F310989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 203 | 142 | 202 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100077188|Ga0068855_1000771881 |
| Length | 349 |
| Sequence | MSDATDVTGKPGNKTGNTSSLKLAFLFPGQGSQKVGMGKALYDASPLARAVFEEADATLGFALSKMCFEGPEEQLTLTANSQPAILTTSIAALRVLQAETGLQPSVVAGHSLGEYSALVAAGALALADAVKVVNLRGRFMQDAVPPGVGAMAAILGLDAAQVEAACAEARAAFPDEVVSPANFNGAGQVVIAGHKRAVETACVSAKARGAKRAMPLAVSAPFHCALMQPAAERLAVELARIEVKTPAVPVIANVDAAPNSDAGRVRGLLTQQVTAPVRWEETVLRLAAMEIGRAIELGHGSVLAGLGKRIAPGLEVVSVGDPGAVSGLAGGTNNHLNNVNAPGEGGTHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 52 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 89 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 97 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 106 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 118 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 121 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 122 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 127 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 128 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 129 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 132 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 133 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 134 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 140 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.55 |
| Metatranscriptomes | 2.96 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 4.43 |
| Rhizosphere | 93.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10038322 | 3300003320 | Bacteria | 18319 |
| 2 | Ga0070658_10004468 | 3300005327 | Bacteria | 11388 |
| 3 | Ga0070683_100257849 | 3300005329 | Bacteria | 1659 |
| 4 | Ga0068869_100048068 | 3300005334 | Bacteria | 3083 |
| 5 | Ga0070666_10005463 | 3300005335 | Bacteria | 7790 |
| 6 | Ga0070680_100052897 | 3300005336 | Bacteria | 3314 |
| 7 | Ga0070660_100070779 | 3300005339 | Bacteria | 2722 |
| 8 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 9 | Ga0070687_100162018 | 3300005343 | Bacteria | 1323 |
| 10 | Ga0070668_100046279 | 3300005347 | Bacteria | 3340 |
| 11 | Ga0070713_100210317 | 3300005436 | Bacteria | 1761 |
| 12 | Ga0070694_100013212 | 3300005444 | Bacteria | 5153 |
| 13 | Ga0070694_100460076 | 3300005444 | Bacteria | 1006 |
| 14 | Ga0070708_100087676 | 3300005445 | Bacteria | 2828 |
| 15 | Ga0070663_100072540 | 3300005455 | Bacteria | 2509 |
| 16 | Ga0070662_100014217 | 3300005457 | Bacteria | 5312 |
| 17 | Ga0070681_10061405 | 3300005458 | Bacteria | 3733 |
| 18 | Ga0070706_100014865 | 3300005467 | Bacteria | 7193 |
| 19 | Ga0070707_100062772 | 3300005468 | Bacteria | 3565 |
| 20 | Ga0070707_100402919 | 3300005468 | Bacteria | 1328 |
| 21 | Ga0070679_100049042 | 3300005530 | Bacteria | 4206 |
| 22 | Ga0070679_100147790 | 3300005530 | Bacteria | 2327 |
| 23 | Ga0070684_100270442 | 3300005535 | Bacteria | 1556 |
| 24 | Ga0068853_100147187 | 3300005539 | Bacteria | 2117 |
| 25 | Ga0070695_100000306 | 3300005545 | Bacteria | 24843 |
| 26 | Ga0068855_100063669 | 3300005563 | Bacteria | 4303 |
| 27 | Ga0068855_100077188 | 3300005563 | Bacteria | 3864 |
| 28 | Ga0068857_100110014 | 3300005577 | Bacteria | 2476 |
| 29 | Ga0068856_100106910 | 3300005614 | Bacteria | 2793 |
| 30 | Ga0068856_100290076 | 3300005614 | Bacteria | 1653 |
| 31 | Ga0070702_100068580 | 3300005615 | Bacteria | 2087 |
| 32 | Ga0068859_100118109 | 3300005617 | Bacteria | 2718 |
| 33 | Ga0068864_100038233 | 3300005618 | Bacteria | 4097 |
| 34 | Ga0068861_100084028 | 3300005719 | Bacteria | 2499 |
| 35 | Ga0068851_10048306 | 3300005834 | Bacteria | 2157 |
| 36 | Ga0068858_100098205 | 3300005842 | Bacteria | 2730 |
| 37 | Ga0068860_100013772 | 3300005843 | Bacteria | 7929 |
