 969
81 Ga0207700_10319064 3300025928 Bacteria 1346
82 Ga0207700_10479378 3300025928 Bacteria 1099
83 Ga0207664_10451345 3300025929 Bacteria 1148
84 Ga0207664_10864166 3300025929 Bacteria 813
85 Ga0207690_10273957 3300025932 Bacteria 1312
86 Ga0207691_10341402 3300025940 Bacteria 1282
87 Ga0207689_10051727 3300025942 Bacteria 3386
88 Ga0207689_10637678 3300025942 Bacteria 897
89 Ga0207668_10282515 3300025972 Bacteria 1362
90 Ga0207640_10219109 3300025981 Bacteria 1456
91 Ga0207658_10689299 3300025986 Bacteria 923
92 Ga0207639_10051475 3300026041 Bacteria 3132
93 Ga0207678_10002535 3300026067 Bacteria 16646
94 Ga0207678_10071754 3300026067 Bacteria 2969
95 Ga0207678_10384121 3300026067 Bacteria 1214
96 Ga0207708_10730907 3300026075 Bacteria 848
97 Ga0207702_10374115 3300026078 Bacteria 1368
98 Ga0207676_10918082 3300026095 Bacteria 860
99 Ga0207675_100154040 3300026118 Bacteria 2189
100 Ga0207698_10701469 3300026142 Bacteria 1007
101 Ga0207698_11237598 3300026142 Bacteria 761
102 Ga0209281_1015262 3300027111 Bacteria 1605
103 Ga0207428_10022497 3300027907 Bacteria 5318
104 Ga0207428_10299627 3300027907 Bacteria 1190
105 Ga0268264_10239254 3300028381 Bacteria 1681
106 Ga0268264_10730991 3300028381 Bacteria 985
107 Ga0265338_10012013 3300028800 Bacteria 9912
108 Ga0265760_10024201 3300031090 Bacteria 1768
109 Ga0265332_10151896 3300031238 Bacteria 969
110 Ga0265325_10001319 3300031241 Bacteria 17563
111 Ga0265340_10008459 3300031247 Bacteria 5556
112 Ga0265340_10039132 3300031247 Bacteria 2342
113 Ga0265340_10112557 3300031247 Bacteria 1257
114 Ga0265339_10046067 3300031249 Bacteria 2398
115 Ga0265339_10049080 3300031249 Bacteria 2313
116 Ga0265339_10125012 3300031249 Bacteria 1319
117 Ga0265316_10215749 3300031344 Bacteria 1418
118 Ga0265313_10000225 3300031595 Bacteria 60933
119 Ga0265313_10005139 3300031595 Bacteria 9743
120 Ga0265313_10055556 3300031595 Bacteria 1875
121 Ga0265313_10061300 3300031595 Bacteria 1761
122 Ga0265342_10049477 3300031712 Bacteria 2515
123 Ga0265342_10069997 3300031712 Bacteria 2048
124 Ga0307406_10085820 3300031901 Bacteria 2106
125 Ga0307409_100224489 3300031995 Bacteria 1698
126 Ga0307411_10570499 3300032005 Bacteria 968
127 Ga0373950_0016527 3300034818 Bacteria 1263
128 Ga0373938_0055935 3300034957 Bacteria 912
129 Ga0373941_0167662 3300035115 Bacteria 816
130 Ga0373961_0004768 3300035241 Bacteria 3262
131 Ga0373962_0011514 3300035242 Bacteria 2218
132 Ga0373931_0001091 3300035691 Bacteria 11503
133 Ga0439431_0040295 3300041997 Bacteria 1187
134 Ga0439456_066756 3300042013 Bacteria 795
135 Ga0466960_0062222 3300044901 Bacteria 1834
136 Ga0451576_0000099 3300045051 Bacteria 220245
137 Ga0495638_0000029 3300046460 Bacteria 330201
138 Ga0495638_0206835 3300046460 Bacteria 1104
139 Ga0495650_0016372 3300046471 Bacteria 3759
140 Ga0495645_0612679 3300046543 Bacteria 669
141 Ga0495611_0028793 3300046648 Bacteria 2434
142 Ga0495674_0003867 3300047319 Bacteria 14549
143 Ga0496102_0017681 3300048905 Bacteria 6249
