F310074
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 202 | 167 | 165 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10053305|Ga0307406_100533052 |
| Length | 190 |
| Sequence | VTRAVLALGSNQGDRIGHLGQAVAQLGERVLLTSGVYETPPWGDTAQPAYLNGVVLVADAQAGPRGWLESAKACETAAGRVRDPARRYGPRTLDVDVIEVYEDDGTPVTSDDPELTLPHPRAHLRAFVLKPWLDIQPYARLTGHGWVTDLLNRPELAADVAAMTPRPDLAGLFSNSPRDAPPHDRMGKQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 5 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 6 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 7 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 8 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 9 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 10 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 11 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 12 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 13 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 14 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 15 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 16 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 17 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 18 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 19 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 20 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 21 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 22 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 23 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 24 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 25 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 26 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 27 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 28 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 29 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 30 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 119 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 120 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 121 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 122 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 138 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 139 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 150 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 151 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 157 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 158 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 159 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 160 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 161 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 162 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 163 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 164 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 165 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 166 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 167 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.69 |
| Metatranscriptomes | 0.99 |
| Isolates | 18.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.47 |
| Nodule | 2.97 |
| Rhizoplane | 2.97 |
| Rhizosphere | 74.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10022056 | 3300003203 | Bacteria | 2546 |
| 2 | Ga0070658_10098042 | 3300005327 | Bacteria | 2420 |
| 3 | Ga0070676_10131648 | 3300005328 | Bacteria | 1582 |
| 4 | Ga0070683_100060456 | 3300005329 | Bacteria | 3521 |
| 5 | Ga0070683_100590716 | 3300005329 | Bacteria | 1062 |
| 6 | Ga0070683_100930456 | 3300005329 | Bacteria | 834 |
| 7 | Ga0070670_100920468 | 3300005331 | Bacteria | 793 |
| 8 | Ga0068869_100028628 | 3300005334 | Bacteria | 3896 |
| 9 | Ga0070680_100578683 | 3300005336 | Bacteria | 963 |
| 10 | Ga0070682_100304344 | 3300005337 | Bacteria | 1171 |
| 11 | Ga0068868_100006157 | 3300005338 | Bacteria | 8480 |
| 12 | Ga0070660_100075111 | 3300005339 | Bacteria | 2646 |
| 13 | Ga0070691_10146280 | 3300005341 | Bacteria | 1208 |
| 14 | Ga0070661_100058051 | 3300005344 | Bacteria | 2836 |
| 15 | Ga0070661_100193357 | 3300005344 | Bacteria | 1552 |
| 16 | Ga0070692_10012329 | 3300005345 | Bacteria | 3953 |
| 17 | Ga0070692_10196336 | 3300005345 | Bacteria | 1179 |
| 18 | Ga0070668_100246864 | 3300005347 | Bacteria | 1480 |
| 19 | Ga0070669_100102886 | 3300005353 | Bacteria | 2157 |
| 20 | Ga0070675_100005072 | 3300005354 | Bacteria | 10050 |
| 21 | Ga0070674_100386161 | 3300005356 | Bacteria | 1140 |
| 22 | Ga0070659_100029279 | 3300005366 | Bacteria | 4255 |
| 23 | Ga0070659_100146868 | 3300005366 | Bacteria | 1922 |
| 24 | Ga0070714_100036112 | 3300005435 | Bacteria | 4144 |
| 25 | Ga0070713_100181259 | 3300005436 | Bacteria | 1893 |
| 26 | Ga0070700_100006119 | 3300005441 | Bacteria | 6411 |
| 27 | Ga0070662_100004703 | 3300005457 | Bacteria | 8655 |
| 28 | Ga0070681_10805674 | 3300005458 | Bacteria | 856 |
| 29 | Ga0070681_11093012 | 3300005458 | Bacteria | 718 |
| 30 | Ga0070681_11270343 | 3300005458 | Bacteria | 659 |
| 31 | Ga0070684_100129788 | 3300005535 | Bacteria | 2273 |
| 32 | Ga0068853_100421701 | 3300005539 | Bacteria | 1251 |
| 33 | Ga0068855_100166686 | 3300005563 | Bacteria | 2497 |
| 34 | Ga0070664_100005469 | 3300005564 | Bacteria | 10198 |
| 35 | Ga0068857_100009332 | 3300005577 | Bacteria | 8518 |
| 36 | Ga0068857_100156261 | 3300005577 | Bacteria | 2068 |
| 37 | Ga0068854_100051310 | 3300005578 | Bacteria | 2955 |
| 38 | Ga0070702_100175890 | 3300005615 | Bacteria | 1396 |
| 39 | Ga0068864_100047956 | 3300005618 | Bacteria | 3671 |
| 40 | Ga0068851_10165494 | 3300005834 | Bacteria | 1217 |
| 41 | Ga0068870_10170266 | 3300005840 | Bacteria | 1299 |
| 42 | Ga0068860_100993586 | 3300005843 | Bacteria | 857 |
| 43 | Ga0068862_100004778 | 3300005844 | Bacteria | 11401 |
| 44 | Ga0081540_1003277 | 3300005983 | Bacteria | 12873 |
| 45 | Ga0081539_10001096 | 3300005985 | Bacteria | 49234 |
| 46 | Ga0081539_10002399 | 3300005985 | Bacteria | 26618 |
| 47 | Ga0075364_10168260 | 3300006051 | Bacteria | 1481 |
| 48 | Ga0070716_100138189 | 3300006173 | Bacteria | 1550 |
| 49 | Ga0075428_100043471 | 3300006844 | Bacteria | 4939 |
| 50 | Ga0075428_100202608 | 3300006844 | Bacteria | 2145 |
| 51 | Ga0075428_100350744 | 3300006844 | Bacteria | 1584 |
| 52 | Ga0075430_100013811 | 3300006846 | Bacteria | 6881 |
| 53 | Ga0075430_100024206 | 3300006846 | Bacteria | 5169 |
| 54 | Ga0075430_100207927 | 3300006846 | Bacteria | 1624 |
| 55 | Ga0075431_100014810 | 3300006847 | Bacteria | 7896 |
| 56 | Ga0075429_100008000 | 3300006880 | Bacteria | 9183 |
| 57 | Ga0075429_100511491 | 3300006880 | Bacteria | 1052 |
| 58 | Ga0075429_100716815 | 3300006880 | Bacteria | 876 |
| 59 | Ga0068865_100453997 | 3300006881 | Bacteria | 1060 |
| 60 | Ga0111539_10006000 | 3300009094 | Bacteria | 15698 |
| 61 | Ga0105245_10007824 | 3300009098 | Bacteria | 9361 |
| 62 | Ga0114129_10006270 | 3300009147 | Bacteria | 16853 |
| 63 | Ga0114129_10026755 | 3300009147 | Bacteria | 8170 |
| 64 | Ga0114129_10376625 | 3300009147 | Bacteria | 1875 |
| 65 | Ga0105243_10074322 | 3300009148 | Bacteria | 2756 |
| 66 | Ga0105238_10280846 | 3300009551 | Bacteria | 1646 |
| 67 | Ga0105246_10034412 | 3300011119 | Bacteria | 3376 |
| 68 | Ga0157370_10104066 | 3300013104 | Bacteria | 2657 |
| 69 | Ga0157369_10007088 | 3300013105 | Bacteria | 12930 |
| 70 | Ga0157375_10409876 | 3300013308 | Bacteria | 1521 |
| 71 | Ga0163163_10657535 | 3300014325 | Bacteria | 1111 |
| 72 | Ga0157380_10095656 | 3300014326 | Bacteria | 2461 |
| 73 | Ga0157377_10003776 | 3300014745 | Bacteria | 6874 |
| 74 | Ga0206356_10911448 | 3300020070 | Bacteria | 1152 |
| 75 | Ga0206353_10365643 | 3300020082 | Bacteria | 3817 |
| 76 | Ga0207645_10118714 | 3300025907 | Bacteria | 1716 |
| 77 | Ga0207643_10465747 | 3300025908 | Bacteria | 805 |
| 78 | Ga0207705_10039043 | 3300025909 | Bacteria | 3402 |
| 79 | Ga0207707_10867533 | 3300025912 | Bacteria | 748 |
| 80 | Ga0207660_10405015 | 3300025917 | Bacteria | 1099 |
| 81 | Ga0207649_10046688 | 3300025920 | Bacteria | 2662 |
| 82 | Ga0207652_10101217 | 3300025921 | Bacteria | 2545 |
| 83 | Ga0207652_10558094 | 3300025921 | Bacteria | 1029 |
| 84 | Ga0207694_10299206 | 3300025924 | Bacteria | 1324 |
| 85 | Ga0207650_10070717 | 3300025925 | Bacteria | 2623 |
| 86 | Ga0207659_10001499 | 3300025926 | Bacteria | 13914 |
| 87 | Ga0207687_10005160 | 3300025927 | Bacteria | 8658 |
| 88 | Ga0207690_10013222 | 3300025932 | Bacteria | 4956 |
| 89 | Ga0207690_10096245 | 3300025932 | Bacteria | 2104 |
| 90 | Ga0207706_10018150 | 3300025933 | Bacteria | 6330 |
| 91 | Ga0207709_10051355 | 3300025935 | Bacteria | 2527 |
| 92 | Ga0207669_10333523 | 3300025937 | Bacteria | 1165 |
| 93 | Ga0207704_10103456 | 3300025938 | Bacteria | 1905 |
| 94 | Ga0207665_10112001 | 3300025939 | Bacteria | 1918 |
| 95 | Ga0207689_10039082 | 3300025942 | Bacteria | 3929 |
| 96 | Ga0207661_10131732 | 3300025944 | Bacteria | 2142 |
| 97 | Ga0207679_10007111 | 3300025945 | Bacteria | 7091 |
| 98 | Ga0207679_10376274 | 3300025945 | Bacteria | 1244 |
| 99 | Ga0207668_10242906 | 3300025972 | Bacteria | 1458 |
| 100 | Ga0207703_10197055 | 3300026035 | Bacteria | 1788 |
| 101 | Ga0207639_10487373 | 3300026041 | Bacteria | 1124 |
| 102 | Ga0207708_10017528 | 3300026075 | Bacteria | 5391 |
| 103 | Ga0207674_10004679 | 3300026116 | Bacteria | 16430 |
| 104 | Ga0207674_10004698 | 3300026116 | Bacteria | 16383 |
| 105 | Ga0207674_10173841 | 3300026116 | Bacteria | 2107 |
| 106 | Ga0207698_11803718 | 3300026142 | Bacteria | 627 |
| 107 | Ga0207428_10021848 | 3300027907 | Bacteria | 5412 |
| 108 | Ga0268266_10663835 | 3300028379 | Bacteria | 1004 |
| 109 | Ga0268265_10017246 | 3300028380 | Bacteria | 4980 |
| 110 | Ga0307515_10016311 | 3300028794 | Bacteria | 13608 |
| 111 | Ga0307515_10045121 | 3300028794 | Bacteria | 6782 |
| 112 | Ga0307512_10031342 | 3300030522 | Bacteria | 4605 |
| 113 | Ga0307513_10083038 | 3300031456 | Bacteria | 3296 |
| 114 | Ga0307509_10648687 | 3300031507 | Bacteria | 725 |
| 115 | Ga0307508_10001708 | 3300031616 | Bacteria | 24364 |
| 116 | Ga0307516_10543067 | 3300031730 | Bacteria | 816 |
| 117 | Ga0307413_10489708 | 3300031824 | Bacteria | 985 |
| 118 | Ga0307406_10053305 | 3300031901 | Bacteria | 2576 |
| 119 | Ga0307406_10065986 | 3300031901 | Bacteria | 2354 |
| 120 | Ga0307406_10129718 | 3300031901 | Bacteria | 1768 |
| 121 | Ga0307407_10022901 | 3300031903 | Bacteria | 3250 |
| 122 | Ga0307409_100022140 | 3300031995 | Bacteria | 4375 |
| 123 | Ga0307409_101099196 | 3300031995 | Bacteria | 816 |
| 124 | Ga0307416_100500409 | 3300032002 | Bacteria | 1279 |
| 125 | Ga0307416_100685407 | 3300032002 | Bacteria | 1113 |
| 126 | Ga0307415_100018112 | 3300032126 | Bacteria | 4243 |
| 127 | Ga0307415_100028685 | 3300032126 | Bacteria | 3545 |
| 128 | Ga0307415_100230039 | 3300032126 | Bacteria | 1492 |
| 129 | Ga0451853_0626431 | 3300041512 | Bacteria | 3465 |