| 38 | Ga0068860_100106533 | 3300005843 | Bacteria | 2677 |
| 39 | Ga0070717_10184543 | 3300006028 | Bacteria | 1820 |
| 40 | Ga0075428_100025080 | 3300006844 | Bacteria | 6597 |
| 41 | Ga0075428_100125117 | 3300006844 | Bacteria | 2798 |
| 42 | Ga0075430_100073278 | 3300006846 | Bacteria | 2872 |
| 43 | Ga0075431_100160595 | 3300006847 | Unclassified | 2311 |
| 44 | Ga0075429_100017233 | 3300006880 | Bacteria | 6248 |
| 45 | Ga0075429_100055961 | 3300006880 | Bacteria | 3433 |
| 46 | Ga0075436_100174715 | 3300006914 | Bacteria | 1517 |
| 47 | Ga0097620_100118115 | 3300006931 | Bacteria | 2718 |
| 48 | Ga0105240_10009273 | 3300009093 | Bacteria | 13959 |
| 49 | Ga0105245_10040754 | 3300009098 | Bacteria | 4138 |
| 50 | Ga0105248_10070229 | 3300009177 | Bacteria | 3933 |
| 51 | Ga0105248_10608368 | 3300009177 | Bacteria | 1233 |
| 52 | Ga0105237_10001922 | 3300009545 | Bacteria | 26511 |
| 53 | Ga0105238_10004323 | 3300009551 | Bacteria | 14093 |
| 54 | Ga0105249_10223866 | 3300009553 | Bacteria | 1852 |
| 55 | Ga0105239_10170650 | 3300010375 | Bacteria | 2432 |
| 56 | Ga0157370_10226772 | 3300013104 | Bacteria | 1730 |
| 57 | Ga0157374_10018941 | 3300013296 | Bacteria | 6087 |
| 58 | Ga0157374_10083555 | 3300013296 | Bacteria | 3034 |
| 59 | Ga0163162_10009022 | 3300013306 | Bacteria | 9694 |
| 60 | Ga0182008_10001710 | 3300014497 | Bacteria | 14399 |
| 61 | Ga0157377_10001941 | 3300014745 | Bacteria | 9047 |
| 62 | Ga0157379_10020458 | 3300014968 | Bacteria | 5853 |
| 63 | Ga0157376_10165188 | 3300014969 | Bacteria | 2011 |
| 64 | Ga0209129_1000785 | 3300025258 | Bacteria | 20058 |
| 65 | Ga0207688_10008683 | 3300025901 | Bacteria | 5529 |
| 66 | Ga0207680_10004220 | 3300025903 | Bacteria | 6802 |
| 67 | Ga0207645_10042158 | 3300025907 | Bacteria | 2921 |
| 68 | Ga0207705_10004655 | 3300025909 | Bacteria | 10353 |
| 69 | Ga0207684_10043524 | 3300025910 | Bacteria | 3807 |
| 70 | Ga0207695_10002570 | 3300025913 | Bacteria | 26673 |
| 71 | Ga0207671_10000186 | 3300025914 | Bacteria | 95503 |
| 72 | Ga0207660_10012402 | 3300025917 | Bacteria | 5576 |
| 73 | Ga0207657_10019063 | 3300025919 | Bacteria | 6527 |
| 74 | Ga0207652_10001606 | 3300025921 | Bacteria | 19875 |
| 75 | Ga0207652_10015287 | 3300025921 | Bacteria | 6231 |
| 76 | Ga0207646_10523651 | 3300025922 | Bacteria | 1067 |
| 77 | Ga0207681_10036853 | 3300025923 | Bacteria | 3229 |
| 78 | Ga0207694_10015142 | 3300025924 | Bacteria | 5815 |
| 79 | Ga0207687_10038947 | 3300025927 | Bacteria | 3252 |
| 80 | Ga0207700_10302030 | 3300025928 | Bacteria | 1383 |
| 81 | Ga0207706_10006738 | 3300025933 | Bacteria | 10621 |
| 82 | Ga0207670_10000002 | 3300025936 | Bacteria | 783058 |
| 83 | Ga0207711_10022917 | 3300025941 | Bacteria | 5226 |
| 84 | Ga0207689_10017464 | 3300025942 | Bacteria | 6070 |
| 85 | Ga0207661_10245002 | 3300025944 | Bacteria | 1591 |
| 86 | Ga0207667_10024293 | 3300025949 | Bacteria | 6656 |
| 87 | Ga0207677_10002663 | 3300026023 | Bacteria | 9406 |
| 88 | Ga0207678_10072444 | 3300026067 | Bacteria | 2952 |
| 89 | Ga0207702_10035071 | 3300026078 | Bacteria | 4195 |
| 90 | Ga0207674_10092751 | 3300026116 | Bacteria | 3009 |
| 91 | Ga0207675_100007218 | 3300026118 | Bacteria | 10496 |
| 92 | Ga0207698_10066211 | 3300026142 | Bacteria | 2843 |
| 93 | Ga0207698_10248584 | 3300026142 | Bacteria | 1626 |
| 94 | Ga0268264_10010520 | 3300028381 | Bacteria | 7649 |
| 95 | Ga0268264_10268394 | 3300028381 | Bacteria | 1593 |
| 96 | Ga0265318_10000008 | 3300028577 | Bacteria | 279221 |
| 97 | Ga0265318_10000061 | 3300028577 | Bacteria | 108688 |
| 98 | Ga0265338_10011793 | 3300028800 | Bacteria | 10047 |
| 99 | Ga0265330_10000038 | 3300031235 | Bacteria | 120147 |
| 100 | Ga0265330_10001137 | 3300031235 | Bacteria | 15910 |
| 101 | Ga0265330_10032165 | 3300031235 | Bacteria | 2351 |
| 102 | Ga0265332_10000191 | 3300031238 | Bacteria | 49944 |
| 103 | Ga0265332_10000623 | 3300031238 | Bacteria | 23085 |
| 104 | Ga0265332_10007253 | 3300031238 | Bacteria | 5019 |
| 105 | Ga0265332_10043361 | 3300031238 | Bacteria | 1942 |
| 106 | Ga0265328_10001541 | 3300031239 | Bacteria | 10633 |
| 107 | Ga0265328_10002633 | 3300031239 | Bacteria | 8019 |
| 108 | Ga0265328_10004160 | 3300031239 | Bacteria | 6310 |
| 109 | Ga0265328_10041653 | 3300031239 | Bacteria | 1690 |
| 110 | Ga0265320_10000066 | 3300031240 | Bacteria | 95235 |
| 111 | Ga0265320_10004773 | 3300031240 | Bacteria | 8821 |
| 112 | Ga0265320_10009198 | 3300031240 | Bacteria | 5977 |
| 113 | Ga0265320_10025559 | 3300031240 | Bacteria | 3103 |
| 114 | Ga0265320_10028323 | 3300031240 | Bacteria | 2909 |
| 115 | Ga0265325_10122341 | 3300031241 | Bacteria | 1253 |
| 116 | Ga0265329_10003138 | 3300031242 | Bacteria | 7277 |
| 117 | Ga0265329_10008171 | 3300031242 | Bacteria | 3990 |
| 118 | Ga0265329_10015787 | 3300031242 | Bacteria | 2630 |
| 119 | Ga0265339_10017148 | 3300031249 | Bacteria | 4294 |
| 120 | Ga0265331_10000004 | 3300031250 | Bacteria | 476985 |
| 121 | Ga0265331_10000095 | 3300031250 | Bacteria | 121876 |
| 122 | Ga0265331_10002678 | 3300031250 | Bacteria | 11891 |
| 123 | Ga0265331_10051662 | 3300031250 | Bacteria | 1967 |
| 124 | Ga0265316_10000063 | 3300031344 | Bacteria | 113592 |
| 125 | Ga0265316_10000710 | 3300031344 | Bacteria | 36726 |
| 126 | Ga0265316_10004074 | 3300031344 | Bacteria | 14620 |
| 127 | Ga0265313_10000005 | 3300031595 | Bacteria | 187978 |
| 128 | Ga0265313_10018567 | 3300031595 | Bacteria | 3899 |
| 129 | Ga0265313_10019600 | 3300031595 | Bacteria | 3759 |
| 130 | Ga0316575_10045623 | 3300031665 | Bacteria | 1740 |
| 131 | Ga0265314_10000190 | 3300031711 | Bacteria | 91400 |
| 132 | Ga0265314_10002095 | 3300031711 | Bacteria | 20994 |
| 133 | Ga0265314_10005310 | 3300031711 | Bacteria | 11656 |
| 134 | Ga0265314_10011083 | 3300031711 | Bacteria | 7472 |
| 135 | Ga0265314_10037963 | 3300031711 | Bacteria | 3484 |
| 136 | Ga0265342_10000388 | 3300031712 | Bacteria | 48589 |
| 137 | Ga0265342_10000991 | 3300031712 | Bacteria | 27985 |
| 138 | Ga0265342_10003302 | 3300031712 | Bacteria | 13326 |
| 139 | Ga0265342_10005702 | 3300031712 | Bacteria | 9413 |
| 140 | Ga0265342_10006118 | 3300031712 | Bacteria | 9016 |
| 141 | Ga0265342_10012854 | 3300031712 | Bacteria | 5651 |
| 142 | Ga0316578_10191402 | 3300031728 | Bacteria | 1232 |
| 143 | Ga0307405_10292410 | 3300031731 | Bacteria | 1232 |
| 144 | Ga0316577_10146275 | 3300031733 | Bacteria | 1331 |
| 145 | Ga0307412_10398714 | 3300031911 | Bacteria | 1119 |
| 146 | Ga0307416_100432694 | 3300032002 | Bacteria | 1363 |
| 147 | Ga0307411_10154287 | 3300032005 | Bacteria | 1711 |
| 148 | Ga0307415_100124304 | 3300032126 | Bacteria | 1941 |
| 149 | Ga0316593_10000048 | 3300032168 | Bacteria | 13632 |
| 150 | Ga0316593_10001542 | 3300032168 | Bacteria | 5123 |
| 151 | Ga0316593_10038426 | 3300032168 | Bacteria | 1585 |
| 152 | Ga0316592_1000210 | 3300033524 | Bacteria | 7141 |
| 153 | Ga0316587_1000070 | 3300033529 | Bacteria | 6890 |
| 154 | Ga0316596_1000105 | 3300033541 | Bacteria | 10649 |
| 155 | Ga0373956_0022876 | 3300035119 | Bacteria | 2678 |
| 156 | Ga0373957_0016907 | 3300035120 | Bacteria | 2533 |
| 157 | Ga0373957_0072549 | 3300035120 | Bacteria | 1348 |
| 158 | Ga0373955_0004393 | 3300035172 | Bacteria | 6238 |
| 159 | Ga0316574_0012916 | 3300035398 | Bacteria | 4789 |
| 160 | Ga0316574_0068853 | 3300035398 | Bacteria | 2232 |
| 161 | Ga0316574_0097523 | 3300035398 | Bacteria | 1879 |
| 162 | Ga0316574_0238761 | 3300035398 | Bacteria | 1162 |
| 163 | Ga0373931_0298278 | 3300035691 | Bacteria | 994 |