144 Ga0496103_0009908 3300048906 Bacteria 5635
145 Ga0496104_0074414 3300048907 Bacteria 3234
146 Ga0496105_0025361 3300048908 Bacteria 4826
147 Ga0496105_0237528 3300048908 Bacteria 1480
148 Ga0496106_0017205 3300048909 Bacteria 5352
149 Ga0496107_0015826 3300048910 Bacteria 5290
150 Ga0496110_0061441 3300048913 Bacteria 3316
151 Ga0496112_0024082 3300048915 Bacteria 5826
152 Ga0496112_0112677 3300048915 Bacteria 2691
153 Ga0496115_0033314 3300048918 Bacteria 4067
154 Ga0496115_0379952 3300048918 Bacteria 1149
155 Ga0496119_0001056 3300048922 Bacteria 35138
156 Ga0496120_0000170 3300048923 Bacteria 110378
157 Ga0496122_0130627 3300048925 Bacteria 1597
158 Ga0496126_0003771 3300048929 Bacteria 18825
159 Ga0496126_0154330 3300048929 Bacteria 1966
160 Ga0501034_0110475 3300049571 Bacteria 2740
161 Ga0501034_0838385 3300049571 Bacteria 810
162 Ga0501036_0279004 3300049572 Bacteria 1399
163 Ga0501042_0906665 3300049578 Bacteria 642
164 Ga0501043_0187857 3300049579 Bacteria 1608
165 Ga0501046_0273449 3300049580 Bacteria 1239
166 Ga0501047_0177358 3300049581 Bacteria 1998
167 Ga0501048_0315263 3300049582 Bacteria 1114
168 Ga0501070_0075203 3300049586 Bacteria 2796
169 Ga0501070_0205345 3300049586 Bacteria 1618
170 Ga0501071_0538341 3300049587 Bacteria 897
171 Ga0501075_0895402 3300049591 Bacteria 675
172 Ga0501076_0250533 3300049592 Bacteria 1449
173 Ga0501083_0185698 3300049744 Bacteria 1357
174 Ga0501045_0263186 3300049824 Bacteria 1284
175 Ga0501045_0554545 3300049824 Bacteria 852
176 nmdc:mga05p37_587997_c1 3300050507 Bacteria 1259
177 nmdc:mga05p37_74516_c1 3300050507 Bacteria 4177
178 nmdc:mga09592_871081_c1 3300050508 Bacteria 758
179 nmdc:mga06r32_1207407_c1 3300050510 Bacteria 702
180 nmdc:mga06r32_13798_c1 3300050510 Bacteria 7329
181 nmdc:mga08y16_110560_c1 3300050511 Bacteria 2862
182 nmdc:mga08y16_114509_c1 3300050511 Bacteria 2807
183 nmdc:mga0n895_3178_c1 3300050512 Bacteria 13125
184 nmdc:mga0rr50_54504_c2 3300050513 Bacteria 2098
185 nmdc:mga0a205_7158_c1 3300050515 Bacteria 10083
186 nmdc:mga0sz30_112903_c1 3300050516 Bacteria 1192
187 Ga0495601_0063005 3300053077 Bacteria 2356
188 Ga0500618_000308 3300053125 Bacteria 36190
189 Ga0500652_096288 3300053131 Bacteria 1236
190 Ga0500616_0135383 3300053153 Bacteria 1158
191 Ga0500622_0000483 3300053156 Bacteria 37330
192 Ga0500636_0259765 3300053177 Bacteria 880
193 Ga0501084_0490820 3300054114 Bacteria 1038
194 Ga0590071_007990 3300059421 Bacteria 2499
195 Ga0590077_001743 3300059426 Bacteria 4919
196 2808984130 2808606386 Bacteria 4471946
197 2809131934 2808606415 Bacteria 4576710
198 2809151557 2808606419 Bacteria 4576925
199 2844540451 2844533157 Bacteria 7517899
200 2852622984 2852618963 Bacteria 4577824
201 2855732386 2855730933 Bacteria 7047938
202 2855769094 2855767633 Bacteria 7049357
203 8054567863 8054563764 Bacteria 5592885
204 Ga0495610_0072117
205 JGI24739J22299_10175673
206 JGI25159J45721_1021030
207 JGI25151J46595_10000938
208 rootH1_10096973
209 rootL2_10223069
210 JGI25160J50197_1012467
211 Ga0058692_1000997
212 Ga0068869_100036020
213 Ga0070680_100119163
214 Ga0068868_100695870
215 Ga0070660_100204910
216 Ga0070691_10022985
217 Ga0070661_100102571
218 Ga0070668_100354094
219 Ga0070673_101011177
220 Ga0070659_100010946
221 Ga0070659_100869499
222 Ga0070709_10228526
223 Ga0070714_100928873
224 Ga0070713_100381322
225 Ga0070710_10249701
226 Ga0070705_100223315
227 Ga0070694_100072716
228 Ga0070663_100022911
229 Ga0070681_10037891
230 Ga0070681_10223108
231 Ga0070679_100241775
232 Ga0070679_100777762
233 Ga0068853_100056248
234 Ga0070696_100133014
235 Ga0070693_100159105
236 Ga0070704_100086656
237 Ga0068855_100049336
238 Ga0068856_101311650
239 Ga0068852_100854744
240 Ga0068864_100268105
241 Ga0068860_100264015
242 Ga0081540_1000642
243 Ga0070717_10148273
244 Ga0070717_10369562
245 Ga0070716_100750287
246 Ga0070712_100340156
247 Ga0097621_100149487
248 Ga0075431_100010742
249 Ga0075434_100021784
250 Ga0068865_100420756
251 Ga0079104_1005952
252 Ga0075435_100185957
253 Ga0105240_10410365
254 Ga0111539_10077793
255 Ga0111539_10114642
256 Ga0105245_10606431
257 Ga0114129_10260729
258 Ga0114129_10351359
259 Ga0105237_10014006
260 Ga0105249_10119629
261 Ga0105033_102017
262 Ga0105239_10334740
263 Ga0105246_10007792
264 Ga0157370_10087586
265 Ga0157374_10598180
266 Ga0157378_10067458
267 Ga0163162_10849842
268 Ga0157375_10304107
269 Ga0163163_11003554
270 Ga0157380_10921335
271 Ga0228598_1020814
272 Ga0209130_1000473
273 Ga0209025_1002075
274 Ga0209758_1019358
275 Ga0207426_1000548
276 Ga0207642_10305390
277 Ga0207647_10054229
278 Ga0207699_10011832
279 Ga0207671_10226489
280 Ga0207660_10148651
281 Ga0207657_10027750
282 Ga0207652_10311258
283 Ga0207687_10548706
284 Ga0207700_10319064
285 Ga0207700_10479378
286 Ga0207664_10451345
287 Ga0207664_10864166
288 Ga0207690_10273957
289 Ga0207691_10341402
290 Ga0207689_10051727
291 Ga0207689_10637678
292 Ga0207668_10282515
293 Ga0207640_10219109
294 Ga0207658_10689299
295 Ga0207639_10051475
296 Ga0207678_10002535
297 Ga0207678_10071754
298 Ga0207678_10384121
299 Ga0207708_10730907
300 Ga0207702_10374115
301 Ga0207676_10918082
302 Ga0207675_100154040
303 Ga0207698_10701469
304 Ga0207698_11237598
305 Ga0209281_1015262
306 Ga0207428_10022497
307 Ga0207428_10299627
308 Ga0268264_10239254
309 Ga0268264_10730991
310 Ga0265338_10012013
311 Ga0265760_10024201
312 Ga0265332_10151896
313 Ga0265325_10001319
314 Ga0265340_10008459
315 Ga0265340_10039132
316 Ga0265340_10112557
317 Ga0265339_10046067
318 Ga0265339_10049080
319 Ga0265339_10125012
320 Ga0265316_10215749
321 Ga0265313_10000225
322 Ga0265313_10005139
323 Ga0265313_10055556
324 Ga0265313_10061300
325 Ga0265342_10049477
326 Ga0265342_10069997
327 Ga0307406_10085820
328 Ga0307409_100224489
329 Ga0307411_10570499
330 Ga0373950_0016527
331 Ga0373938_0055935
332 Ga0373941_0167662
333 Ga0373961_0004768
334 Ga0373962_0011514
335 Ga0373931_0001091
336 Ga0439431_0040295
337 Ga0439456_066756
338 Ga0466960_0062222
339 Ga0451576_0000099
340 Ga0495638_0000029
341 Ga0495638_0206835
342 Ga0495650_0016372
343 Ga0495645_0612679
344 Ga0495611_0028793
345 Ga0495674_0003867
346 Ga0496102_0017681
347 Ga0496103_0009908
348 Ga0496104_0074414
349 Ga0496105_0025361
350 Ga0496105_0237528
351 Ga0496106_0017205
352 Ga0496107_0015826
353 Ga0496110_0061441
354 Ga0496112_0024082
355 Ga0496112_0112677
356 Ga0496115_0033314
357 Ga0496115_0379952
358 Ga0496119_0001056
359 Ga0496120_0000170
360 Ga0496122_0130627
361 Ga0496126_0003771
362 Ga0496126_0154330
363 Ga0501034_0110475
364 Ga0501034_0838385
365 Ga0501036_0279004
366 Ga0501042_0906665
367 Ga0501043_0187857
368 Ga0501046_0273449
369 Ga0501047_0177358
370 Ga0501048_0315263
371 Ga0501070_0075203
372 Ga0501070_0205345
373 Ga0501071_0538341
374 Ga0501075_0895402
375 Ga0501076_0250533
376 Ga0501083_0185698
377 Ga0501045_0263186
378 Ga0501045_0554545
379 nmdc:mga05p37_587997_c1
380 nmdc:mga05p37_74516_c1
381 nmdc:mga09592_871081_c1
382 nmdc:mga06r32_1207407_c1
383 nmdc:mga06r32_13798_c1
384 nmdc:mga08y16_110560_c1
385 nmdc:mga08y16_114509_c1
386 nmdc:mga0n895_3178_c1
387 nmdc:mga0rr50_54504_c2
388 nmdc:mga0a205_7158_c1
389 nmdc:mga0sz30_112903_c1
390 Ga0495601_0063005
391 Ga0500618_000308
392 Ga0500652_096288
393 Ga0500616_0135383
394 Ga0500622_0000483
395 Ga0500636_0259765
396 Ga0501084_0490820
397 Ga0590071_007990
398 Ga0590077_001743
399 2808984130
400 2809131934
401 2809151557
402 2844540451
403 2852622984
404 2855732386
405 2855769094
406 8054567863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

57

211

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9553 8 180
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9191 8 180
3hmz-assembly1.cif.gz_A-2 crystal structure of a fmn-binding domain of flavin reductases-like enzyme (sbal_0626) from shewanella baltica os155 at 1.50 a resolution 0.9122 5 176
1i0s-assembly1.cif.gz_A archaeoglobus fulgidus ferric reductase complex with nadp+ 0.9035 22 150
2d5m-assembly1.cif.gz_A-2 flavoredoxin of desulfovibrio vulgaris (miyazaki f) 0.8939 20 177
ID Description Score Start End Superfamily
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.95 8 179 2.30.110.10
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9391 8 179 2.30.110.10
af_P76121_1_188_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9216 5 176 2.30.110.10
1i0sA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9035 22 150 2.30.110.10
2d5mA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8939 20 177 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7Y2K599-F1-model_v4 Flavin reductase family protein 0.9897 5 172 GO:0010181
GO:0016646
AF-A0A258SKZ0-F1-model_v4 Flavin reductase 0.9865 7 150 GO:0010181
GO:0016646
AF-K2DLI3-F1-model_v4 Flavin reductase protein 0.9844 7 162 GO:0010181
GO:0016646
AF-A0A0F9R1I4-F1-model_v4 Flavin reductase like domain-containing protein 0.9836 38 186 GO:0010181
AF-A0A4R1RTM0-F1-model_v4 Flavin reductase (DIM6/NTAB) family NADH-FMN oxidoreductase RutF 0.983 3 181 GO:0010181
GO:0016646

Map