F310074

General Info

Members Datasets Scaffolds Average Seq Length
202 167 165 174

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10053305|Ga0307406_100533052
Length 190
Sequence VTRAVLALGSNQGDRIGHLGQAVAQLGERVLLTSGVYETPPWGDTAQPAYLNGVVLVADAQAGPRGWLESAKACETAAGRVRDPARRYGPRTLDVDVIEVYEDDGTPVTSDDPELTLPHPRAHLRAFVLKPWLDIQPYARLTGHGWVTDLLNRPELAADVAAMTPRPDLAGLFSNSPRDAPPHDRMGKQA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
5 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
6 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
7 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
8 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
9 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
10 2855683550 Micromonospora sp. RP3T Isolate Unclassified
11 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
12 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
13 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
14 2858868258 Micromonospora sp. MH33 Isolate Unclassified
15 2858882152 Micromonospora noduli MED15 Isolate Nodule
16 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
17 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
18 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
19 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
20 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
21 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
22 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
23 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
24 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
25 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
26 2902582711 Micromonospora sp. AP08 Isolate Unclassified
27 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
28 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
29 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
30 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
158 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
159 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
160 649633069 Micromonospora sp. L5 Isolate Unclassified
161 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
162 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
163 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
164 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
165 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
166 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
167 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.69
Metatranscriptomes 0.99
Isolates 18.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 2.97
Rhizoplane 2.97
Rhizosphere 74.26
Stem 0
Stem Tuber 0
Unclassified 16.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10022056 3300003203 Bacteria 2546
2 Ga0070658_10098042 3300005327 Bacteria 2420
3 Ga0070676_10131648 3300005328 Bacteria 1582
4 Ga0070683_100060456 3300005329 Bacteria 3521
5 Ga0070683_100590716 3300005329 Bacteria 1062
6 Ga0070683_100930456 3300005329 Bacteria 834
7 Ga0070670_100920468 3300005331 Bacteria 793
8 Ga0068869_100028628 3300005334 Bacteria 3896
9 Ga0070680_100578683 3300005336 Bacteria 963
10 Ga0070682_100304344 3300005337 Bacteria 1171
11 Ga0068868_100006157 3300005338 Bacteria 8480
12 Ga0070660_100075111 3300005339 Bacteria 2646
13 Ga0070691_10146280 3300005341 Bacteria 1208
14 Ga0070661_100058051 3300005344 Bacteria 2836
15 Ga0070661_100193357 3300005344 Bacteria 1552
16 Ga0070692_10012329 3300005345 Bacteria 3953
17 Ga0070692_10196336 3300005345 Bacteria 1179
18 Ga0070668_100246864 3300005347 Bacteria 1480
19 Ga0070669_100102886 3300005353 Bacteria 2157
20 Ga0070675_100005072 3300005354 Bacteria 10050
21 Ga0070674_100386161 3300005356 Bacteria 1140
22 Ga0070659_100029279 3300005366 Bacteria 4255
23 Ga0070659_100146868 3300005366 Bacteria 1922
24 Ga0070714_100036112 3300005435 Bacteria 4144
25 Ga0070713_100181259 3300005436 Bacteria 1893
26 Ga0070700_100006119 3300005441 Bacteria 6411
27 Ga0070662_100004703 3300005457 Bacteria 8655
28 Ga0070681_10805674 3300005458 Bacteria 856
29 Ga0070681_11093012 3300005458 Bacteria 718
30 Ga0070681_11270343 3300005458 Bacteria 659
31 Ga0070684_100129788 3300005535 Bacteria 2273
32 Ga0068853_100421701 3300005539 Bacteria 1251
33 Ga0068855_100166686 3300005563 Bacteria 2497
34 Ga0070664_100005469 3300005564 Bacteria 10198
35 Ga0068857_100009332 3300005577 Bacteria 8518
36 Ga0068857_100156261 3300005577 Bacteria 2068
37 Ga0068854_100051310 3300005578 Bacteria 2955
38 Ga0070702_100175890 3300005615 Bacteria 1396
39 Ga0068864_100047956 3300005618 Bacteria 3671
40 Ga0068851_10165494 3300005834 Bacteria 1217
41 Ga0068870_10170266 3300005840 Bacteria 1299
42 Ga0068860_100993586 3300005843 Bacteria 857
43 Ga0068862_100004778 3300005844 Bacteria 11401
44 Ga0081540_1003277 3300005983 Bacteria 12873
45 Ga0081539_10001096 3300005985 Bacteria 49234
46 Ga0081539_10002399 3300005985 Bacteria 26618
47 Ga0075364_10168260 3300006051 Bacteria 1481
48 Ga0070716_100138189 3300006173 Bacteria 1550
49 Ga0075428_100043471 3300006844 Bacteria 4939
50 Ga0075428_100202608 3300006844 Bacteria 2145
51 Ga0075428_100350744 3300006844 Bacteria 1584
52 Ga0075430_100013811 3300006846 Bacteria 6881
53 Ga0075430_100024206 3300006846 Bacteria 5169
54 Ga0075430_100207927 3300006846 Bacteria 1624
55 Ga0075431_100014810 3300006847 Bacteria 7896
56 Ga0075429_100008000 3300006880 Bacteria 9183
57 Ga0075429_100511491 3300006880 Bacteria 1052
58 Ga0075429_100716815 3300006880 Bacteria 876
59 Ga0068865_100453997 3300006881 Bacteria 1060
60 Ga0111539_10006000 3300009094 Bacteria 15698
61 Ga0105245_10007824 3300009098 Bacteria 9361
62 Ga0114129_10006270 3300009147 Bacteria 16853
63 Ga0114129_10026755 3300009147 Bacteria 8170
64 Ga0114129_10376625 3300009147 Bacteria 1875
65 Ga0105243_10074322 3300009148 Bacteria 2756
66 Ga0105238_10280846 3300009551 Bacteria 1646
67 Ga0105246_10034412 3300011119 Bacteria 3376
68 Ga0157370_10104066 3300013104 Bacteria 2657
69 Ga0157369_10007088 3300013105 Bacteria 12930
70 Ga0157375_10409876 3300013308 Bacteria 1521
71 Ga0163163_10657535 3300014325 Bacteria 1111
72 Ga0157380_10095656 3300014326 Bacteria 2461
73 Ga0157377_10003776 3300014745 Bacteria 6874
74 Ga0206356_10911448 3300020070 Bacteria 1152
75 Ga0206353_10365643 3300020082 Bacteria 3817
76 Ga0207645_10118714 3300025907 Bacteria 1716
77 Ga0207643_10465747 3300025908 Bacteria 805
78 Ga0207705_10039043 3300025909 Bacteria 3402
79 Ga0207707_10867533 3300025912 Bacteria 748
80 Ga0207660_10405015 3300025917 Bacteria 1099
81 Ga0207649_10046688 3300025920 Bacteria 2662
82 Ga0207652_10101217 3300025921 Bacteria 2545
83 Ga0207652_10558094 3300025921 Bacteria 1029
84 Ga0207694_10299206 3300025924 Bacteria 1324
85 Ga0207650_10070717 3300025925 Bacteria 2623
86 Ga0207659_10001499 3300025926 Bacteria 13914
87 Ga0207687_10005160 3300025927 Bacteria 8658
88 Ga0207690_10013222 3300025932 Bacteria 4956
89 Ga0207690_10096245 3300025932 Bacteria 2104
90 Ga0207706_10018150 3300025933 Bacteria 6330
91 Ga0207709_10051355 3300025935 Bacteria 2527
92 Ga0207669_10333523 3300025937 Bacteria 1165
93 Ga0207704_10103456 3300025938 Bacteria 1905
94 Ga0207665_10112001 3300025939 Bacteria 1918
95 Ga0207689_10039082 3300025942 Bacteria 3929
96 Ga0207661_10131732 3300025944 Bacteria 2142
97 Ga0207679_10007111 3300025945 Bacteria 7091
98 Ga0207679_10376274 3300025945 Bacteria 1244
99 Ga0207668_10242906 3300025972 Bacteria 1458
100 Ga0207703_10197055 3300026035 Bacteria 1788
101 Ga0207639_10487373 3300026041 Bacteria 1124
102 Ga0207708_10017528 3300026075 Bacteria 5391
103 Ga0207674_10004679 3300026116 Bacteria 16430
104 Ga0207674_10004698 3300026116 Bacteria 16383
105 Ga0207674_10173841 3300026116 Bacteria 2107
106 Ga0207698_11803718 3300026142 Bacteria 627
107 Ga0207428_10021848 3300027907 Bacteria 5412
108 Ga0268266_10663835 3300028379 Bacteria 1004
109 Ga0268265_10017246 3300028380 Bacteria 4980
110 Ga0307515_10016311 3300028794 Bacteria 13608
111 Ga0307515_10045121 3300028794 Bacteria 6782
112 Ga0307512_10031342 3300030522 Bacteria 4605
113 Ga0307513_10083038 3300031456 Bacteria 3296
114 Ga0307509_10648687 3300031507 Bacteria 725
115 Ga0307508_10001708 3300031616 Bacteria 24364
116 Ga0307516_10543067 3300031730 Bacteria 816
117 Ga0307413_10489708 3300031824 Bacteria 985
118 Ga0307406_10053305 3300031901 Bacteria 2576
119 Ga0307406_10065986 3300031901 Bacteria 2354
120 Ga0307406_10129718 3300031901 Bacteria 1768
121 Ga0307407_10022901 3300031903 Bacteria 3250
122 Ga0307409_100022140 3300031995 Bacteria 4375
123 Ga0307409_101099196 3300031995 Bacteria 816
124 Ga0307416_100500409 3300032002 Bacteria 1279
125 Ga0307416_100685407 3300032002 Bacteria 1113
126 Ga0307415_100018112 3300032126 Bacteria 4243
127 Ga0307415_100028685 3300032126 Bacteria 3545
128 Ga0307415_100230039 3300032126 Bacteria 1492
129 Ga0451853_0626431 3300041512 Bacteria 3465
130 Ga0466957_0034024 3300044842 Bacteria 3057
131 Ga0495594_0066640 3300046499 Bacteria 1998
132 Ga0496104_0563342 3300048907 Bacteria 1050
133 Ga0496108_0871554 3300048911 Bacteria 774
134 Ga0496109_0084062 3300048912 Bacteria 2936
135 Ga0496110_0598459 3300048913 Bacteria 1000
136 Ga0496112_0229164 3300048915 Bacteria 1812
137 Ga0496113_0281198 3300048916 Bacteria 1331
138 Ga0496126_0195702 3300048929 Bacteria 1709
139 Ga0501032_0027712 3300049569 Bacteria 3894
140 Ga0501036_0492828 3300049572 Bacteria 1020
141 Ga0501039_0151546 3300049575 Bacteria 1821
142 Ga0501047_0540542 3300049581 Bacteria 990
143 Ga0501068_0140660 3300049584 Bacteria 1513
144 Ga0501072_1587841 3300049588 Bacteria 504
145 Ga0501080_0043715 3300049742 Bacteria 4172
146 Ga0501035_0249508 3300049822 Bacteria 1508
147 Ga0501044_0503997 3300049823 Bacteria 1111
148 Ga0501045_0572889 3300049824 Bacteria 837
149 nmdc:mga03n38_269953_c1 3300050490 Bacteria 904
150 nmdc:mga00v17_153457_c1 3300050491 Bacteria 1480
151 nmdc:mga05p37_119180_c1 3300050507 Bacteria 3243
152 nmdc:mga05p37_15882_c1 3300050507 Bacteria 9057
153 nmdc:mga09592_288754_c1 3300050508 Bacteria 1422
154 nmdc:mga09592_326738_c1 3300050508 Bacteria 1328
155 nmdc:mga09592_34888_c1 3300050508 Bacteria 4208
156 nmdc:mga09592_562445_c1 3300050508 Bacteria 979
157 nmdc:mga0qj67_1282_c1 3300050509 Bacteria 17594
158 nmdc:mga0qj67_3969_c1 3300050509 Bacteria 10704
159 nmdc:mga06r32_11768_c1 3300050510 Bacteria 7879
160 nmdc:mga06r32_473871_c1 3300050510 Bacteria 1230
161 nmdc:mga08y16_2655_c1 3300050511 Bacteria 18385
162 Ga0500646_0000149 3300053090 Bacteria 20548
163 Ga0500583_0004365 3300053092 Bacteria 4599
164 Ga0500588_0014463 3300053146 Bacteria 2000
165 Ga0500633_0178556 3300053160 Bacteria 796

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_1587841 Ga0501072_1587841_15_464 149
2 3300050508 nmdc:mga09592_562445_c1 nmdc:mga09592_562445_c1_488_961 156
3 3300032126 Ga0307415_100018112 Ga0307415_1000181123 160
4 3300005458 Ga0070681_11270343 Ga0070681_112703431 163
5 3300025912 Ga0207707_10867533 Ga0207707_108675331 163
6 3300025921 Ga0207652_10558094 Ga0207652_105580941 163
7 3300049569 Ga0501032_0027712 Ga0501032_0027712_1262_1756 164
8 3300049575 Ga0501039_0151546 Ga0501039_0151546_59_553 164
9 3300049581 Ga0501047_0540542 Ga0501047_0540542_59_553 164
10 3300049742 Ga0501080_0043715 Ga0501080_0043715_1995_2489 164
11 3300049824 Ga0501045_0572889 Ga0501045_0572889_316_810 164
12 3300049572 Ga0501036_0492828 Ga0501036_0492828_445_951 165
13 3300049823 Ga0501044_0503997 Ga0501044_0503997_390_896 165
14 3300049822 Ga0501035_0249508 Ga0501035_0249508_676_1185 169
15 iso_pu_bacteria 2501939600 2501941177 170
16 iso_pu_bacteria 2622736626 2623585431 170
17 iso_pu_bacteria 2831935698 2831939807 170
18 iso_pu_bacteria 2832004796 2832005825 170
19 iso_pu_bacteria 2855670206 2855672401 170
20 iso_pu_bacteria 2855676851 2855677230 170
21 iso_pu_bacteria 2855683550 2855686226 170
22 iso_pu_bacteria 2856858025 2856859346 170
23 iso_pu_bacteria 2857288857 2857291433 170
24 iso_pu_bacteria 2858848962 2858850264 170
25 iso_pu_bacteria 2858868258 2858871391 170
26 iso_pu_bacteria 2858882152 2858884714 170
27 iso_pu_bacteria 2858888857 2858893333 170
28 iso_pu_bacteria 2858895516 2858900383 170
29 iso_pu_bacteria 2858902515 2858902594 170
30 iso_pu_bacteria 2866065130 2866066352 170
31 iso_pu_bacteria 2867302475 2867306315 170
32 iso_pu_bacteria 2867319477 2867322946 170
33 iso_pu_bacteria 2867507094 2867510544 170
34 iso_pu_bacteria 2869048445 2869050677 170
35 iso_pu_bacteria 2869061728 2869063230 170
36 iso_pu_bacteria 2869068681 2869074862 170
37 iso_pu_bacteria 2902582711 2902584348 170
38 iso_pu_bacteria 2929219909 2929226092 170
39 iso_pu_bacteria 2929226422 2929232753 170
40 iso_pu_bacteria 2996221748 2996228158 170
41 iso_pu_bacteria 649633069 649812789 170
42 iso_pu_bacteria 8003830390 8003836062 170
43 iso_pu_bacteria 8003856774 8003858550 170
44 iso_pu_bacteria 8003870546 8003877886 170
45 iso_pu_bacteria 8054704163 8054710675 170
46 iso_pu_bacteria 8054727385 8054732377 170
47 iso_pu_bacteria 8054734606 8054739340 170
48 iso_pu_bacteria 8055412473 8055414968 170
49 3300006846 Ga0075430_100024206 Ga0075430_1000242066 171
50 3300009147 Ga0114129_10376625 Ga0114129_103766252 171
51 3300050509 nmdc:mga0qj67_1282_c1 nmdc:mga0qj67_1282_c1_9599_10114 171
52 3300050510 nmdc:mga06r32_473871_c1 nmdc:mga06r32_473871_c1_15_530 171
53 3300005328 Ga0070676_10131648 Ga0070676_101316482 172
54 3300005329 Ga0070683_100590716 Ga0070683_1005907162 172
55 3300005329 Ga0070683_100930456 Ga0070683_1009304562 172
56 3300005331 Ga0070670_100920468 Ga0070670_1009204682 172
57 3300005334 Ga0068869_100028628 Ga0068869_1000286284 172
58 3300005336 Ga0070680_100578683 Ga0070680_1005786831 172