| 164 | Ga0373933_0006410 | 3300035724 | Bacteria | 6404 |
| 165 | Ga0373933_0042414 | 3300035724 | Bacteria | 2690 |
| 166 | Ga0373937_0003896 | 3300036401 | Bacteria | 12623 |
| 167 | Ga0316582_0049062 | 3300036647 | Bacteria | 2671 |
| 168 | Ga0400483_243862 | 3300039062 | Unclassified | 1707 |
| 169 | Ga0436365_0125853 | 3300039437 | Bacteria | 1159 |
| 170 | Ga0451577_0017527 | 3300042876 | Bacteria | 6616 |
| 171 | Ga0451577_0218368 | 3300042876 | Bacteria | 1723 |
| 172 | Ga0451577_0446017 | 3300042876 | Unclassified | 1175 |
| 173 | Ga0453684_0064988 | 3300044712 | Unclassified | 4656 |
| 174 | Ga0453684_0069790 | 3300044712 | Bacteria | 4455 |
| 175 | Ga0453684_0081866 | 3300044712 | Unclassified | 4024 |
| 176 | Ga0453684_0097662 | 3300044712 | Bacteria | 3604 |
| 177 | Ga0453684_0158378 | 3300044712 | Bacteria | 2681 |
| 178 | Ga0451576_0000241 | 3300045051 | Bacteria | 133881 |
| 179 | Ga0451576_0041412 | 3300045051 | Bacteria | 4870 |
| 180 | Ga0466967_0109872 | 3300045976 | Bacteria | 2532 |
| 181 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 182 | Ga0496100_0199840 | 3300048903 | Bacteria | 1456 |
| 183 | Ga0496102_0165151 | 3300048905 | Bacteria | 2083 |
| 184 | Ga0496104_0009946 | 3300048907 | Bacteria | 8488 |
| 185 | Ga0496105_0318763 | 3300048908 | Bacteria | 1246 |
| 186 | Ga0496107_0173089 | 3300048910 | Bacteria | 1602 |
| 187 | Ga0496109_0206017 | 3300048912 | Bacteria | 1849 |
| 188 | Ga0496110_0138495 | 3300048913 | Bacteria | 2200 |
| 189 | Ga0496113_0045634 | 3300048916 | Bacteria | 3251 |
| 190 | Ga0496114_0008589 | 3300048917 | Bacteria | 8096 |
| 191 | Ga0501070_0326353 | 3300049586 | Bacteria | 1248 |
| 192 | Ga0501072_0113816 | 3300049588 | Bacteria | 2154 |
| 193 | Ga0501080_0001179 | 3300049742 | Bacteria | 21661 |
| 194 | Ga0501081_0068708 | 3300049743 | Bacteria | 2467 |
| 195 | Ga0501083_0001201 | 3300049744 | Bacteria | 17527 |
| 196 | Ga0501083_0053852 | 3300049744 | Bacteria | 2700 |
| 197 | Ga0501083_0074627 | 3300049744 | Bacteria | 2253 |
| 198 | Ga0501280_000952 | 3300049776 | Bacteria | 6051 |
| 199 | nmdc:mga06r32_141496_c1 | 3300050510 | Unclassified | 2382 |
| 200 | nmdc:mga08x19_153200_c1 | 3300050514 | Bacteria | 1562 |
| 201 | Ga0501084_0000947 | 3300054114 | Bacteria | 22455 |
| 202 | Ga0501084_0151686 | 3300054114 | Bacteria | 1953 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035119 | Ga0373956_0022876 | Ga0373956_0022876_476_1483 | 269 |
| 2 | 3300035120 | Ga0373957_0016907 | Ga0373957_0016907_22_1029 | 269 |
| 3 | 3300035172 | Ga0373955_0004393 | Ga0373955_0004393_4593_5600 | 269 |
| 4 | 3300035724 | Ga0373933_0006410 | Ga0373933_0006410_5241_6248 | 269 |
| 5 | 3300036401 | Ga0373937_0003896 | Ga0373937_0003896_8931_9938 | 269 |
| 6 | 3300026142 | Ga0207698_10248584 | Ga0207698_102485843 | 274 |
| 7 | 3300005535 | Ga0070684_100270442 | Ga0070684_1002704422 | 277 |
| 8 | 3300031239 | Ga0265328_10041653 | Ga0265328_100416532 | 281 |
| 9 | 3300031711 | Ga0265314_10037963 | Ga0265314_100379634 | 281 |
| 10 | 3300005336 | Ga0070680_100052897 | Ga0070680_1000528971 | 283 |
| 11 | 3300005530 | Ga0070679_100049042 | Ga0070679_1000490424 | 283 |
| 12 | 3300025917 | Ga0207660_10012402 | Ga0207660_100124026 | 283 |
| 13 | 3300025921 | Ga0207652_10001606 | Ga0207652_1000160612 | 283 |
| 14 | 3300035691 | Ga0373931_0298278 | Ga0373931_0298278_18_905 | 283 |
| 15 | 3300006028 | Ga0070717_10184543 | Ga0070717_101845432 | 289 |
| 16 | 3300042876 | Ga0451577_0218368 | Ga0451577_0218368_820_1692 | 289 |
| 17 | 3300049743 | Ga0501081_0068708 | Ga0501081_0068708_1268_2158 | 289 |
| 18 | 3300035120 | Ga0373957_0072549 | Ga0373957_0072549_191_1201 | 290 |
| 19 | 3300039437 | Ga0436365_0125853 | Ga0436365_0125853_104_1042 | 291 |
| 20 | 3300005444 | Ga0070694_100013212 | Ga0070694_1000132126 | 292 |
| 21 | 3300005445 | Ga0070708_100087676 | Ga0070708_1000876763 | 292 |
| 22 | 3300009177 | Ga0105248_10608368 | Ga0105248_106083682 | 292 |
| 23 | 3300048907 | Ga0496104_0009946 | Ga0496104_0009946_949_1860 | 292 |
| 24 | 3300048917 | Ga0496114_0008589 | Ga0496114_0008589_4860_5771 | 292 |
| 25 | 3300005467 | Ga0070706_100014865 | Ga0070706_1000148652 | 293 |
| 26 | 3300005468 | Ga0070707_100062772 | Ga0070707_1000627723 | 293 |
| 27 | 3300025910 | Ga0207684_10043524 | Ga0207684_100435244 | 293 |
| 28 | 3300031249 | Ga0265339_10017148 | Ga0265339_100171483 | 293 |
| 29 | 3300036647 | Ga0316582_0049062 | Ga0316582_0049062_644_1528 | 293 |
| 30 | 3300042876 | Ga0451577_0017527 | Ga0451577_0017527_1248_2135 | 293 |
| 31 | 3300044712 | Ga0453684_0097662 | Ga0453684_0097662_38_925 | 293 |
| 32 | 3300005468 | Ga0070707_100402919 | Ga0070707_1004029191 | 295 |
| 33 | 3300006844 | Ga0075428_100125117 | Ga0075428_1001251173 | 295 |
| 34 | 3300006880 | Ga0075429_100055961 | Ga0075429_1000559612 | 295 |
| 35 | 3300028800 | Ga0265338_10011793 | Ga0265338_100117935 | 295 |
| 36 | 3300031240 | Ga0265320_10004773 | Ga0265320_100047738 | 295 |
| 37 | 3300031712 | Ga0265342_10003302 | Ga0265342_1000330213 | 295 |
| 38 | 3300049588 | Ga0501072_0113816 | Ga0501072_0113816_891_1778 | 295 |
| 39 | 3300049744 | Ga0501083_0001201 | Ga0501083_0001201_13445_14332 | 295 |
| 40 | 3300049744 | Ga0501083_0074627 | Ga0501083_0074627_148_1035 | 295 |
| 41 | 3300054114 | Ga0501084_0000947 | Ga0501084_0000947_18476_19363 | 295 |
| 42 | 3300025922 | Ga0207646_10523651 | Ga0207646_105236511 | 296 |
| 43 | 3300032168 | Ga0316593_10038426 | Ga0316593_100384262 | 298 |
| 44 | 3300005334 | Ga0068869_100048068 | Ga0068869_1000480682 | 299 |
| 45 | 3300005339 | Ga0070660_100070779 | Ga0070660_1000707792 | 299 |
| 46 | 3300005347 | Ga0070668_100046279 | Ga0070668_1000462794 | 299 |
| 47 | 3300005444 | Ga0070694_100460076 | Ga0070694_1004600761 | 299 |
| 48 | 3300005455 | Ga0070663_100072540 | Ga0070663_1000725403 | 299 |
| 49 | 3300005457 | Ga0070662_100014217 | Ga0070662_1000142175 | 299 |
| 50 | 3300005539 | Ga0068853_100147187 | Ga0068853_1001471872 | 299 |
| 51 | 3300005614 | Ga0068856_100106910 | Ga0068856_1001069102 | 299 |
| 52 | 3300005615 | Ga0070702_100068580 | Ga0070702_1000685802 | 299 |
| 53 | 3300005618 | Ga0068864_100038233 | Ga0068864_1000382332 | 299 |
| 54 | 3300005719 | Ga0068861_100084028 | Ga0068861_1000840282 | 299 |
| 55 | 3300005834 | Ga0068851_10048306 | Ga0068851_100483063 | 299 |
| 56 | 3300005842 | Ga0068858_100098205 | Ga0068858_1000982053 | 299 |
| 57 | 3300005843 | Ga0068860_100106533 | Ga0068860_1001065332 | 299 |
| 58 | 3300009098 | Ga0105245_10040754 | Ga0105245_100407543 | 299 |
| 59 | 3300009177 | Ga0105248_10070229 | Ga0105248_100702293 | 299 |
| 60 | 3300009553 | Ga0105249_10223866 | Ga0105249_102238662 | 299 |
| 61 | 3300010375 | Ga0105239_10170650 | Ga0105239_101706502 | 299 |
| 62 | 3300013296 | Ga0157374_10018941 | Ga0157374_100189418 | 299 |
| 63 | 3300013306 | Ga0163162_10009022 | Ga0163162_1000902210 | 299 |
| 64 | 3300014745 | Ga0157377_10001941 | Ga0157377_100019412 | 299 |
| 65 | 3300014968 | Ga0157379_10020458 | Ga0157379_100204587 | 299 |
| 66 | 3300014969 | Ga0157376_10165188 | Ga0157376_101651882 | 299 |
| 67 | 3300025901 | Ga0207688_10008683 | Ga0207688_100086837 | 299 |
| 68 | 3300025907 | Ga0207645_10042158 | Ga0207645_100421582 | 299 |
| 69 | 3300025919 | Ga0207657_10019063 | Ga0207657_100190633 | 299 |
| 70 | 3300025923 | Ga0207681_10036853 | Ga0207681_100368533 | 299 |
| 71 | 3300025927 | Ga0207687_10038947 | Ga0207687_100389473 | 299 |
| 72 | 3300025933 | Ga0207706_10006738 | Ga0207706_1000673810 | 299 |
| 73 | 3300025941 | Ga0207711_10022917 | Ga0207711_100229172 | 299 |
| 74 | 3300025942 | Ga0207689_10017464 | Ga0207689_100174645 | 299 |
| 75 | 3300025944 | Ga0207661_10245002 | Ga0207661_102450022 | 299 |
| 76 | 3300026023 | Ga0207677_10002663 | Ga0207677_100026638 | 299 |
| 77 | 3300026067 | Ga0207678_10072444 | Ga0207678_100724443 | 299 |
| 78 | 3300026118 | Ga0207675_100007218 | Ga0207675_10000721810 | 299 |
| 79 | 3300026142 | Ga0207698_10066211 | Ga0207698_100662113 | 299 |
| 80 | 3300028381 | Ga0268264_10268394 | Ga0268264_102683942 | 299 |
| 81 | 3300031595 | Ga0265313_10018567 | Ga0265313_100185673 | 299 |
| 82 | 3300031712 | Ga0265342_10012854 | Ga0265342_100128543 | 299 |
| 83 | 3300048903 | Ga0496100_0199840 | Ga0496100_0199840_154_1092 | 299 |
| 84 | 3300048905 | Ga0496102_0165151 | Ga0496102_0165151_370_1308 | 299 |
| 85 | 3300048908 | Ga0496105_0318763 | Ga0496105_0318763_287_1225 | 299 |
| 86 | 3300048910 | Ga0496107_0173089 | Ga0496107_0173089_102_1040 | 299 |
| 87 | 3300048912 | Ga0496109_0206017 | Ga0496109_0206017_707_1645 | 299 |
| 88 | 3300048913 | Ga0496110_0138495 | Ga0496110_0138495_517_1455 | 299 |
| 89 | 3300048916 | Ga0496113_0045634 | Ga0496113_0045634_297_1235 | 299 |
| 90 | 3300005329 | Ga0070683_100257849 | Ga0070683_1002578492 | 300 |
| 91 | 3300005335 | Ga0070666_10005463 | Ga0070666_100054633 | 300 |
| 92 | 3300005843 | Ga0068860_100013772 | Ga0068860_1000137728 | 300 |
| 93 | 3300025903 | Ga0207680_10004220 | Ga0207680_100042207 | 300 |
| 94 | 3300028381 | Ga0268264_10010520 | Ga0268264_100105204 | 300 |
| 95 | 3300005340 | Ga0070689_100000001 | Ga0070689_100000001107 | 301 |
| 96 | 3300006846 | Ga0075430_100073278 | Ga0075430_1000732781 | 301 |
| 97 | 3300006847 | Ga0075431_100160595 | Ga0075431_1001605952 | 301 |
| 98 | 3300025936 | Ga0207670_10000002 | Ga0207670_1000000210 | 301 |
| 99 | 3300050510 | nmdc:mga06r32_141496_c1 | nmdc:mga06r32_141496_c1_136_1050 | 301 |
| 100 | 3300035724 | Ga0373933_0042414 | Ga0373933_0042414_1222_2178 | 302 |
| 101 | 3300045976 | Ga0466967_0109872 | Ga0466967_0109872_640_1593 | 303 |
| 102 | 3300005530 | Ga0070679_100147790 | Ga0070679_1001477902 | 304 |
| 103 | 3300005563 | Ga0068855_100063669 | Ga0068855_1000636693 | 304 |
| 104 | 3300005614 | Ga0068856_100290076 | Ga0068856_1002900762 | 304 |
| 105 | 3300025921 | Ga0207652_10015287 | Ga0207652_100152872 | 304 |
| 106 | 3300025949 | Ga0207667_10024293 | Ga0207667_100242933 | 304 |
| 107 | 3300026078 | Ga0207702_10035071 | Ga0207702_100350712 | 304 |
| 108 | 3300045051 | Ga0451576_0000241 | Ga0451576_0000241_52192_53109 | 304 |
| 109 | 3300005545 | Ga0070695_100000306 | Ga0070695_1000003064 | 305 |
| 110 | 3300045051 | Ga0451576_0041412 | Ga0451576_0041412_3862_4785 | 305 |
| 111 | 3300006844 | Ga0075428_100025080 | Ga0075428_1000250804 | 306 |
| 112 | 3300006880 | Ga0075429_100017233 | Ga0075429_1000172336 | 306 |
| 113 | 3300042876 | Ga0451577_0446017 | Ga0451577_0446017_196_1137 | 306 |
| 114 | 3300044712 | Ga0453684_0069790 | Ga0453684_0069790_2025_2966 | 306 |
| 115 | 3300044712 | Ga0453684_0081866 | Ga0453684_0081866_2468_3409 | 306 |
| 116 | 3300044712 | Ga0453684_0158378 | Ga0453684_0158378_31_972 | 306 |
| 117 | 3300009551 | Ga0105238_10004323 | Ga0105238_100043233 | 307 |
| 118 | 3300025924 | Ga0207694_10015142 | Ga0207694_100151426 | 307 |
| 119 | 3300031733 | Ga0316577_10146275 | Ga0316577_101462751 | 307 |
| 120 | 3300035398 | Ga0316574_0097523 | Ga0316574_0097523_170_1114 | 307 |
| 121 | 3300044712 | Ga0453684_0064988 | Ga0453684_0064988_2180_3127 | 307 |
| 122 | 3300005436 | Ga0070713_100210317 | Ga0070713_1002103172 | 308 |
| 123 | 3300005617 | Ga0068859_100118109 | Ga0068859_1001181094 | 308 |
| 124 | 3300006914 | Ga0075436_100174715 | Ga0075436_1001747151 | 308 |
| 125 | 3300006931 | Ga0097620_100118115 | Ga0097620_1001181152 | 308 |
| 126 | 3300013296 | Ga0157374_10083555 | Ga0157374_100835554 | 308 |
| 127 | 3300025258 | Ga0209129_1000785 | Ga0209129_100078518 | 308 |
| 128 | 3300025928 | Ga0207700_10302030 | Ga0207700_103020302 | 308 |
| 129 | 3300031235 | Ga0265330_10032165 | Ga0265330_100321652 | 308 |
| 130 | 3300031238 | Ga0265332_10000623 | Ga0265332_100006234 | 308 |
| 131 | 3300031239 | Ga0265328_10004160 | Ga0265328_100041602 | 308 |
| 132 | 3300031240 | Ga0265320_10025559 | Ga0265320_100255594 | 308 |
| 133 | 3300031241 | Ga0265325_10122341 | Ga0265325_101223412 | 308 |
| 134 | 3300031242 | Ga0265329_10008171 | Ga0265329_100081715 | 308 |
| 135 | 3300031242 | Ga0265329_10015787 | Ga0265329_100157873 | 308 |
| 136 | 3300031250 | Ga0265331_10000095 | Ga0265331_1000009543 | 308 |
| 137 | 3300031250 | Ga0265331_10051662 | Ga0265331_100516622 | 308 |
| 138 | 3300031344 | Ga0265316_10000063 | Ga0265316_1000006337 | 308 |
| 139 | 3300031711 | Ga0265314_10002095 | Ga0265314_100020954 | 308 |
| 140 | 3300031712 | Ga0265342_10005702 | Ga0265342_100057029 | 308 |
| 141 | 3300031731 | Ga0307405_10292410 | Ga0307405_102924102 | 308 |
| 142 | 3300031911 | Ga0307412_10398714 | Ga0307412_103987141 | 308 |
| 143 | 3300032002 | Ga0307416_100432694 | Ga0307416_1004326942 | 308 |
| 144 | 3300032005 | Ga0307411_10154287 | Ga0307411_101542872 | 308 |
| 145 | 3300032126 | Ga0307415_100124304 | Ga0307415_1001243042 | 308 |
| 146 | 3300039062 | Ga0400483_243862 | Ga0400483_243862_272_1216 | 308 |
| 147 | 3300049776 | Ga0501280_000952 | Ga0501280_000952_3739_4686 | 308 |
| 148 | 3300050514 | nmdc:mga08x19_153200_c1 | nmdc:mga08x19_153200_c1_69_1004 | 308 |
| 149 | 3300005327 | Ga0070658_10004468 | Ga0070658_100044687 | 309 |
| 150 | 3300005343 | Ga0070687_100162018 | Ga0070687_1001620181 | 309 |
| 151 | 3300005458 | Ga0070681_10061405 | Ga0070681_100614054 | 309 |
| 152 | 3300005563 | Ga0068855_100077188 | Ga0068855_1000771881 | 309 |
| 153 | 3300005577 | Ga0068857_100110014 | Ga0068857_1001100142 | 309 |
| 154 | 3300009093 | Ga0105240_10009273 | Ga0105240_100092737 | 309 |
| 155 | 3300009545 | Ga0105237_10001922 | Ga0105237_1000192223 | 309 |
| 156 | 3300013104 | Ga0157370_10226772 | Ga0157370_102267721 | 309 |
| 157 | 3300014497 | Ga0182008_10001710 | Ga0182008_100017104 | 309 |
| 158 | 3300025909 | Ga0207705_10004655 | Ga0207705_100046557 | 309 |
| 159 | 3300025913 | Ga0207695_10002570 | Ga0207695_1000257013 | 309 |
| 160 | 3300025914 | Ga0207671_10000186 | Ga0207671_1000018662 | 309 |
| 161 | 3300026116 | Ga0207674_10092751 | Ga0207674_100927513 | 309 |
| 162 | 3300028577 | Ga0265318_10000008 | Ga0265318_1000000861 | 309 |
| 163 | 3300028577 | Ga0265318_10000061 | Ga0265318_1000006173 | 309 |
| 164 | 3300031235 | Ga0265330_10000038 | Ga0265330_1000003840 | 309 |
| 165 | 3300031235 | Ga0265330_10001137 | Ga0265330_1000113712 | 309 |
| 166 | 3300031238 | Ga0265332_10000191 | Ga0265332_1000019124 | 309 |
| 167 | 3300031238 | Ga0265332_10007253 | Ga0265332_100072536 | 309 |
| 168 | 3300031238 | Ga0265332_10043361 | Ga0265332_100433612 | 309 |
| 169 | 3300031239 | Ga0265328_10001541 | Ga0265328_100015418 | 309 |
| 170 | 3300031239 | Ga0265328_10002633 | Ga0265328_100026337 | 309 |
| 171 | 3300031240 | Ga0265320_10000066 | Ga0265320_1000006661 | 309 |
| 172 | 3300031240 | Ga0265320_10009198 | Ga0265320_100091983 | 309 |
| 173 | 3300031240 | Ga0265320_10028323 | Ga0265320_100283233 | 309 |
| 174 | 3300031242 | Ga0265329_10003138 | Ga0265329_100031388 | 309 |
| 175 | 3300031250 | Ga0265331_10000004 | Ga0265331_1000000461 | 309 |
| 176 | 3300031250 | Ga0265331_10002678 | Ga0265331_100026787 | 309 |
| 177 | 3300031344 | Ga0265316_10000710 | Ga0265316_1000071013 | 309 |
| 178 | 3300031344 | Ga0265316_10004074 | Ga0265316_1000407413 | 309 |
| 179 | 3300031595 | Ga0265313_10000005 | Ga0265313_1000000595 | 309 |
| 180 | 3300031595 | Ga0265313_10019600 | Ga0265313_100196005 | 309 |
| 181 | 3300031665 | Ga0316575_10045623 | Ga0316575_100456232 | 309 |
| 182 | 3300031711 | Ga0265314_10000190 | Ga0265314_1000019015 | 309 |
| 183 | 3300031711 | Ga0265314_10005310 | Ga0265314_100053108 | 309 |
| 184 | 3300031711 | Ga0265314_10011083 | Ga0265314_100110833 | 309 |
| 185 | 3300031712 | Ga0265342_10000388 | Ga0265342_1000038827 | 309 |
| 186 | 3300031712 | Ga0265342_10000991 | Ga0265342_1000099122 | 309 |
| 187 | 3300031712 | Ga0265342_10006118 | Ga0265342_100061187 | 309 |
| 188 | 3300031728 | Ga0316578_10191402 | Ga0316578_101914021 | 309 |
| 189 | 3300032168 | Ga0316593_10000048 | Ga0316593_100000488 | 309 |
| 190 | 3300032168 | Ga0316593_10001542 | Ga0316593_100015425 | 309 |
| 191 | 3300033524 | Ga0316592_1000210 | Ga0316592_10002105 | 309 |
| 192 | 3300033529 | Ga0316587_1000070 | Ga0316587_10000705 | 309 |
| 193 | 3300033541 | Ga0316596_1000105 | Ga0316596_100010510 | 309 |
| 194 | 3300035398 | Ga0316574_0012916 | Ga0316574_0012916_1693_2658 | 309 |
| 195 | 3300035398 | Ga0316574_0068853 | Ga0316574_0068853_393_1358 | 309 |
| 196 | 3300035398 | Ga0316574_0238761 | Ga0316574_0238761_21_953 | 309 |
| 197 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_18506_19516 | 309 |
| 198 | iso_pu_bacteria | 2919404418 | 2919404940 | 309 |
| 199 | 3300003320 | rootH2_10038322 | rootH2_1003832216 | 311 |
| 200 | 3300049586 | Ga0501070_0326353 | Ga0501070_0326353_293_1228 | 311 |
| 201 | 3300049742 | Ga0501080_0001179 | Ga0501080_0001179_6756_7691 | 311 |
| 202 | 3300049744 | Ga0501083_0053852 | Ga0501083_0053852_1164_2099 | 311 |
| 203 | 3300054114 | Ga0501084_0151686 | Ga0501084_0151686_600_1535 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g2y-assembly1.cif.gz_A | structure of e.coli fabd complexed with malonate | 0.9763 | 2 | 306 |
| 3ptw-assembly1.cif.gz_A | crystal structure of malonyl coa-acyl carrier protein transacylase from clostridium perfringens atcc 13124 | 0.9725 | 1 | 310 |
| 3h0p-assembly1.cif.gz_A | 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. | 0.9714 | 1 | 306 |
| 3tqe-assembly1.cif.gz_A | structure of the malonyl coa-acyl carrier protein transacylase (fabd) from coxiella burnetii | 0.9708 | 1 | 308 |
| 2g2y-assembly1.cif.gz_A | structure of e.coli fabd complexed with malonate | 0.97 | 2 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAI9_6_286_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9774 | 6 | 286 | 3.20.10.10 |
| 3ptwA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding | 0.9756 | 128 | 196 | 3.30.70.250 |
| 3im8A01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9716 | 2 | 309 | 3.40.366.10 |
| af_P0AAI9_6_286_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9705 | 6 | 286 | 3.20.10.10 |
| 2cuyB01 | Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 | 0.9647 | 1 | 309 | 3.40.366.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G1G4T3-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9851 | 1 | 310 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A512IKK0-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9842 | 1 | 305 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A832N1W0-F1-model_v4 | [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) | 0.9835 | 1 | 233 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A1I6GHK3-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9834 | 2 | 309 |
GO:0004314
GO:0005829 GO:0006633 |
| AF-A0A355E4J5-F1-model_v4 | Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) | 0.9834 | 1 | 310 |
GO:0004314
GO:0005829 GO:0006633 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar