F310989

General Info

Members Datasets Scaffolds Average Seq Length
203 142 202 312

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100077188|Ga0068855_1000771881
Length 349
Sequence MSDATDVTGKPGNKTGNTSSLKLAFLFPGQGSQKVGMGKALYDASPLARAVFEEADATLGFALSKMCFEGPEEQLTLTANSQPAILTTSIAALRVLQAETGLQPSVVAGHSLGEYSALVAAGALALADAVKVVNLRGRFMQDAVPPGVGAMAAILGLDAAQVEAACAEARAAFPDEVVSPANFNGAGQVVIAGHKRAVETACVSAKARGAKRAMPLAVSAPFHCALMQPAAERLAVELARIEVKTPAVPVIANVDAAPNSDAGRVRGLLTQQVTAPVRWEETVLRLAAMEIGRAIELGHGSVLAGLGKRIAPGLEVVSVGDPGAVSGLAGGTNNHLNNVNAPGEGGTHA

Samples

Sample ID Description Type Environment
1 2919404418 Luteibacter sp. 3190 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 2.96
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 4.43
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10038322 3300003320 Bacteria 18319
2 Ga0070658_10004468 3300005327 Bacteria 11388
3 Ga0070683_100257849 3300005329 Bacteria 1659
4 Ga0068869_100048068 3300005334 Bacteria 3083
5 Ga0070666_10005463 3300005335 Bacteria 7790
6 Ga0070680_100052897 3300005336 Bacteria 3314
7 Ga0070660_100070779 3300005339 Bacteria 2722
8 Ga0070689_100000001 3300005340 Bacteria 1334580
9 Ga0070687_100162018 3300005343 Bacteria 1323
10 Ga0070668_100046279 3300005347 Bacteria 3340
11 Ga0070713_100210317 3300005436 Bacteria 1761
12 Ga0070694_100013212 3300005444 Bacteria 5153
13 Ga0070694_100460076 3300005444 Bacteria 1006
14 Ga0070708_100087676 3300005445 Bacteria 2828
15 Ga0070663_100072540 3300005455 Bacteria 2509
16 Ga0070662_100014217 3300005457 Bacteria 5312
17 Ga0070681_10061405 3300005458 Bacteria 3733
18 Ga0070706_100014865 3300005467 Bacteria 7193
19 Ga0070707_100062772 3300005468 Bacteria 3565
20 Ga0070707_100402919 3300005468 Bacteria 1328
21 Ga0070679_100049042 3300005530 Bacteria 4206
22 Ga0070679_100147790 3300005530 Bacteria 2327
23 Ga0070684_100270442 3300005535 Bacteria 1556
24 Ga0068853_100147187 3300005539 Bacteria 2117
25 Ga0070695_100000306 3300005545 Bacteria 24843
26 Ga0068855_100063669 3300005563 Bacteria 4303
27 Ga0068855_100077188 3300005563 Bacteria 3864
28 Ga0068857_100110014 3300005577 Bacteria 2476
29 Ga0068856_100106910 3300005614 Bacteria 2793
30 Ga0068856_100290076 3300005614 Bacteria 1653
31 Ga0070702_100068580 3300005615 Bacteria 2087
32 Ga0068859_100118109 3300005617 Bacteria 2718
33 Ga0068864_100038233 3300005618 Bacteria 4097
34 Ga0068861_100084028 3300005719 Bacteria 2499
35 Ga0068851_10048306 3300005834 Bacteria 2157
36 Ga0068858_100098205 3300005842 Bacteria 2730
37 Ga0068860_100013772 3300005843 Bacteria 7929
38 Ga0068860_100106533 3300005843 Bacteria 2677
39 Ga0070717_10184543 3300006028 Bacteria 1820
40 Ga0075428_100025080 3300006844 Bacteria 6597
41 Ga0075428_100125117 3300006844 Bacteria 2798
42 Ga0075430_100073278 3300006846 Bacteria 2872
43 Ga0075431_100160595 3300006847 Unclassified 2311
44 Ga0075429_100017233 3300006880 Bacteria 6248
45 Ga0075429_100055961 3300006880 Bacteria 3433
46 Ga0075436_100174715 3300006914 Bacteria 1517
47 Ga0097620_100118115 3300006931 Bacteria 2718