| 130 | Ga0466957_0034024 | 3300044842 | Bacteria | 3057 |
| 131 | Ga0495594_0066640 | 3300046499 | Bacteria | 1998 |
| 132 | Ga0496104_0563342 | 3300048907 | Bacteria | 1050 |
| 133 | Ga0496108_0871554 | 3300048911 | Bacteria | 774 |
| 134 | Ga0496109_0084062 | 3300048912 | Bacteria | 2936 |
| 135 | Ga0496110_0598459 | 3300048913 | Bacteria | 1000 |
| 136 | Ga0496112_0229164 | 3300048915 | Bacteria | 1812 |
| 137 | Ga0496113_0281198 | 3300048916 | Bacteria | 1331 |
| 138 | Ga0496126_0195702 | 3300048929 | Bacteria | 1709 |
| 139 | Ga0501032_0027712 | 3300049569 | Bacteria | 3894 |
| 140 | Ga0501036_0492828 | 3300049572 | Bacteria | 1020 |
| 141 | Ga0501039_0151546 | 3300049575 | Bacteria | 1821 |
| 142 | Ga0501047_0540542 | 3300049581 | Bacteria | 990 |
| 143 | Ga0501068_0140660 | 3300049584 | Bacteria | 1513 |
| 144 | Ga0501072_1587841 | 3300049588 | Bacteria | 504 |
| 145 | Ga0501080_0043715 | 3300049742 | Bacteria | 4172 |
| 146 | Ga0501035_0249508 | 3300049822 | Bacteria | 1508 |
| 147 | Ga0501044_0503997 | 3300049823 | Bacteria | 1111 |
| 148 | Ga0501045_0572889 | 3300049824 | Bacteria | 837 |
| 149 | nmdc:mga03n38_269953_c1 | 3300050490 | Bacteria | 904 |
| 150 | nmdc:mga00v17_153457_c1 | 3300050491 | Bacteria | 1480 |
| 151 | nmdc:mga05p37_119180_c1 | 3300050507 | Bacteria | 3243 |
| 152 | nmdc:mga05p37_15882_c1 | 3300050507 | Bacteria | 9057 |
| 153 | nmdc:mga09592_288754_c1 | 3300050508 | Bacteria | 1422 |
| 154 | nmdc:mga09592_326738_c1 | 3300050508 | Bacteria | 1328 |
| 155 | nmdc:mga09592_34888_c1 | 3300050508 | Bacteria | 4208 |
| 156 | nmdc:mga09592_562445_c1 | 3300050508 | Bacteria | 979 |
| 157 | nmdc:mga0qj67_1282_c1 | 3300050509 | Bacteria | 17594 |
| 158 | nmdc:mga0qj67_3969_c1 | 3300050509 | Bacteria | 10704 |
| 159 | nmdc:mga06r32_11768_c1 | 3300050510 | Bacteria | 7879 |
| 160 | nmdc:mga06r32_473871_c1 | 3300050510 | Bacteria | 1230 |
| 161 | nmdc:mga08y16_2655_c1 | 3300050511 | Bacteria | 18385 |
| 162 | Ga0500646_0000149 | 3300053090 | Bacteria | 20548 |
| 163 | Ga0500583_0004365 | 3300053092 | Bacteria | 4599 |
| 164 | Ga0500588_0014463 | 3300053146 | Bacteria | 2000 |
| 165 | Ga0500633_0178556 | 3300053160 | Bacteria | 796 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_1587841 | Ga0501072_1587841_15_464 | 149 |
| 2 | 3300050508 | nmdc:mga09592_562445_c1 | nmdc:mga09592_562445_c1_488_961 | 156 |
| 3 | 3300032126 | Ga0307415_100018112 | Ga0307415_1000181123 | 160 |
| 4 | 3300005458 | Ga0070681_11270343 | Ga0070681_112703431 | 163 |
| 5 | 3300025912 | Ga0207707_10867533 | Ga0207707_108675331 | 163 |
| 6 | 3300025921 | Ga0207652_10558094 | Ga0207652_105580941 | 163 |
| 7 | 3300049569 | Ga0501032_0027712 | Ga0501032_0027712_1262_1756 | 164 |
| 8 | 3300049575 | Ga0501039_0151546 | Ga0501039_0151546_59_553 | 164 |
| 9 | 3300049581 | Ga0501047_0540542 | Ga0501047_0540542_59_553 | 164 |
| 10 | 3300049742 | Ga0501080_0043715 | Ga0501080_0043715_1995_2489 | 164 |
| 11 | 3300049824 | Ga0501045_0572889 | Ga0501045_0572889_316_810 | 164 |
| 12 | 3300049572 | Ga0501036_0492828 | Ga0501036_0492828_445_951 | 165 |
| 13 | 3300049823 | Ga0501044_0503997 | Ga0501044_0503997_390_896 | 165 |
| 14 | 3300049822 | Ga0501035_0249508 | Ga0501035_0249508_676_1185 | 169 |
| 15 | iso_pu_bacteria | 2501939600 | 2501941177 | 170 |
| 16 | iso_pu_bacteria | 2622736626 | 2623585431 | 170 |
| 17 | iso_pu_bacteria | 2831935698 | 2831939807 | 170 |
| 18 | iso_pu_bacteria | 2832004796 | 2832005825 | 170 |
| 19 | iso_pu_bacteria | 2855670206 | 2855672401 | 170 |
| 20 | iso_pu_bacteria | 2855676851 | 2855677230 | 170 |
| 21 | iso_pu_bacteria | 2855683550 | 2855686226 | 170 |
| 22 | iso_pu_bacteria | 2856858025 | 2856859346 | 170 |
| 23 | iso_pu_bacteria | 2857288857 | 2857291433 | 170 |
| 24 | iso_pu_bacteria | 2858848962 | 2858850264 | 170 |
| 25 | iso_pu_bacteria | 2858868258 | 2858871391 | 170 |
| 26 | iso_pu_bacteria | 2858882152 | 2858884714 | 170 |
| 27 | iso_pu_bacteria | 2858888857 | 2858893333 | 170 |
| 28 | iso_pu_bacteria | 2858895516 | 2858900383 | 170 |
| 29 | iso_pu_bacteria | 2858902515 | 2858902594 | 170 |
| 30 | iso_pu_bacteria | 2866065130 | 2866066352 | 170 |
| 31 | iso_pu_bacteria | 2867302475 | 2867306315 | 170 |
| 32 | iso_pu_bacteria | 2867319477 | 2867322946 | 170 |
| 33 | iso_pu_bacteria | 2867507094 | 2867510544 | 170 |
| 34 | iso_pu_bacteria | 2869048445 | 2869050677 | 170 |
| 35 | iso_pu_bacteria | 2869061728 | 2869063230 | 170 |
| 36 | iso_pu_bacteria | 2869068681 | 2869074862 | 170 |
| 37 | iso_pu_bacteria | 2902582711 | 2902584348 | 170 |
| 38 | iso_pu_bacteria | 2929219909 | 2929226092 | 170 |
| 39 | iso_pu_bacteria | 2929226422 | 2929232753 | 170 |
| 40 | iso_pu_bacteria | 2996221748 | 2996228158 | 170 |
| 41 | iso_pu_bacteria | 649633069 | 649812789 | 170 |
| 42 | iso_pu_bacteria | 8003830390 | 8003836062 | 170 |
| 43 | iso_pu_bacteria | 8003856774 | 8003858550 | 170 |
| 44 | iso_pu_bacteria | 8003870546 | 8003877886 | 170 |
| 45 | iso_pu_bacteria | 8054704163 | 8054710675 | 170 |
| 46 | iso_pu_bacteria | 8054727385 | 8054732377 | 170 |
| 47 | iso_pu_bacteria | 8054734606 | 8054739340 | 170 |
| 48 | iso_pu_bacteria | 8055412473 | 8055414968 | 170 |
| 49 | 3300006846 | Ga0075430_100024206 | Ga0075430_1000242066 | 171 |
| 50 | 3300009147 | Ga0114129_10376625 | Ga0114129_103766252 | 171 |
| 51 | 3300050509 | nmdc:mga0qj67_1282_c1 | nmdc:mga0qj67_1282_c1_9599_10114 | 171 |
| 52 | 3300050510 | nmdc:mga06r32_473871_c1 | nmdc:mga06r32_473871_c1_15_530 | 171 |
| 53 | 3300005328 | Ga0070676_10131648 | Ga0070676_101316482 | 172 |
| 54 | 3300005329 | Ga0070683_100590716 | Ga0070683_1005907162 | 172 |
| 55 | 3300005329 | Ga0070683_100930456 | Ga0070683_1009304562 | 172 |
| 56 | 3300005331 | Ga0070670_100920468 | Ga0070670_1009204682 | 172 |
| 57 | 3300005334 | Ga0068869_100028628 | Ga0068869_1000286284 | 172 |
| 58 | 3300005336 | Ga0070680_100578683 | Ga0070680_1005786831 | 172 |
| 59 | 3300005337 | Ga0070682_100304344 | Ga0070682_1003043442 | 172 |
| 60 | 3300005338 | Ga0068868_100006157 | Ga0068868_1000061573 | 172 |
| 61 | 3300005341 | Ga0070691_10146280 | Ga0070691_101462801 | 172 |
| 62 | 3300005344 | Ga0070661_100058051 | Ga0070661_1000580514 | 172 |
| 63 | 3300005345 | Ga0070692_10012329 | Ga0070692_100123293 | 172 |
| 64 | 3300005347 | Ga0070668_100246864 | Ga0070668_1002468642 | 172 |
| 65 | 3300005353 | Ga0070669_100102886 | Ga0070669_1001028862 | 172 |
| 66 | 3300005354 | Ga0070675_100005072 | Ga0070675_1000050727 | 172 |
| 67 | 3300005356 | Ga0070674_100386161 | Ga0070674_1003861612 | 172 |
| 68 | 3300005366 | Ga0070659_100029279 | Ga0070659_1000292795 | 172 |
| 69 | 3300005441 | Ga0070700_100006119 | Ga0070700_1000061193 | 172 |
| 70 | 3300005457 | Ga0070662_100004703 | Ga0070662_1000047036 | 172 |
| 71 | 3300005535 | Ga0070684_100129788 | Ga0070684_1001297883 | 172 |
| 72 | 3300005539 | Ga0068853_100421701 | Ga0068853_1004217012 | 172 |
| 73 | 3300005564 | Ga0070664_100005469 | Ga0070664_1000054697 | 172 |
| 74 | 3300005577 | Ga0068857_100009332 | Ga0068857_1000093326 | 172 |
| 75 | 3300005578 | Ga0068854_100051310 | Ga0068854_1000513103 | 172 |
| 76 | 3300005615 | Ga0070702_100175890 | Ga0070702_1001758901 | 172 |
| 77 | 3300005618 | Ga0068864_100047956 | Ga0068864_1000479565 | 172 |
| 78 | 3300005834 | Ga0068851_10165494 | Ga0068851_101654943 | 172 |
| 79 | 3300005840 | Ga0068870_10170266 | Ga0068870_101702662 | 172 |
| 80 | 3300005843 | Ga0068860_100993586 | Ga0068860_1009935862 | 172 |
| 81 | 3300005844 | Ga0068862_100004778 | Ga0068862_10000477810 | 172 |
| 82 | 3300006844 | Ga0075428_100202608 | Ga0075428_1002026082 | 172 |
| 83 | 3300006844 | Ga0075428_100350744 | Ga0075428_1003507441 | 172 |
| 84 | 3300006846 | Ga0075430_100207927 | Ga0075430_1002079271 | 172 |
| 85 | 3300006880 | Ga0075429_100511491 | Ga0075429_1005114912 | 172 |
| 86 | 3300006881 | Ga0068865_100453997 | Ga0068865_1004539972 | 172 |
| 87 | 3300009094 | Ga0111539_10006000 | Ga0111539_1000600010 | 172 |
| 88 | 3300009098 | Ga0105245_10007824 | Ga0105245_100078247 | 172 |
| 89 | 3300009148 | Ga0105243_10074322 | Ga0105243_100743225 | 172 |
| 90 | 3300009551 | Ga0105238_10280846 | Ga0105238_102808462 | 172 |
| 91 | 3300011119 | Ga0105246_10034412 | Ga0105246_100344123 | 172 |
| 92 | 3300013308 | Ga0157375_10409876 | Ga0157375_104098762 | 172 |
| 93 | 3300014326 | Ga0157380_10095656 | Ga0157380_100956563 | 172 |
| 94 | 3300014745 | Ga0157377_10003776 | Ga0157377_100037769 | 172 |
| 95 | 3300025907 | Ga0207645_10118714 | Ga0207645_101187142 | 172 |
| 96 | 3300025908 | Ga0207643_10465747 | Ga0207643_104657471 | 172 |
| 97 | 3300025917 | Ga0207660_10405015 | Ga0207660_104050152 | 172 |
| 98 | 3300025920 | Ga0207649_10046688 | Ga0207649_100466885 | 172 |
| 99 | 3300025924 | Ga0207694_10299206 | Ga0207694_102992062 | 172 |
| 100 | 3300025925 | Ga0207650_10070717 | Ga0207650_100707173 | 172 |
| 101 | 3300025926 | Ga0207659_10001499 | Ga0207659_100014996 | 172 |
| 102 | 3300025927 | Ga0207687_10005160 | Ga0207687_100051606 | 172 |
| 103 | 3300025932 | Ga0207690_10096245 | Ga0207690_100962453 | 172 |
| 104 | 3300025933 | Ga0207706_10018150 | Ga0207706_100181505 | 172 |
| 105 | 3300025935 | Ga0207709_10051355 | Ga0207709_100513553 | 172 |
| 106 | 3300025937 | Ga0207669_10333523 | Ga0207669_103335232 | 172 |
| 107 | 3300025938 | Ga0207704_10103456 | Ga0207704_101034563 | 172 |
| 108 | 3300025942 | Ga0207689_10039082 | Ga0207689_100390824 | 172 |
| 109 | 3300025944 | Ga0207661_10131732 | Ga0207661_101317323 | 172 |
| 110 | 3300025945 | Ga0207679_10007111 | Ga0207679_100071116 | 172 |
| 111 | 3300025945 | Ga0207679_10376274 | Ga0207679_103762742 | 172 |
| 112 | 3300025972 | Ga0207668_10242906 | Ga0207668_102429062 | 172 |
| 113 | 3300026035 | Ga0207703_10197055 | Ga0207703_101970553 | 172 |
| 114 | 3300026041 | Ga0207639_10487373 | Ga0207639_104873732 | 172 |
| 115 | 3300026075 | Ga0207708_10017528 | Ga0207708_100175283 | 172 |
| 116 | 3300026116 | Ga0207674_10004679 | Ga0207674_100046797 | 172 |
| 117 | 3300026142 | Ga0207698_11803718 | Ga0207698_118037182 | 172 |
| 118 | 3300027907 | Ga0207428_10021848 | Ga0207428_100218486 | 172 |
| 119 | 3300028380 | Ga0268265_10017246 | Ga0268265_100172465 | 172 |
| 120 | 3300050508 | nmdc:mga09592_326738_c1 | nmdc:mga09592_326738_c1_474_995 | 172 |
| 121 | 3300050511 | nmdc:mga08y16_2655_c1 | nmdc:mga08y16_2655_c1_5792_6313 | 172 |
| 122 | 3300006844 | Ga0075428_100043471 | Ga0075428_1000434716 | 173 |
| 123 | 3300006846 | Ga0075430_100013811 | Ga0075430_1000138114 | 173 |
| 124 | 3300006847 | Ga0075431_100014810 | Ga0075431_1000148106 | 173 |
| 125 | 3300006880 | Ga0075429_100008000 | Ga0075429_1000080007 | 173 |
| 126 | 3300009147 | Ga0114129_10026755 | Ga0114129_100267556 | 173 |
| 127 | 3300031824 | Ga0307413_10489708 | Ga0307413_104897082 | 173 |
| 128 | 3300031901 | Ga0307406_10129718 | Ga0307406_101297183 | 173 |
| 129 | 3300032126 | Ga0307415_100028685 | Ga0307415_1000286853 | 173 |
| 130 | 3300044842 | Ga0466957_0034024 | Ga0466957_0034024_1550_2071 | 173 |
| 131 | 3300046499 | Ga0495594_0066640 | Ga0495594_0066640_503_1024 | 173 |
| 132 | 3300050490 | nmdc:mga03n38_269953_c1 | nmdc:mga03n38_269953_c1_159_698 | 173 |
| 133 | 3300050507 | nmdc:mga05p37_119180_c1 | nmdc:mga05p37_119180_c1_233_763 | 173 |
| 134 | 3300050508 | nmdc:mga09592_34888_c1 | nmdc:mga09592_34888_c1_2324_2854 | 173 |
| 135 | 3300050509 | nmdc:mga0qj67_3969_c1 | nmdc:mga0qj67_3969_c1_1026_1556 | 173 |
| 136 | 3300050510 | nmdc:mga06r32_11768_c1 | nmdc:mga06r32_11768_c1_2480_3010 | 173 |
| 137 | 3300053090 | Ga0500646_0000149 | Ga0500646_0000149_3939_4484 | 173 |
| 138 | 3300053092 | Ga0500583_0004365 | Ga0500583_0004365_123_668 | 173 |
| 139 | 3300053146 | Ga0500588_0014463 | Ga0500588_0014463_787_1332 | 173 |
| 140 | 3300053160 | Ga0500633_0178556 | Ga0500633_0178556_29_574 | 173 |
| 141 | 3300003203 | JGI25406J46586_10022056 | JGI25406J46586_100220563 | 174 |
| 142 | 3300005327 | Ga0070658_10098042 | Ga0070658_100980421 | 174 |
| 143 | 3300005329 | Ga0070683_100060456 | Ga0070683_1000604561 | 174 |
| 144 | 3300005339 | Ga0070660_100075111 | Ga0070660_1000751113 | 174 |
| 145 | 3300005344 | Ga0070661_100193357 | Ga0070661_1001933573 | 174 |
| 146 | 3300005345 | Ga0070692_10196336 | Ga0070692_101963362 | 174 |
| 147 | 3300005366 | Ga0070659_100146868 | Ga0070659_1001468682 | 174 |
| 148 | 3300005435 | Ga0070714_100036112 | Ga0070714_1000361125 | 174 |
| 149 | 3300005436 | Ga0070713_100181259 | Ga0070713_1001812591 | 174 |
| 150 | 3300005458 | Ga0070681_10805674 | Ga0070681_108056741 | 174 |
| 151 | 3300005458 | Ga0070681_11093012 | Ga0070681_110930121 | 174 |
| 152 | 3300005563 | Ga0068855_100166686 | Ga0068855_1001666862 | 174 |
| 153 | 3300005577 | Ga0068857_100156261 | Ga0068857_1001562613 | 174 |
| 154 | 3300005983 | Ga0081540_1003277 | Ga0081540_100327712 | 174 |
| 155 | 3300005985 | Ga0081539_10001096 | Ga0081539_1000109629 | 174 |
| 156 | 3300005985 | Ga0081539_10002399 | Ga0081539_100023999 | 174 |
| 157 | 3300006051 | Ga0075364_10168260 | Ga0075364_101682601 | 174 |
| 158 | 3300006173 | Ga0070716_100138189 | Ga0070716_1001381893 | 174 |
| 159 | 3300006880 | Ga0075429_100716815 | Ga0075429_1007168152 | 174 |
| 160 | 3300009147 | Ga0114129_10006270 | Ga0114129_100062705 | 174 |
| 161 | 3300013104 | Ga0157370_10104066 | Ga0157370_101040662 | 174 |
| 162 | 3300013105 | Ga0157369_10007088 | Ga0157369_1000708814 | 174 |
| 163 | 3300014325 | Ga0163163_10657535 | Ga0163163_106575352 | 174 |
| 164 | 3300020070 | Ga0206356_10911448 | Ga0206356_109114482 | 174 |
| 165 | 3300020082 | Ga0206353_10365643 | Ga0206353_103656434 | 174 |
| 166 | 3300025909 | Ga0207705_10039043 | Ga0207705_100390433 | 174 |
| 167 | 3300025921 | Ga0207652_10101217 | Ga0207652_101012173 | 174 |
| 168 | 3300025932 | Ga0207690_10013222 | Ga0207690_100132225 | 174 |
| 169 | 3300025939 | Ga0207665_10112001 | Ga0207665_101120013 | 174 |
| 170 | 3300026116 | Ga0207674_10004698 | Ga0207674_1000469810 | 174 |
| 171 | 3300026116 | Ga0207674_10173841 | Ga0207674_101738413 | 174 |
| 172 | 3300028379 | Ga0268266_10663835 | Ga0268266_106638351 | 174 |
| 173 | 3300028794 | Ga0307515_10016311 | Ga0307515_1001631114 | 174 |
| 174 | 3300028794 | Ga0307515_10045121 | Ga0307515_100451213 | 174 |
| 175 | 3300030522 | Ga0307512_10031342 | Ga0307512_100313425 | 174 |
| 176 | 3300031456 | Ga0307513_10083038 | Ga0307513_100830383 | 174 |
| 177 | 3300031507 | Ga0307509_10648687 | Ga0307509_106486871 | 174 |
| 178 | 3300031616 | Ga0307508_10001708 | Ga0307508_100017086 | 174 |
| 179 | 3300031730 | Ga0307516_10543067 | Ga0307516_105430672 | 174 |
| 180 | 3300031901 | Ga0307406_10053305 | Ga0307406_100533052 | 174 |
| 181 | 3300031901 | Ga0307406_10065986 | Ga0307406_100659863 | 174 |
| 182 | 3300031903 | Ga0307407_10022901 | Ga0307407_100229015 | 174 |
| 183 | 3300031995 | Ga0307409_100022140 | Ga0307409_1000221404 | 174 |
| 184 | 3300031995 | Ga0307409_101099196 | Ga0307409_1010991962 | 174 |
| 185 | 3300032002 | Ga0307416_100500409 | Ga0307416_1005004092 | 174 |
| 186 | 3300032002 | Ga0307416_100685407 | Ga0307416_1006854072 | 174 |
| 187 | 3300032126 | Ga0307415_100230039 | Ga0307415_1002300392 | 174 |
| 188 | 3300041512 | Ga0451853_0626431 | Ga0451853_0626431_92_658 | 174 |
| 189 | 3300048907 | Ga0496104_0563342 | Ga0496104_0563342_121_654 | 174 |
| 190 | 3300048911 | Ga0496108_0871554 | Ga0496108_0871554_26_559 | 174 |
| 191 | 3300048912 | Ga0496109_0084062 | Ga0496109_0084062_559_1092 | 174 |
| 192 | 3300048913 | Ga0496110_0598459 | Ga0496110_0598459_121_654 | 174 |
| 193 | 3300048915 | Ga0496112_0229164 | Ga0496112_0229164_1020_1553 | 174 |
| 194 | 3300048916 | Ga0496113_0281198 | Ga0496113_0281198_441_974 | 174 |
| 195 | 3300048929 | Ga0496126_0195702 | Ga0496126_0195702_702_1226 | 174 |
| 196 | 3300049584 | Ga0501068_0140660 | Ga0501068_0140660_845_1372 | 174 |
| 197 | 3300050491 | nmdc:mga00v17_153457_c1 | nmdc:mga00v17_153457_c1_933_1460 | 174 |
| 198 | 3300050507 | nmdc:mga05p37_15882_c1 | nmdc:mga05p37_15882_c1_5581_6108 | 174 |
| 199 | 3300050508 | nmdc:mga09592_288754_c1 | nmdc:mga09592_288754_c1_420_944 | 174 |
| 200 | iso_pu_bacteria | 2515154088 | 2515497698 | 174 |
| 201 | iso_pu_bacteria | 2515154137 | 2515757810 | 174 |
| 202 | iso_pu_bacteria | 2515154203 | 2516091618 | 174 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4m5j-assembly1.cif.gz_A | the identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase | 0.9174 | 1 | 154 |
| 1cbk-assembly1.cif.gz_B | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase from haemophilus influenzae | 0.9106 | 1 | 152 |
| 5etl-assembly3.cif.gz_C | e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution | 0.9098 | 2 | 154 |
| 5etl-assembly2.cif.gz_B | e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution | 0.9057 | 2 | 154 |
| 5etl-assembly1.cif.gz_A | e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution | 0.9043 | 2 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNC7_1_182_3.30.70.560 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK | 0.8972 | 1 | 173 | 3.30.70.560 |
| af_Q54YD9_144_293_3.30.70.560 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK | 0.896 | 2 | 153 | 3.30.70.560 |
| af_P9WNC7_1_182_3.30.70.560 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK | 0.8874 | 1 | 173 | 3.30.70.560 |
| af_Q54YD9_144_293_3.30.70.560 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK | 0.8792 | 2 | 153 | 3.30.70.560 |
| af_Q4LB35_295_465_3.30.70.560 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK | 0.8771 | 1 | 152 | 3.30.70.560 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6F8Y2Z1-F1-model_v4 | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) | 0.9916 | 1 | 120 |
GO:0003848
GO:0005524 GO:0016301 GO:0046654 GO:0046656 |
| AF-A0A6N9XZT4-F1-model_v4 | deleted | 0.9826 | 1 | 75 |
|
| AF-W7VLJ6-F1-model_v4 | deleted | 0.9812 | 2 | 174 |
|
| AF-W7VLJ6-F1-model_v4 | deleted | 0.9702 | 2 | 174 |
|
| AF-A0A7G6X1I4-F1-model_v4 | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) | 0.9699 | 1 | 165 |
GO:0003848
GO:0005524 GO:0016301 GO:0046654 GO:0046656 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar