F311555

General Info

Members Datasets Scaffolds Average Seq Length
203 93 406 120

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0179729|Ga0466966_0179729_518_904
Length 128
Sequence MGSNRSSASPLADTFEEIVESLPDDWTDLELDLRIFDERRYVDAAVLLVTCNAQPYSKHDWHWRLLVAHRFGHASSVPAVHAALRLLDEAGLDGELAVREVRTGRVEVVQMWGRPESVRQEFRALRAQ

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
4 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
5 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
6 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
7 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
8 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
9 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
10 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
19 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
20 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
21 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
22 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
23 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
24 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
25 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
26 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
27 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
28 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
29 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
30 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
31 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
32 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
33 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
34 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
35 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
36 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
39 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
40 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
44 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
45 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
46 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
47 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
48 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
49 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
52 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
58 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
59 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
63 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
64 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
65 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
66 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
67 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
68 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
69 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
73 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
76 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
77 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
78 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
92 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
93 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.88
Rhizosphere 69.46
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0179729 3300044684 Unclassified 1284
2 Ga0070714_100053408 3300005435 Bacteria 3449
3 Ga0068852_100673556 3300005616 Bacteria 1043
4 Ga0070712_100000170 3300006175 Bacteria 35641
5 Ga0070712_100029312 3300006175 Bacteria 3688
6 Ga0070712_100253281 3300006175 Bacteria 1408
7 Ga0070712_100517781 3300006175 Bacteria 1002
8 Ga0105249_10319756 3300009553 Bacteria 1563
9 Ga0163162_10244159 3300013306 Bacteria 1927
10 Ga0213874_10000577 3300021377 Bacteria 7339