48 Ga0105240_10009273 3300009093 Bacteria 13959
49 Ga0105245_10040754 3300009098 Bacteria 4138
50 Ga0105248_10070229 3300009177 Bacteria 3933
51 Ga0105248_10608368 3300009177 Bacteria 1233
52 Ga0105237_10001922 3300009545 Bacteria 26511
53 Ga0105238_10004323 3300009551 Bacteria 14093
54 Ga0105249_10223866 3300009553 Bacteria 1852
55 Ga0105239_10170650 3300010375 Bacteria 2432
56 Ga0157370_10226772 3300013104 Bacteria 1730
57 Ga0157374_10018941 3300013296 Bacteria 6087
58 Ga0157374_10083555 3300013296 Bacteria 3034
59 Ga0163162_10009022 3300013306 Bacteria 9694
60 Ga0182008_10001710 3300014497 Bacteria 14399
61 Ga0157377_10001941 3300014745 Bacteria 9047
62 Ga0157379_10020458 3300014968 Bacteria 5853
63 Ga0157376_10165188 3300014969 Bacteria 2011
64 Ga0209129_1000785 3300025258 Bacteria 20058
65 Ga0207688_10008683 3300025901 Bacteria 5529
66 Ga0207680_10004220 3300025903 Bacteria 6802
67 Ga0207645_10042158 3300025907 Bacteria 2921
68 Ga0207705_10004655 3300025909 Bacteria 10353
69 Ga0207684_10043524 3300025910 Bacteria 3807
70 Ga0207695_10002570 3300025913 Bacteria 26673
71 Ga0207671_10000186 3300025914 Bacteria 95503
72 Ga0207660_10012402 3300025917 Bacteria 5576
73 Ga0207657_10019063 3300025919 Bacteria 6527
74 Ga0207652_10001606 3300025921 Bacteria 19875
75 Ga0207652_10015287 3300025921 Bacteria 6231
76 Ga0207646_10523651 3300025922 Bacteria 1067
77 Ga0207681_10036853 3300025923 Bacteria 3229
78 Ga0207694_10015142 3300025924 Bacteria 5815
79 Ga0207687_10038947 3300025927 Bacteria 3252
80 Ga0207700_10302030 3300025928 Bacteria 1383
81 Ga0207706_10006738 3300025933 Bacteria 10621
82 Ga0207670_10000002 3300025936 Bacteria 783058
83 Ga0207711_10022917 3300025941 Bacteria 5226
84 Ga0207689_10017464 3300025942 Bacteria 6070
85 Ga0207661_10245002 3300025944 Bacteria 1591
86 Ga0207667_10024293 3300025949 Bacteria 6656
87 Ga0207677_10002663 3300026023 Bacteria 9406
88 Ga0207678_10072444 3300026067 Bacteria 2952
89 Ga0207702_10035071 3300026078 Bacteria 4195
90 Ga0207674_10092751 3300026116 Bacteria 3009
91 Ga0207675_100007218 3300026118 Bacteria 10496
92 Ga0207698_10066211 3300026142 Bacteria 2843
93 Ga0207698_10248584 3300026142 Bacteria 1626
94 Ga0268264_10010520 3300028381 Bacteria 7649
95 Ga0268264_10268394 3300028381 Bacteria 1593
96 Ga0265318_10000008 3300028577 Bacteria 279221
97 Ga0265318_10000061 3300028577 Bacteria 108688
98 Ga0265338_10011793 3300028800 Bacteria 10047
99 Ga0265330_10000038 3300031235 Bacteria 120147
100 Ga0265330_10001137 3300031235 Bacteria 15910
101 Ga0265330_10032165 3300031235 Bacteria 2351
102 Ga0265332_10000191 3300031238 Bacteria 49944
103 Ga0265332_10000623 3300031238 Bacteria 23085
104 Ga0265332_10007253 3300031238 Bacteria 5019
105 Ga0265332_10043361 3300031238 Bacteria 1942
106 Ga0265328_10001541 3300031239 Bacteria 10633
107 Ga0265328_10002633 3300031239 Bacteria 8019
108 Ga0265328_10004160 3300031239 Bacteria 6310
109 Ga0265328_10041653 3300031239 Bacteria 1690
110 Ga0265320_10000066 3300031240 Bacteria 95235
111 Ga0265320_10004773 3300031240 Bacteria 8821
112 Ga0265320_10009198 3300031240 Bacteria 5977
113 Ga0265320_10025559 3300031240 Bacteria 3103
114 Ga0265320_10028323 3300031240 Bacteria 2909
115 Ga0265325_10122341 3300031241 Bacteria 1253
116 Ga0265329_10003138 3300031242 Bacteria 7277
117 Ga0265329_10008171 3300031242 Bacteria 3990
118 Ga0265329_10015787 3300031242 Bacteria 2630
119 Ga0265339_10017148 3300031249 Bacteria 4294
120 Ga0265331_10000004 3300031250 Bacteria 476985
121 Ga0265331_10000095 3300031250 Bacteria 121876
122 Ga0265331_10002678 3300031250 Bacteria 11891
123 Ga0265331_10051662 3300031250 Bacteria 1967
124 Ga0265316_10000063 3300031344 Bacteria 113592
125 Ga0265316_10000710 3300031344 Bacteria 36726
126 Ga0265316_10004074 3300031344 Bacteria 14620
127 Ga0265313_10000005 3300031595 Bacteria 187978
128 Ga0265313_10018567 3300031595 Bacteria 3899
129 Ga0265313_10019600 3300031595 Bacteria 3759
130 Ga0316575_10045623 3300031665 Bacteria 1740
131 Ga0265314_10000190 3300031711 Bacteria 91400
132 Ga0265314_10002095 3300031711 Bacteria 20994
133 Ga0265314_10005310 3300031711 Bacteria 11656
134 Ga0265314_10011083 3300031711 Bacteria 7472
135 Ga0265314_10037963 3300031711 Bacteria 3484
136 Ga0265342_10000388 3300031712 Bacteria 48589
137 Ga0265342_10000991 3300031712 Bacteria 27985
138 Ga0265342_10003302 3300031712 Bacteria 13326
139 Ga0265342_10005702 3300031712 Bacteria 9413
140 Ga0265342_10006118 3300031712 Bacteria 9016
141 Ga0265342_10012854 3300031712 Bacteria 5651
142 Ga0316578_10191402 3300031728 Bacteria 1232
143 Ga0307405_10292410 3300031731 Bacteria 1232
144 Ga0316577_10146275 3300031733 Bacteria 1331
145 Ga0307412_10398714 3300031911 Bacteria 1119
146 Ga0307416_100432694 3300032002 Bacteria 1363
147 Ga0307411_10154287 3300032005 Bacteria 1711
148 Ga0307415_100124304 3300032126 Bacteria 1941
149 Ga0316593_10000048 3300032168 Bacteria 13632
150 Ga0316593_10001542 3300032168 Bacteria 5123
151 Ga0316593_10038426 3300032168 Bacteria 1585
152 Ga0316592_1000210 3300033524 Bacteria 7141
153 Ga0316587_1000070 3300033529 Bacteria 6890
154 Ga0316596_1000105 3300033541 Bacteria 10649
155 Ga0373956_0022876 3300035119 Bacteria 2678
156 Ga0373957_0016907 3300035120 Bacteria 2533
157 Ga0373957_0072549 3300035120 Bacteria 1348
158 Ga0373955_0004393 3300035172 Bacteria 6238
159 Ga0316574_0012916 3300035398 Bacteria 4789
160 Ga0316574_0068853 3300035398 Bacteria 2232
161 Ga0316574_0097523 3300035398 Bacteria 1879
162 Ga0316574_0238761 3300035398 Bacteria 1162
163 Ga0373931_0298278 3300035691 Bacteria 994
164 Ga0373933_0006410 3300035724 Bacteria 6404
165 Ga0373933_0042414 3300035724 Bacteria 2690
166 Ga0373937_0003896 3300036401 Bacteria 12623
167 Ga0316582_0049062 3300036647 Bacteria 2671
168 Ga0400483_243862 3300039062 Unclassified 1707
169 Ga0436365_0125853 3300039437 Bacteria 1159
170 Ga0451577_0017527 3300042876 Bacteria 6616
171 Ga0451577_0218368 3300042876 Bacteria 1723
172 Ga0451577_0446017 3300042876 Unclassified 1175
173 Ga0453684_0064988 3300044712 Unclassified 4656
174 Ga0453684_0069790 3300044712 Bacteria 4455