59 3300005337 Ga0070682_100304344 Ga0070682_1003043442 172
60 3300005338 Ga0068868_100006157 Ga0068868_1000061573 172
61 3300005341 Ga0070691_10146280 Ga0070691_101462801 172
62 3300005344 Ga0070661_100058051 Ga0070661_1000580514 172
63 3300005345 Ga0070692_10012329 Ga0070692_100123293 172
64 3300005347 Ga0070668_100246864 Ga0070668_1002468642 172
65 3300005353 Ga0070669_100102886 Ga0070669_1001028862 172
66 3300005354 Ga0070675_100005072 Ga0070675_1000050727 172
67 3300005356 Ga0070674_100386161 Ga0070674_1003861612 172
68 3300005366 Ga0070659_100029279 Ga0070659_1000292795 172
69 3300005441 Ga0070700_100006119 Ga0070700_1000061193 172
70 3300005457 Ga0070662_100004703 Ga0070662_1000047036 172
71 3300005535 Ga0070684_100129788 Ga0070684_1001297883 172
72 3300005539 Ga0068853_100421701 Ga0068853_1004217012 172
73 3300005564 Ga0070664_100005469 Ga0070664_1000054697 172
74 3300005577 Ga0068857_100009332 Ga0068857_1000093326 172
75 3300005578 Ga0068854_100051310 Ga0068854_1000513103 172
76 3300005615 Ga0070702_100175890 Ga0070702_1001758901 172
77 3300005618 Ga0068864_100047956 Ga0068864_1000479565 172
78 3300005834 Ga0068851_10165494 Ga0068851_101654943 172
79 3300005840 Ga0068870_10170266 Ga0068870_101702662 172
80 3300005843 Ga0068860_100993586 Ga0068860_1009935862 172
81 3300005844 Ga0068862_100004778 Ga0068862_10000477810 172
82 3300006844 Ga0075428_100202608 Ga0075428_1002026082 172
83 3300006844 Ga0075428_100350744 Ga0075428_1003507441 172
84 3300006846 Ga0075430_100207927 Ga0075430_1002079271 172
85 3300006880 Ga0075429_100511491 Ga0075429_1005114912 172
86 3300006881 Ga0068865_100453997 Ga0068865_1004539972 172
87 3300009094 Ga0111539_10006000 Ga0111539_1000600010 172
88 3300009098 Ga0105245_10007824 Ga0105245_100078247 172
89 3300009148 Ga0105243_10074322 Ga0105243_100743225 172
90 3300009551 Ga0105238_10280846 Ga0105238_102808462 172
91 3300011119 Ga0105246_10034412 Ga0105246_100344123 172
92 3300013308 Ga0157375_10409876 Ga0157375_104098762 172
93 3300014326 Ga0157380_10095656 Ga0157380_100956563 172
94 3300014745 Ga0157377_10003776 Ga0157377_100037769 172
95 3300025907 Ga0207645_10118714 Ga0207645_101187142 172
96 3300025908 Ga0207643_10465747 Ga0207643_104657471 172
97 3300025917 Ga0207660_10405015 Ga0207660_104050152 172
98 3300025920 Ga0207649_10046688 Ga0207649_100466885 172
99 3300025924 Ga0207694_10299206 Ga0207694_102992062 172
100 3300025925 Ga0207650_10070717 Ga0207650_100707173 172
101 3300025926 Ga0207659_10001499 Ga0207659_100014996 172
102 3300025927 Ga0207687_10005160 Ga0207687_100051606 172
103 3300025932 Ga0207690_10096245 Ga0207690_100962453 172
104 3300025933 Ga0207706_10018150 Ga0207706_100181505 172
105 3300025935 Ga0207709_10051355 Ga0207709_100513553 172
106 3300025937 Ga0207669_10333523 Ga0207669_103335232 172
107 3300025938 Ga0207704_10103456 Ga0207704_101034563 172
108 3300025942 Ga0207689_10039082 Ga0207689_100390824 172
109 3300025944 Ga0207661_10131732 Ga0207661_101317323 172
110 3300025945 Ga0207679_10007111 Ga0207679_100071116 172
111 3300025945 Ga0207679_10376274 Ga0207679_103762742 172
112 3300025972 Ga0207668_10242906 Ga0207668_102429062 172
113 3300026035 Ga0207703_10197055 Ga0207703_101970553 172
114 3300026041 Ga0207639_10487373 Ga0207639_104873732 172
115 3300026075 Ga0207708_10017528 Ga0207708_100175283 172
116 3300026116 Ga0207674_10004679 Ga0207674_100046797 172
117 3300026142 Ga0207698_11803718 Ga0207698_118037182 172
118 3300027907 Ga0207428_10021848 Ga0207428_100218486 172
119 3300028380 Ga0268265_10017246 Ga0268265_100172465 172
120 3300050508 nmdc:mga09592_326738_c1 nmdc:mga09592_326738_c1_474_995 172
121 3300050511 nmdc:mga08y16_2655_c1 nmdc:mga08y16_2655_c1_5792_6313 172
122 3300006844 Ga0075428_100043471 Ga0075428_1000434716 173
123 3300006846 Ga0075430_100013811 Ga0075430_1000138114 173
124 3300006847 Ga0075431_100014810 Ga0075431_1000148106 173
125 3300006880 Ga0075429_100008000 Ga0075429_1000080007 173
126 3300009147 Ga0114129_10026755 Ga0114129_100267556 173
127 3300031824 Ga0307413_10489708 Ga0307413_104897082 173
128 3300031901 Ga0307406_10129718 Ga0307406_101297183 173
129 3300032126 Ga0307415_100028685 Ga0307415_1000286853 173
130 3300044842 Ga0466957_0034024 Ga0466957_0034024_1550_2071 173
131 3300046499 Ga0495594_0066640 Ga0495594_0066640_503_1024 173
132 3300050490 nmdc:mga03n38_269953_c1 nmdc:mga03n38_269953_c1_159_698 173
133 3300050507 nmdc:mga05p37_119180_c1 nmdc:mga05p37_119180_c1_233_763 173
134 3300050508 nmdc:mga09592_34888_c1 nmdc:mga09592_34888_c1_2324_2854 173
135 3300050509 nmdc:mga0qj67_3969_c1 nmdc:mga0qj67_3969_c1_1026_1556 173
136 3300050510 nmdc:mga06r32_11768_c1 nmdc:mga06r32_11768_c1_2480_3010 173
137 3300053090 Ga0500646_0000149 Ga0500646_0000149_3939_4484 173
138 3300053092 Ga0500583_0004365 Ga0500583_0004365_123_668 173
139 3300053146 Ga0500588_0014463 Ga0500588_0014463_787_1332 173
140 3300053160 Ga0500633_0178556 Ga0500633_0178556_29_574 173
141 3300003203 JGI25406J46586_10022056 JGI25406J46586_100220563 174
142 3300005327 Ga0070658_10098042 Ga0070658_100980421 174
143 3300005329 Ga0070683_100060456 Ga0070683_1000604561 174
144 3300005339 Ga0070660_100075111 Ga0070660_1000751113 174
145 3300005344 Ga0070661_100193357 Ga0070661_1001933573 174
146 3300005345 Ga0070692_10196336 Ga0070692_101963362 174
147 3300005366 Ga0070659_100146868 Ga0070659_1001468682 174
148 3300005435 Ga0070714_100036112 Ga0070714_1000361125 174
149 3300005436 Ga0070713_100181259 Ga0070713_1001812591 174
150 3300005458 Ga0070681_10805674 Ga0070681_108056741 174
151 3300005458 Ga0070681_11093012 Ga0070681_110930121 174
152 3300005563 Ga0068855_100166686 Ga0068855_1001666862 174
153 3300005577 Ga0068857_100156261 Ga0068857_1001562613 174
154 3300005983 Ga0081540_1003277 Ga0081540_100327712 174
155 3300005985 Ga0081539_10001096 Ga0081539_1000109629 174
156 3300005985 Ga0081539_10002399 Ga0081539_100023999 174
157 3300006051 Ga0075364_10168260 Ga0075364_101682601 174
158 3300006173 Ga0070716_100138189 Ga0070716_1001381893 174
159 3300006880 Ga0075429_100716815 Ga0075429_1007168152 174
160 3300009147 Ga0114129_10006270 Ga0114129_100062705 174
161 3300013104 Ga0157370_10104066 Ga0157370_101040662 174
162 3300013105 Ga0157369_10007088 Ga0157369_1000708814 174
163 3300014325 Ga0163163_10657535 Ga0163163_106575352 174
164 3300020070 Ga0206356_10911448 Ga0206356_109114482 174
165 3300020082 Ga0206353_10365643 Ga0206353_103656434 174
166 3300025909 Ga0207705_10039043 Ga0207705_100390433 174
167 3300025921 Ga0207652_10101217 Ga0207652_101012173 174
168 3300025932 Ga0207690_10013222 Ga0207690_100132225 174
169 3300025939 Ga0207665_10112001 Ga0207665_101120013 174
170 3300026116 Ga0207674_10004698 Ga0207674_1000469810 174
171 3300026116 Ga0207674_10173841 Ga0207674_101738413 174
172 3300028379 Ga0268266_10663835 Ga0268266_106638351 174
173 3300028794 Ga0307515_10016311 Ga0307515_1001631114 174
174 3300028794 Ga0307515_10045121 Ga0307515_100451213 174
175 3300030522 Ga0307512_10031342 Ga0307512_100313425 174
176 3300031456 Ga0307513_10083038 Ga0307513_100830383 174
177 3300031507 Ga0307509_10648687 Ga0307509_106486871 174
178 3300031616 Ga0307508_10001708 Ga0307508_100017086 174
179 3300031730 Ga0307516_10543067 Ga0307516_105430672 174
180 3300031901 Ga0307406_10053305 Ga0307406_100533052 174
181 3300031901 Ga0307406_10065986 Ga0307406_100659863 174
182 3300031903 Ga0307407_10022901 Ga0307407_100229015 174
183 3300031995 Ga0307409_100022140 Ga0307409_1000221404 174
184 3300031995 Ga0307409_101099196 Ga0307409_1010991962 174
185 3300032002 Ga0307416_100500409 Ga0307416_1005004092 174
186 3300032002 Ga0307416_100685407 Ga0307416_1006854072 174
187 3300032126 Ga0307415_100230039 Ga0307415_1002300392 174
188 3300041512 Ga0451853_0626431 Ga0451853_0626431_92_658 174
189 3300048907 Ga0496104_0563342 Ga0496104_0563342_121_654 174
190 3300048911 Ga0496108_0871554 Ga0496108_0871554_26_559 174
191 3300048912 Ga0496109_0084062 Ga0496109_0084062_559_1092 174
192 3300048913 Ga0496110_0598459 Ga0496110_0598459_121_654 174
193 3300048915 Ga0496112_0229164 Ga0496112_0229164_1020_1553 174
194 3300048916 Ga0496113_0281198 Ga0496113_0281198_441_974 174
195 3300048929 Ga0496126_0195702 Ga0496126_0195702_702_1226 174
196 3300049584 Ga0501068_0140660 Ga0501068_0140660_845_1372 174
197 3300050491 nmdc:mga00v17_153457_c1 nmdc:mga00v17_153457_c1_933_1460 174
198 3300050507 nmdc:mga05p37_15882_c1 nmdc:mga05p37_15882_c1_5581_6108 174
199 3300050508 nmdc:mga09592_288754_c1 nmdc:mga09592_288754_c1_420_944 174
200 iso_pu_bacteria 2515154088 2515497698 174
201 iso_pu_bacteria 2515154137 2515757810 174
202 iso_pu_bacteria 2515154203 2516091618 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

5

137

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m5j-assembly1.cif.gz_A the identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase 0.9174 1 154
1cbk-assembly1.cif.gz_B 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase from haemophilus influenzae 0.9106 1 152
5etl-assembly3.cif.gz_C e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution 0.9098 2 154
5etl-assembly2.cif.gz_B e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution 0.9057 2 154
5etl-assembly1.cif.gz_A e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution 0.9043 2 154
ID Description Score Start End Superfamily
af_P9WNC7_1_182_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8972 1 173 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.896 2 153 3.30.70.560
af_P9WNC7_1_182_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8874 1 173 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8792 2 153 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.8771 1 152 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A6F8Y2Z1-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9916 1 120 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A6N9XZT4-F1-model_v4 deleted 0.9826 1 75
AF-W7VLJ6-F1-model_v4 deleted 0.9812 2 174
AF-W7VLJ6-F1-model_v4 deleted 0.9702 2 174
AF-A0A7G6X1I4-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9699 1 165 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Feature Viewer

pLDDT pTM Quality
93.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map