11 Ga0213874_10310572 3300021377 Bacteria 595
12 Ga0213876_10010556 3300021384 Bacteria 4949
13 Ga0213876_10031716 3300021384 Bacteria 2787
14 Ga0213876_10055943 3300021384 Bacteria 2083
15 Ga0213876_10071686 3300021384 Bacteria 1829
16 Ga0213876_10268051 3300021384 Bacteria 907
17 Ga0213876_10377359 3300021384 Bacteria 754
18 Ga0213875_10007187 3300021388 Bacteria 5779
19 Ga0213875_10012616 3300021388 Bacteria 4164
20 Ga0213875_10189428 3300021388 Bacteria 967
21 Ga0207693_10000028 3300025915 Bacteria 120041
22 Ga0207693_10004645 3300025915 Bacteria 11583
23 Ga0207693_10331452 3300025915 Bacteria 1191
24 Ga0207693_10561928 3300025915 Bacteria 889
25 Ga0207693_10801918 3300025915 Bacteria 726
26 Ga0207700_10208551 3300025928 Bacteria 1651
27 Ga0207664_10704439 3300025929 Bacteria 908
28 Ga0207664_11772077 3300025929 Bacteria 540
29 Ga0207712_10518963 3300025961 Bacteria 1021
30 Ga0207668_10072173 3300025972 Bacteria 2469
31 Ga0207678_10230286 3300026067 Bacteria 1586
32 Ga0207675_100219522 3300026118 Bacteria 1831
33 Ga0207698_10289455 3300026142 Bacteria 1519
34 Ga0265338_10048532 3300028800 Bacteria 3861
35 Ga0265327_10056908 3300031251 Bacteria 2013
36 Ga0316578_10449355 3300031728 Bacteria 762
37 Ga0373923_0078133 3300035111 Bacteria 1432
38 Ga0373954_0039506 3300035118 Bacteria 2197
39 Ga0373955_0223531 3300035172 Bacteria 1125
40 Ga0373935_0819467 3300035692 Bacteria 688
41 Ga0373933_0069817 3300035724 Bacteria 2136
42 Ga0373947_0166128 3300035725 Bacteria 1430
43 Ga0373937_0029663 3300036401 Bacteria 4955
44 Ga0373937_0908935 3300036401 Bacteria 829
45 Ga0316584_0106934 3300036712 Bacteria 2093
46 Ga0373925_0853167 3300037068 Bacteria 751
47 Ga0436364_0054966 3300037853 Bacteria 28517
48 Ga0436364_0091363 3300037853 Bacteria 7402
49 Ga0436364_0208692 3300037853 Bacteria 1224
50 Ga0436364_0239386 3300037853 Bacteria 4030
51 Ga0436364_0321057 3300037853 Bacteria 3402
52 Ga0436364_0420564 3300037853 Bacteria 1789
53 Ga0436364_1046606 3300037853 Bacteria 1533
54 Ga0436364_1270285 3300037853 Bacteria 647
55 Ga0436364_1352655 3300037853 Bacteria 4930
56 Ga0436365_0436054 3300039437 Bacteria 24314
57 Ga0436365_0669998 3300039437 Bacteria 4443
58 Ga0436365_0694102 3300039437 Bacteria 1088
59 Ga0436365_1363975 3300039437 Bacteria 1114
60 Ga0436365_1371810 3300039437 Bacteria 666
61 Ga0436365_1381046 3300039437 Bacteria 1639
62 Ga0436365_1502010 3300039437 Bacteria 14596
63 Ga0436365_1607052 3300039437 Bacteria 3924
64 Ga0436365_1664535 3300039437 Bacteria 907
65 Ga0436365_1772343 3300039437 Bacteria 8487
66 Ga0436360_1367702 3300039438 Bacteria 951
67 Ga0436361_0663071 3300039447 Bacteria 3149
68 Ga0436363_0198098 3300039450 Bacteria 521
69 Ga0436363_0533459 3300039450 Bacteria 8628
70 Ga0436363_0699187 3300039450 Bacteria 719
71 Ga0436363_0816042 3300039450 Bacteria 713
72 Ga0436363_0862078 3300039450 Bacteria 33162
73 Ga0436363_1035953 3300039450 Bacteria 1407
74 Ga0436363_1089128 3300039450 Bacteria 1702
75 Ga0436363_1252203 3300039450 Bacteria 5648
76 Ga0436363_1363364 3300039450 Bacteria 11754
77 Ga0436363_1374978 3300039450 Bacteria 642
78 Ga0436363_1407790 3300039450 Bacteria 1570
79 Ga0436363_1547221 3300039450 Bacteria 870
80 Ga0436363_1583730 3300039450 Bacteria 1199
81 Ga0436363_1668999 3300039450 Bacteria 671
82 Ga0436362_0112184 3300039453 Bacteria 927
83 Ga0436362_1051298 3300039453 Bacteria 2382
84 Ga0451835_0528909 3300041492 Bacteria 529
85 Ga0451853_1457694 3300041512 Bacteria 751
86 Ga0466969_0100878 3300044656 Bacteria 1359
87 Ga0466969_0209192 3300044656 Bacteria 889
88 Ga0466969_0307884 3300044656 Unclassified 717
89 Ga0466972_0207264 3300044658 Bacteria 918
90 Ga0466972_0494994 3300044658 Bacteria 575
91 Ga0466965_0042959 3300044683 Unclassified 2231
92 Ga0466966_0040983 3300044684 Bacteria 2978
93 Ga0466966_0053920 3300044684 Bacteria 2550
94 Ga0466966_0265851 3300044684 Bacteria 1032
95 Ga0466966_0346703 3300044684 Bacteria 892
96 Ga0466966_0377336 3300044684 Bacteria 852
97 Ga0466966_0432206 3300044684 Bacteria 791
98 Ga0466966_0581005 3300044684 Bacteria 674
99 Ga0466966_0791179 3300044684 Bacteria 572
100 Ga0466961_0002526 3300044693 Bacteria 11346
101 Ga0466961_0046520 3300044693 Bacteria 2775
102 Ga0466961_0216564 3300044693 Bacteria 1181
103 Ga0466961_0433694 3300044693 Bacteria 796
104 Ga0466961_0575059 3300044693 Bacteria 678
105 Ga0466961_0890747 3300044693 Bacteria 530
106 Ga0466961_0902743 3300044693 Unclassified 526
107 Ga0466963_0012236 3300044694 Bacteria 5247
108 Ga0466963_0065456 3300044694 Bacteria 2437
109 Ga0466963_0468851 3300044694 Bacteria 889
110 Ga0466971_0018940 3300044719 Bacteria 3053
111 Ga0466971_0249797 3300044719 Bacteria 845
112 Ga0466971_0459108 3300044719 Unclassified 625
113 Ga0466968_0030131 3300044735 Bacteria 2247
114 Ga0466968_0073256 3300044735 Bacteria 1494
115 Ga0466968_0186771 3300044735 Bacteria 966
116 Ga0466968_0248766 3300044735 Bacteria 844
117 Ga0466968_0419589 3300044735 Bacteria 658
118 Ga0466970_0169818 3300044765 Bacteria 1208
119 Ga0466957_0011085 3300044842 Bacteria 5189
120 Ga0466957_0424533 3300044842 Bacteria 913
121 Ga0466957_0673513 3300044842 Bacteria 729
122 Ga0466960_0001118 3300044901 Bacteria 9629
123 Ga0466960_0213792 3300044901 Bacteria 1058
124 Ga0466959_0003955 3300045049 Bacteria 9846
125 Ga0466959_0005555 3300045049 Bacteria 8654
126 Ga0466959_0066983 3300045049 Unclassified 2604
127 Ga0466959_0129582 3300045049 Bacteria 1788
128 Ga0466959_0135406 3300045049 Bacteria 1744
129 Ga0466959_0208229 3300045049 Bacteria 1359
130 Ga0466959_0533320 3300045049 Bacteria 792
131 Ga0466958_0032533 3300045836 Bacteria 3103
132 Ga0466958_0037581 3300045836 Bacteria 2901
133 Ga0466958_0164893 3300045836 Bacteria 1401
134 Ga0466958_0222272 3300045836 Bacteria 1205
135 Ga0466958_0335790 3300045836 Bacteria 972
136 Ga0466958_0499764 3300045836 Bacteria 789
137 Ga0466958_0507865 3300045836 Bacteria 782
138 Ga0466958_0670133 3300045836 Bacteria 675
139 Ga0466958_0704789 3300045836 Bacteria 658
140 Ga0466967_0023017 3300045976 Bacteria 5098
141 Ga0466967_0029280 3300045976 Unclassified 4607
142 Ga0466967_0265278 3300045976 Bacteria 1644
143 Ga0466967_0957472 3300045976 Bacteria 852
144 Ga0466967_1039919 3300045976 Bacteria 816
145 Ga0466967_1389766 3300045976 Bacteria 699
146 Ga0466967_2119338 3300045976 Bacteria 558
147 Ga0495592_0318191 3300046454 Bacteria 1006
148 Ga0495603_0478883 3300046455 Bacteria 713
149 Ga0495629_0123223 3300046459 Bacteria 1806
150 Ga0495641_0042221 3300046461 Bacteria 2115
151 Ga0495651_0057268 3300046462 Bacteria 2992
152 Ga0495651_0163309 3300046462 Bacteria 1594
153 Ga0495653_0161562 3300046463 Bacteria 1554
154 Ga0495653_0282054 3300046463 Bacteria 1090
155 Ga0495582_0058480 3300046473 Bacteria 2126
156 Ga0495664_0381820 3300046477 Bacteria 847
157 Ga0495664_0454241 3300046477 Bacteria 767
158 Ga0495608_0027938 3300046511 Bacteria 3835
159 Ga0495608_0846905 3300046511 Unclassified 538
160 Ga0495628_0115150 3300046516 Bacteria 2065
161 Ga0495652_0095451 3300046529 Bacteria 2423
162 Ga0495665_0207770 3300046531 Bacteria 1014
163 Ga0495645_0198245 3300046543 Bacteria 1364
164 Ga0495667_0040983 3300046559 Bacteria 3072
165 Ga0495667_0514884 3300046559 Bacteria 749
166 Ga0495635_0023068 3300046663 Bacteria 4337
167 Ga0495657_0012221 3300046675 Bacteria 6384
168 Ga0495657_0879668 3300046675 Bacteria 510
169 Ga0495599_0383150 3300046678 Bacteria 839
170 Ga0495623_0037751 3300046679 Bacteria 3090
171 Ga0495646_0047809 3300046680 Bacteria 2602
172 Ga0495658_0364740 3300046683 Bacteria 919
173 Ga0495613_0067434 3300046689 Bacteria 2612
174 Ga0495581_0025606 3300047315 Bacteria 3421
175 Ga0495581_0556607 3300047315 Bacteria 665
176 Ga0495674_0065898 3300047319 Bacteria 3144
177 Ga0495680_0014633 3300047322 Bacteria 6787
178 Ga0495684_0133095 3300047471 Bacteria 1866
179 Ga0495593_0103337 3300047673 Bacteria 1460
180 Ga0495602_0031326 3300048088 Bacteria 5029
181 Ga0496100_0000285 3300048903 Bacteria 25690
182 Ga0496100_1118020 3300048903 Bacteria 621
183 Ga0496101_0003134 3300048904 Bacteria 10228
184 Ga0496104_0039007 3300048907 Bacteria 4446
185 Ga0496104_0289553 3300048907 Bacteria 1550
186 Ga0496105_0117271 3300048908 Bacteria 2196
187 Ga0496106_1048978 3300048909 Bacteria 640
188 Ga0496108_0279213 3300048911 Bacteria 1454
189 Ga0496108_0424851 3300048911 Bacteria 1161
190 Ga0496109_0001288 3300048912 Bacteria 20809
191 Ga0496110_1526253 3300048913 Bacteria 578
192 Ga0496112_0000418 3300048915 Bacteria 28077
193 Ga0496112_0053650 3300048915 Bacteria 3960
194 Ga0496112_0333729 3300048915 Bacteria 1460
195 Ga0496114_0605093 3300048917 Bacteria 966
196 Ga0496115_0641694 3300048918 Bacteria 840
197 Ga0501034_0017641 3300049571 Bacteria 7319
198 Ga0501048_0551910 3300049582 Bacteria 827
199 Ga0495601_0365127 3300053077 Bacteria 938
200 Ga0495595_0010405 3300053084 Bacteria 3865
201 Ga0466962_0065363 3300061719 Bacteria 1737
202 Ga0466962_0407960 3300061719 Bacteria 681
203 Ga0466962_0413147 3300061719 Unclassified 676
204 Ga0466966_0179729
205 Ga0070714_100053408
206 Ga0068852_100673556
207 Ga0070712_100000170
208 Ga0070712_100029312
209 Ga0070712_100253281
210 Ga0070712_100517781
211 Ga0105249_10319756
212 Ga0163162_10244159
213 Ga0213874_10000577
214 Ga0213874_10310572
215 Ga0213876_10010556
216 Ga0213876_10031716
217 Ga0213876_10055943
218 Ga0213876_10071686
219 Ga0213876_10268051
220 Ga0213876_10377359
221 Ga0213875_10007187
222 Ga0213875_10012616
223 Ga0213875_10189428
224 Ga0207693_10000028
225 Ga0207693_10004645
226 Ga0207693_10331452
227 Ga0207693_10561928
228 Ga0207693_10801918
229 Ga0207700_10208551
230 Ga0207664_10704439
231 Ga0207664_11772077
232 Ga0207712_10518963
233 Ga0207668_10072173
234 Ga0207678_10230286
235 Ga0207675_100219522
236 Ga0207698_10289455
237 Ga0265338_10048532
238 Ga0265327_10056908
239 Ga0316578_10449355
240 Ga0373923_0078133
241 Ga0373954_0039506
242 Ga0373955_0223531
243 Ga0373935_0819467
244 Ga0373933_0069817
245 Ga0373947_0166128
246 Ga0373937_0029663
247 Ga0373937_0908935
248 Ga0316584_0106934
249 Ga0373925_0853167
250 Ga0436364_0054966
251 Ga0436364_0091363
252 Ga0436364_0208692
253 Ga0436364_0239386
254 Ga0436364_0321057
255 Ga0436364_0420564
256 Ga0436364_1046606
257 Ga0436364_1270285
258 Ga0436364_1352655
259 Ga0436365_0436054
260 Ga0436365_0669998
261 Ga0436365_0694102
262 Ga0436365_1363975
263 Ga0436365_1371810
264 Ga0436365_1381046
265 Ga0436365_1502010
266 Ga0436365_1607052
267 Ga0436365_1664535
268 Ga0436365_1772343
269 Ga0436360_1367702
270 Ga0436361_0663071
271 Ga0436363_0198098
272 Ga0436363_0533459
273 Ga0436363_0699187
274 Ga0436363_0816042
275 Ga0436363_0862078
276 Ga0436363_1035953
277 Ga0436363_1089128
278 Ga0436363_1252203
279 Ga0436363_1363364
280 Ga0436363_1374978
281 Ga0436363_1407790
282 Ga0436363_1547221
283 Ga0436363_1583730
284 Ga0436363_1668999
285 Ga0436362_0112184
286 Ga0436362_1051298
287 Ga0451835_0528909
288 Ga0451853_1457694
289 Ga0466969_0100878
290 Ga0466969_0209192
291 Ga0466969_0307884
292 Ga0466972_0207264
293 Ga0466972_0494994
294 Ga0466965_0042959
295 Ga0466966_0040983
296 Ga0466966_0053920
297 Ga0466966_0265851
298 Ga0466966_0346703
299 Ga0466966_0377336
300 Ga0466966_0432206
301 Ga0466966_0581005
302 Ga0466966_0791179
303 Ga0466961_0002526
304 Ga0466961_0046520
305 Ga0466961_0216564
306 Ga0466961_0433694
307 Ga0466961_0575059
308 Ga0466961_0890747
309 Ga0466961_0902743
310 Ga0466963_0012236
311 Ga0466963_0065456
312 Ga0466963_0468851
313 Ga0466971_0018940
314 Ga0466971_0249797
315 Ga0466971_0459108
316 Ga0466968_0030131
317 Ga0466968_0073256
318 Ga0466968_0186771
319 Ga0466968_0248766
320 Ga0466968_0419589
321 Ga0466970_0169818
322 Ga0466957_0011085
323 Ga0466957_0424533
324 Ga0466957_0673513
325 Ga0466960_0001118
326 Ga0466960_0213792
327 Ga0466959_0003955
328 Ga0466959_0005555
329 Ga0466959_0066983
330 Ga0466959_0129582
331 Ga0466959_0135406
332 Ga0466959_0208229
333 Ga0466959_0533320
334 Ga0466958_0032533
335 Ga0466958_0037581
336 Ga0466958_0164893
337 Ga0466958_0222272
338 Ga0466958_0335790
339 Ga0466958_0499764
340 Ga0466958_0507865
341 Ga0466958_0670133
342 Ga0466958_0704789
343 Ga0466967_0023017
344 Ga0466967_0029280
345 Ga0466967_0265278
346 Ga0466967_0957472
347 Ga0466967_1039919
348 Ga0466967_1389766
349 Ga0466967_2119338
350 Ga0495592_0318191
351 Ga0495603_0478883
352 Ga0495629_0123223
353 Ga0495641_0042221
354 Ga0495651_0057268
355 Ga0495651_0163309
356 Ga0495653_0161562
357 Ga0495653_0282054
358 Ga0495582_0058480
359 Ga0495664_0381820
360 Ga0495664_0454241
361 Ga0495608_0027938
362 Ga0495608_0846905
363 Ga0495628_0115150
364 Ga0495652_0095451
365 Ga0495665_0207770
366 Ga0495645_0198245
367 Ga0495667_0040983
368 Ga0495667_0514884
369 Ga0495635_0023068
370 Ga0495657_0012221
371 Ga0495657_0879668
372 Ga0495599_0383150
373 Ga0495623_0037751
374 Ga0495646_0047809
375 Ga0495658_0364740
376 Ga0495613_0067434
377 Ga0495581_0025606
378 Ga0495581_0556607
379 Ga0495674_0065898
380 Ga0495680_0014633
381 Ga0495684_0133095
382 Ga0495593_0103337
383 Ga0495602_0031326
384 Ga0496100_0000285
385 Ga0496100_1118020
386 Ga0496101_0003134
387 Ga0496104_0039007
388 Ga0496104_0289553
389 Ga0496105_0117271
390 Ga0496106_1048978
391 Ga0496108_0279213
392 Ga0496108_0424851
393 Ga0496109_0001288
394 Ga0496110_1526253
395 Ga0496112_0000418
396 Ga0496112_0053650
397 Ga0496112_0333729
398 Ga0496114_0605093
399 Ga0496115_0641694
400 Ga0501034_0017641
401 Ga0501048_0551910
402 Ga0495601_0365127
403 Ga0495595_0010405
404 Ga0466962_0065363
405 Ga0466962_0407960
406 Ga0466962_0413147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoq-assembly1.cif.gz_A crystal structure of a lanthipeptide protease 0.6483 22 88
4zoq-assembly1.cif.gz_A crystal structure of a lanthipeptide protease 0.6173 22 88
4zoq-assembly7.cif.gz_G crystal structure of a lanthipeptide protease 0.5966 22 91
1jqg-assembly1.cif.gz_A crystal structure of the carboxypeptidase a from helicoverpa armigera 0.5956 14 90
4zoq-assembly7.cif.gz_G crystal structure of a lanthipeptide protease 0.5825 22 91
ID Description Score Start End Superfamily
2mzwA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.6381 14 89 3.30.70.870
af_Q93YZ7_400_477_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.6372 20 105 3.30.70.1150
2mzwA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.6313 14 89 3.30.70.870
4d3gA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6293 20 92 3.30.70.120
af_Q93YZ7_400_477_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.6146 20 105 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A7V9CRW9-F1-model_v4 Uncharacterized protein 0.9147 1 100
AF-A0A7W1BRJ4-F1-model_v4 Uncharacterized protein 0.9105 1 95
AF-A0A538L6C6-F1-model_v4 Uncharacterized protein 0.9007 1 100
AF-A0A7V9KXI2-F1-model_v4 Uncharacterized protein 0.9 1 101
AF-A0A7W0NIP1-F1-model_v4 Uncharacterized protein 0.8864 1 101

Map