175 Ga0453684_0081866 3300044712 Unclassified 4024
176 Ga0453684_0097662 3300044712 Bacteria 3604
177 Ga0453684_0158378 3300044712 Bacteria 2681
178 Ga0451576_0000241 3300045051 Bacteria 133881
179 Ga0451576_0041412 3300045051 Bacteria 4870
180 Ga0466967_0109872 3300045976 Bacteria 2532
181 Ga0495686_0000017 3300047472 Bacteria 435554
182 Ga0496100_0199840 3300048903 Bacteria 1456
183 Ga0496102_0165151 3300048905 Bacteria 2083
184 Ga0496104_0009946 3300048907 Bacteria 8488
185 Ga0496105_0318763 3300048908 Bacteria 1246
186 Ga0496107_0173089 3300048910 Bacteria 1602
187 Ga0496109_0206017 3300048912 Bacteria 1849
188 Ga0496110_0138495 3300048913 Bacteria 2200
189 Ga0496113_0045634 3300048916 Bacteria 3251
190 Ga0496114_0008589 3300048917 Bacteria 8096
191 Ga0501070_0326353 3300049586 Bacteria 1248
192 Ga0501072_0113816 3300049588 Bacteria 2154
193 Ga0501080_0001179 3300049742 Bacteria 21661
194 Ga0501081_0068708 3300049743 Bacteria 2467
195 Ga0501083_0001201 3300049744 Bacteria 17527
196 Ga0501083_0053852 3300049744 Bacteria 2700
197 Ga0501083_0074627 3300049744 Bacteria 2253
198 Ga0501280_000952 3300049776 Bacteria 6051
199 nmdc:mga06r32_141496_c1 3300050510 Unclassified 2382
200 nmdc:mga08x19_153200_c1 3300050514 Bacteria 1562
201 Ga0501084_0000947 3300054114 Bacteria 22455
202 Ga0501084_0151686 3300054114 Bacteria 1953

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0022876 Ga0373956_0022876_476_1483 269
2 3300035120 Ga0373957_0016907 Ga0373957_0016907_22_1029 269
3 3300035172 Ga0373955_0004393 Ga0373955_0004393_4593_5600 269
4 3300035724 Ga0373933_0006410 Ga0373933_0006410_5241_6248 269
5 3300036401 Ga0373937_0003896 Ga0373937_0003896_8931_9938 269
6 3300026142 Ga0207698_10248584 Ga0207698_102485843 274
7 3300005535 Ga0070684_100270442 Ga0070684_1002704422 277
8 3300031239 Ga0265328_10041653 Ga0265328_100416532 281
9 3300031711 Ga0265314_10037963 Ga0265314_100379634 281
10 3300005336 Ga0070680_100052897 Ga0070680_1000528971 283
11 3300005530 Ga0070679_100049042 Ga0070679_1000490424 283
12 3300025917 Ga0207660_10012402 Ga0207660_100124026 283
13 3300025921 Ga0207652_10001606 Ga0207652_1000160612 283
14 3300035691 Ga0373931_0298278 Ga0373931_0298278_18_905 283
15 3300006028 Ga0070717_10184543 Ga0070717_101845432 289
16 3300042876 Ga0451577_0218368 Ga0451577_0218368_820_1692 289
17 3300049743 Ga0501081_0068708 Ga0501081_0068708_1268_2158 289
18 3300035120 Ga0373957_0072549 Ga0373957_0072549_191_1201 290
19 3300039437 Ga0436365_0125853 Ga0436365_0125853_104_1042 291
20 3300005444 Ga0070694_100013212 Ga0070694_1000132126 292
21 3300005445 Ga0070708_100087676 Ga0070708_1000876763 292
22 3300009177 Ga0105248_10608368 Ga0105248_106083682 292
23 3300048907 Ga0496104_0009946 Ga0496104_0009946_949_1860 292
24 3300048917 Ga0496114_0008589 Ga0496114_0008589_4860_5771 292
25 3300005467 Ga0070706_100014865 Ga0070706_1000148652 293
26 3300005468 Ga0070707_100062772 Ga0070707_1000627723 293
27 3300025910 Ga0207684_10043524 Ga0207684_100435244 293
28 3300031249 Ga0265339_10017148 Ga0265339_100171483 293
29 3300036647 Ga0316582_0049062 Ga0316582_0049062_644_1528 293
30 3300042876 Ga0451577_0017527 Ga0451577_0017527_1248_2135 293
31 3300044712 Ga0453684_0097662 Ga0453684_0097662_38_925 293
32 3300005468 Ga0070707_100402919 Ga0070707_1004029191 295
33 3300006844 Ga0075428_100125117 Ga0075428_1001251173 295
34 3300006880 Ga0075429_100055961 Ga0075429_1000559612 295
35 3300028800 Ga0265338_10011793 Ga0265338_100117935 295
36 3300031240 Ga0265320_10004773 Ga0265320_100047738 295
37 3300031712 Ga0265342_10003302 Ga0265342_1000330213 295
38 3300049588 Ga0501072_0113816 Ga0501072_0113816_891_1778 295
39 3300049744 Ga0501083_0001201 Ga0501083_0001201_13445_14332 295
40 3300049744 Ga0501083_0074627 Ga0501083_0074627_148_1035 295
41 3300054114 Ga0501084_0000947 Ga0501084_0000947_18476_19363 295
42 3300025922 Ga0207646_10523651 Ga0207646_105236511 296
43 3300032168 Ga0316593_10038426 Ga0316593_100384262 298
44 3300005334 Ga0068869_100048068 Ga0068869_1000480682 299
45 3300005339 Ga0070660_100070779 Ga0070660_1000707792 299
46 3300005347 Ga0070668_100046279 Ga0070668_1000462794 299
47 3300005444 Ga0070694_100460076 Ga0070694_1004600761 299
48 3300005455 Ga0070663_100072540 Ga0070663_1000725403 299
49 3300005457 Ga0070662_100014217 Ga0070662_1000142175 299
50 3300005539 Ga0068853_100147187 Ga0068853_1001471872 299
51 3300005614 Ga0068856_100106910 Ga0068856_1001069102 299
52 3300005615 Ga0070702_100068580 Ga0070702_1000685802 299
53 3300005618 Ga0068864_100038233 Ga0068864_1000382332 299
54 3300005719 Ga0068861_100084028 Ga0068861_1000840282 299
55 3300005834 Ga0068851_10048306 Ga0068851_100483063 299
56 3300005842 Ga0068858_100098205 Ga0068858_1000982053 299
57 3300005843 Ga0068860_100106533 Ga0068860_1001065332 299
58 3300009098 Ga0105245_10040754 Ga0105245_100407543 299
59 3300009177 Ga0105248_10070229 Ga0105248_100702293 299
60 3300009553 Ga0105249_10223866 Ga0105249_102238662 299
61 3300010375 Ga0105239_10170650 Ga0105239_101706502 299
62 3300013296 Ga0157374_10018941 Ga0157374_100189418 299
63 3300013306 Ga0163162_10009022 Ga0163162_1000902210 299
64 3300014745 Ga0157377_10001941 Ga0157377_100019412 299
65 3300014968 Ga0157379_10020458 Ga0157379_100204587 299
66 3300014969 Ga0157376_10165188 Ga0157376_101651882 299
67 3300025901 Ga0207688_10008683 Ga0207688_100086837 299
68 3300025907 Ga0207645_10042158 Ga0207645_100421582 299
69 3300025919 Ga0207657_10019063 Ga0207657_100190633 299
70 3300025923 Ga0207681_10036853 Ga0207681_100368533 299
71 3300025927 Ga0207687_10038947 Ga0207687_100389473 299
72 3300025933 Ga0207706_10006738 Ga0207706_1000673810 299
73 3300025941 Ga0207711_10022917 Ga0207711_100229172 299
74 3300025942 Ga0207689_10017464 Ga0207689_100174645 299
75 3300025944 Ga0207661_10245002 Ga0207661_102450022 299
76 3300026023 Ga0207677_10002663 Ga0207677_100026638 299
77 3300026067 Ga0207678_10072444 Ga0207678_100724443 299
78 3300026118 Ga0207675_100007218 Ga0207675_10000721810 299
79 3300026142 Ga0207698_10066211 Ga0207698_100662113 299
80 3300028381 Ga0268264_10268394 Ga0268264_102683942 299
81 3300031595 Ga0265313_10018567 Ga0265313_100185673 299
82 3300031712 Ga0265342_10012854 Ga0265342_100128543 299
83 3300048903 Ga0496100_0199840 Ga0496100_0199840_154_1092 299
84 3300048905 Ga0496102_0165151 Ga0496102_0165151_370_1308 299
85 3300048908 Ga0496105_0318763 Ga0496105_0318763_287_1225 299
86 3300048910 Ga0496107_0173089 Ga0496107_0173089_102_1040 299
87 3300048912 Ga0496109_0206017 Ga0496109_0206017_707_1645 299
88 3300048913 Ga0496110_0138495 Ga0496110_0138495_517_1455 299
89 3300048916 Ga0496113_0045634 Ga0496113_0045634_297_1235 299
90 3300005329 Ga0070683_100257849 Ga0070683_1002578492 300
91 3300005335 Ga0070666_10005463 Ga0070666_100054633 300
92 3300005843 Ga0068860_100013772 Ga0068860_1000137728 300
93 3300025903 Ga0207680_10004220 Ga0207680_100042207 300
94 3300028381 Ga0268264_10010520 Ga0268264_100105204 300
95 3300005340 Ga0070689_100000001 Ga0070689_100000001107 301
96 3300006846 Ga0075430_100073278 Ga0075430_1000732781 301
97 3300006847 Ga0075431_100160595 Ga0075431_1001605952 301
98 3300025936 Ga0207670_10000002 Ga0207670_1000000210 301
99 3300050510 nmdc:mga06r32_141496_c1 nmdc:mga06r32_141496_c1_136_1050 301
100 3300035724 Ga0373933_0042414 Ga0373933_0042414_1222_2178 302
101 3300045976 Ga0466967_0109872 Ga0466967_0109872_640_1593 303
102 3300005530 Ga0070679_100147790 Ga0070679_1001477902 304
103 3300005563 Ga0068855_100063669 Ga0068855_1000636693 304
104 3300005614 Ga0068856_100290076 Ga0068856_1002900762 304
105 3300025921 Ga0207652_10015287 Ga0207652_100152872 304
106 3300025949 Ga0207667_10024293 Ga0207667_100242933 304
107 3300026078 Ga0207702_10035071 Ga0207702_100350712 304
108 3300045051 Ga0451576_0000241 Ga0451576_0000241_52192_53109 304
109 3300005545 Ga0070695_100000306 Ga0070695_1000003064 305
110 3300045051 Ga0451576_0041412 Ga0451576_0041412_3862_4785 305
111 3300006844 Ga0075428_100025080 Ga0075428_1000250804 306
112 3300006880 Ga0075429_100017233 Ga0075429_1000172336 306
113 3300042876 Ga0451577_0446017 Ga0451577_0446017_196_1137 306
114 3300044712 Ga0453684_0069790 Ga0453684_0069790_2025_2966 306
115 3300044712 Ga0453684_0081866 Ga0453684_0081866_2468_3409 306
116 3300044712 Ga0453684_0158378 Ga0453684_0158378_31_972 306
117 3300009551 Ga0105238_10004323 Ga0105238_100043233 307
118 3300025924 Ga0207694_10015142 Ga0207694_100151426 307
119 3300031733 Ga0316577_10146275 Ga0316577_101462751 307
120 3300035398 Ga0316574_0097523 Ga0316574_0097523_170_1114 307
121 3300044712 Ga0453684_0064988 Ga0453684_0064988_2180_3127 307
122 3300005436 Ga0070713_100210317 Ga0070713_1002103172 308
123 3300005617 Ga0068859_100118109 Ga0068859_1001181094 308
124 3300006914 Ga0075436_100174715 Ga0075436_1001747151 308
125 3300006931 Ga0097620_100118115 Ga0097620_1001181152 308
126 3300013296 Ga0157374_10083555 Ga0157374_100835554 308
127 3300025258 Ga0209129_1000785 Ga0209129_100078518 308
128 3300025928 Ga0207700_10302030 Ga0207700_103020302 308
129 3300031235 Ga0265330_10032165 Ga0265330_100321652 308
130 3300031238 Ga0265332_10000623 Ga0265332_100006234 308
131 3300031239 Ga0265328_10004160 Ga0265328_100041602 308
132 3300031240 Ga0265320_10025559 Ga0265320_100255594 308
133 3300031241 Ga0265325_10122341 Ga0265325_101223412 308
134 3300031242 Ga0265329_10008171 Ga0265329_100081715 308
135 3300031242 Ga0265329_10015787 Ga0265329_100157873 308
136 3300031250 Ga0265331_10000095 Ga0265331_1000009543 308
137 3300031250 Ga0265331_10051662 Ga0265331_100516622 308
138 3300031344 Ga0265316_10000063 Ga0265316_1000006337 308
139 3300031711 Ga0265314_10002095 Ga0265314_100020954 308
140 3300031712 Ga0265342_10005702 Ga0265342_100057029 308
141 3300031731 Ga0307405_10292410 Ga0307405_102924102 308
142 3300031911 Ga0307412_10398714 Ga0307412_103987141 308
143 3300032002 Ga0307416_100432694 Ga0307416_1004326942 308
144 3300032005 Ga0307411_10154287 Ga0307411_101542872 308
145 3300032126 Ga0307415_100124304 Ga0307415_1001243042 308
146 3300039062 Ga0400483_243862 Ga0400483_243862_272_1216 308
147 3300049776 Ga0501280_000952 Ga0501280_000952_3739_4686 308
148 3300050514 nmdc:mga08x19_153200_c1 nmdc:mga08x19_153200_c1_69_1004 308
149 3300005327 Ga0070658_10004468 Ga0070658_100044687 309
150 3300005343 Ga0070687_100162018 Ga0070687_1001620181 309
151 3300005458 Ga0070681_10061405 Ga0070681_100614054 309
152 3300005563 Ga0068855_100077188 Ga0068855_1000771881 309
153 3300005577 Ga0068857_100110014 Ga0068857_1001100142 309
154 3300009093 Ga0105240_10009273 Ga0105240_100092737 309
155 3300009545 Ga0105237_10001922 Ga0105237_1000192223 309
156 3300013104 Ga0157370_10226772 Ga0157370_102267721 309
157 3300014497 Ga0182008_10001710 Ga0182008_100017104 309
158 3300025909 Ga0207705_10004655 Ga0207705_100046557 309
159 3300025913 Ga0207695_10002570 Ga0207695_1000257013 309
160 3300025914 Ga0207671_10000186 Ga0207671_1000018662 309
161 3300026116 Ga0207674_10092751 Ga0207674_100927513 309
162 3300028577 Ga0265318_10000008 Ga0265318_1000000861 309
163 3300028577 Ga0265318_10000061 Ga0265318_1000006173 309
164 3300031235 Ga0265330_10000038 Ga0265330_1000003840 309
165 3300031235 Ga0265330_10001137 Ga0265330_1000113712 309
166 3300031238 Ga0265332_10000191 Ga0265332_1000019124 309
167 3300031238 Ga0265332_10007253 Ga0265332_100072536 309
168 3300031238 Ga0265332_10043361 Ga0265332_100433612 309
169 3300031239 Ga0265328_10001541 Ga0265328_100015418 309
170 3300031239 Ga0265328_10002633 Ga0265328_100026337 309
171 3300031240 Ga0265320_10000066 Ga0265320_1000006661 309
172 3300031240 Ga0265320_10009198 Ga0265320_100091983 309
173 3300031240 Ga0265320_10028323 Ga0265320_100283233 309
174 3300031242 Ga0265329_10003138 Ga0265329_100031388 309
175 3300031250 Ga0265331_10000004 Ga0265331_1000000461 309
176 3300031250 Ga0265331_10002678 Ga0265331_100026787 309
177 3300031344 Ga0265316_10000710 Ga0265316_1000071013 309
178 3300031344 Ga0265316_10004074 Ga0265316_1000407413 309
179 3300031595 Ga0265313_10000005 Ga0265313_1000000595 309
180 3300031595 Ga0265313_10019600 Ga0265313_100196005 309
181 3300031665 Ga0316575_10045623 Ga0316575_100456232 309
182 3300031711 Ga0265314_10000190 Ga0265314_1000019015 309
183 3300031711 Ga0265314_10005310 Ga0265314_100053108 309
184 3300031711 Ga0265314_10011083 Ga0265314_100110833 309
185 3300031712 Ga0265342_10000388 Ga0265342_1000038827 309
186 3300031712 Ga0265342_10000991 Ga0265342_1000099122 309
187 3300031712 Ga0265342_10006118 Ga0265342_100061187 309
188 3300031728 Ga0316578_10191402 Ga0316578_101914021 309
189 3300032168 Ga0316593_10000048 Ga0316593_100000488 309
190 3300032168 Ga0316593_10001542 Ga0316593_100015425 309
191 3300033524 Ga0316592_1000210 Ga0316592_10002105 309
192 3300033529 Ga0316587_1000070 Ga0316587_10000705 309
193 3300033541 Ga0316596_1000105 Ga0316596_100010510 309
194 3300035398 Ga0316574_0012916 Ga0316574_0012916_1693_2658 309
195 3300035398 Ga0316574_0068853 Ga0316574_0068853_393_1358 309
196 3300035398 Ga0316574_0238761 Ga0316574_0238761_21_953 309
197 3300047472 Ga0495686_0000017 Ga0495686_0000017_18506_19516 309
198 iso_pu_bacteria 2919404418 2919404940 309
199 3300003320 rootH2_10038322 rootH2_1003832216 311
200 3300049586 Ga0501070_0326353 Ga0501070_0326353_293_1228 311
201 3300049742 Ga0501080_0001179 Ga0501080_0001179_6756_7691 311
202 3300049744 Ga0501083_0053852 Ga0501083_0053852_1164_2099 311
203 3300054114 Ga0501084_0151686 Ga0501084_0151686_600_1535 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

24

320

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9763 2 306
3ptw-assembly1.cif.gz_A crystal structure of malonyl coa-acyl carrier protein transacylase from clostridium perfringens atcc 13124 0.9725 1 310
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9714 1 306
3tqe-assembly1.cif.gz_A structure of the malonyl coa-acyl carrier protein transacylase (fabd) from coxiella burnetii 0.9708 1 308
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.97 2 306
ID Description Score Start End Superfamily
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9774 6 286 3.20.10.10
3ptwA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Malonyl-CoA ACP transacylase, ACP-binding 0.9756 128 196 3.30.70.250
3im8A01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9716 2 309 3.40.366.10
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9705 6 286 3.20.10.10
2cuyB01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9647 1 309 3.40.366.10
ID Description Score Start End GO Terms
AF-A0A1G1G4T3-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9851 1 310 GO:0004314
GO:0005829
GO:0006633
AF-A0A512IKK0-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9842 1 305 GO:0004314
GO:0005829
GO:0006633
AF-A0A832N1W0-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9835 1 233 GO:0004314
GO:0005829
GO:0006633
AF-A0A1I6GHK3-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9834 2 309 GO:0004314
GO:0005829
GO:0006633
AF-A0A355E4J5-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9834 1 310 GO:0004314
GO:0005829
GO:0006633

Feature Viewer

pLDDT pTM Quality
95.63 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map