F309691
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 202 | 122 | 201 | 1005 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_100025569|Ga0070712_1000255692 |
| Length | 1118 |
| Sequence | MGRSDLLGLQSELPGCDEGAKLKRLGFSAQNAKNSFMGLKQMQKQVRGFACFMLLFLLALAGTYSFGQATATGTIQGTVTDKSNAVVSGAHVTATFKATGLTRTATTNETGSYRFDLLQAGTYEVKITKEGFATVAQTAELLVGQSASVNATLNPGAATTVVEVTXXXXLVDVDKTSVSQNITPSEVSELPLVGRDAANLAYLAPGVKATDSYDPTKNRYAVLSINGSDGRNVNTTINGVDNKDNTVGGAVMQMPLEAIQEFQISTQRFSAENGRSQGAAINMITKSGTNDYHGSVFGYFRNSALDTEEKVANGDGTSSPNLPDYSRQFFGGSIGGPIKKDKLFAFWAMERQRESQGLSESGTSYAELVLAQQAGLDAQPAKTIPRPFHEWRYNGRLDWTINSRNNAYVSYSSQANDSLNDQADGTQDLTAGNFTLNHLQIANVTLTSQLSSSAINTFTAGFQYWNNLIASHTQAPLITFPDASFGTNGNVPQQSFQRKWQFKDDFSKTIGKHTFKGGVDFIHNPVEGGFFEFNSTLEVDFVANPSCILGIDTSAGCGPSVFPDGFASAGAVTSMSYSNGDPYFLVATKQLGFYGQDDWKVSPRLTLNLGLRWDRDFNMLGMSDYKNSRTYQSLLAISSDPAAQQYSNYYVRSLPHDGTKDFSPRIGFAYDMTGRGKHMLRGGFGLYFGNVFQNIPLFMEQLANPTIFQTVMSLSQTDAVPCAGGQTVNQWSYSQAAADAVVACLPGPSTTAADGSVGRLIDPGYRNPVSEEFNVGYSWAINNNSVFEAEFTHVLGLHENKTINIDQRVVSGQDTSGTPCTAPGTPLGCNLYYGSDNLARPLSAAFANAGQPVLASVRNDESINRQHYDGINFSFRQRMSHHFSLNTNYTLSWAYGYDAGGFTAFRNYARDGYHPFASYEWGPMTNDERHHITVSGLVNLPKGFEFAPILQFGTARPYALTNSYSAINAGGGTTNAVIVPISDQRNFTYGPDFLANFVSQATTNDPTIDPADALAAAKQQLWTCYYESQCTMGKFDPVRGQAFFELDAKLAKDFKLGERVKVQIVAQAFNLTNRANYGNNYGGDVSSSTFGHPVGFINPSSTFTPRSIWSEFGVHLTF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 32 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 51 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 78 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 79 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 80 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 81 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 82 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 83 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 84 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 85 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 86 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 87 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 88 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 89 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 90 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 91 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 92 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 93 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 99 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 100 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 101 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 102 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 103 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 104 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 105 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 106 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.14 |
| Metatranscriptomes | 13.86 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.46 |
| Rhizosphere | 94.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_10058350 | 3300004799 | Bacteria | 3438 |
| 2 | Ga0058863_10169089 | 3300004799 | Unclassified | 3151 |
| 3 | Ga0058861_10093327 | 3300004800 | Unclassified | 3642 |
| 4 | Ga0070670_100033486 | 3300005331 | Unclassified | 4425 |
| 5 | Ga0070680_100034732 | 3300005336 | Unclassified | 4066 |
| 6 | Ga0068868_100028248 | 3300005338 | Unclassified | 4287 |
| 7 | Ga0070667_100011836 | 3300005367 | Bacteria | 7212 |
| 8 | Ga0070709_10003386 | 3300005434 | Bacteria | 8563 |
| 9 | Ga0070709_10004316 | 3300005434 | Bacteria | 7665 |
| 10 | Ga0070714_100017959 | 3300005435 | Bacteria | 5736 |
| 11 | Ga0070713_100025344 | 3300005436 | Bacteria | 4635 |
| 12 | Ga0070711_100024253 | 3300005439 | Bacteria | 3954 |
| 13 | Ga0070681_10064077 | 3300005458 | Unclassified | 3647 |
| 14 | Ga0070706_100018917 | 3300005467 | Bacteria | 6353 |
| 15 | Ga0070707_100002268 | 3300005468 | Bacteria | 18366 |
| 16 | Ga0070698_100002721 | 3300005471 | Bacteria | 19441 |
| 17 | Ga0070679_100063475 | 3300005530 | Bacteria | 3681 |
| 18 | Ga0070684_100004720 | 3300005535 | Bacteria | 10409 |
| 19 | Ga0070684_100023569 | 3300005535 | Bacteria | 5152 |
| 20 | Ga0070684_100024336 | 3300005535 | Bacteria | 5079 |
| 21 | Ga0070697_100013667 | 3300005536 | Bacteria | 6370 |
| 22 | Ga0068853_100005886 | 3300005539 | Bacteria | 9669 |
| 23 | Ga0068853_100006248 | 3300005539 | Bacteria | 9442 |
| 24 | Ga0068855_100010399 | 3300005563 | Bacteria | 11223 |
| 25 | Ga0068855_100031032 | 3300005563 | Bacteria | 6386 |
| 26 | Ga0068857_100013615 | 3300005577 | Bacteria | 7086 |
| 27 | Ga0068856_100020642 | 3300005614 | Bacteria | 6400 |
| 28 | Ga0068852_100000027 | 3300005616 | Bacteria | 113819 |
| 29 | Ga0068852_100043111 | 3300005616 | Unclassified | 3825 |
| 30 | Ga0068864_100004276 | 3300005618 | Bacteria | 11747 |
| 31 | Ga0068863_100000571 | 3300005841 | Bacteria | 37496 |
| 32 | Ga0068863_100011598 | 3300005841 | Bacteria | 8528 |
| 33 | Ga0068858_100023117 | 3300005842 | Bacteria | 5798 |
| 34 | Ga0068860_100034690 | 3300005843 | Unclassified | 4840 |
| 35 | Ga0081540_1002911 | 3300005983 | Bacteria | 13799 |
| 36 | Ga0070717_10020434 | 3300006028 | Bacteria | 5207 |
| 37 | Ga0070712_100002847 | 3300006175 | Bacteria | 10709 |
| 38 | Ga0070712_100025569 | 3300006175 | Bacteria | 3926 |
| 39 | Ga0068871_100024078 | 3300006358 | Bacteria | 4717 |
| 40 | Ga0068871_100035582 | 3300006358 | Unclassified | 3958 |
| 41 | Ga0075434_100000242 | 3300006871 | Bacteria | 38087 |
| 42 | Ga0075436_100004852 | 3300006914 | Bacteria | 9239 |
| 43 | Ga0075436_100018261 | 3300006914 | Bacteria | 4804 |
| 44 | Ga0105240_10000222 | 3300009093 | Bacteria | 113825 |
| 45 | Ga0105240_10002024 | 3300009093 | Bacteria | 33431 |
| 46 | Ga0105240_10013982 | 3300009093 | Bacteria | 10985 |
| 47 | Ga0105240_10033015 | 3300009093 | Bacteria | 6691 |
| 48 | Ga0105240_10074355 | 3300009093 | Unclassified | 4195 |
| 49 | Ga0105240_10104689 | 3300009093 | Unclassified | 3436 |
| 50 | Ga0105240_10104690 | 3300009093 | Unclassified | 3436 |
| 51 | Ga0105245_10011607 | 3300009098 | Bacteria | 7673 |
| 52 | Ga0105241_10008796 | 3300009174 | Bacteria | 7419 |
| 53 | Ga0105241_10011740 | 3300009174 | Bacteria | 6432 |
| 54 | Ga0105241_10032733 | 3300009174 | Unclassified | 3900 |
| 55 | Ga0105241_10035264 | 3300009174 | Bacteria | 3762 |
| 56 | Ga0105248_10007728 | 3300009177 | Bacteria | 11807 |
| 57 | Ga0105248_10074008 | 3300009177 | Unclassified | 3829 |
| 58 | Ga0105248_10088576 | 3300009177 | Bacteria | 3484 |
| 59 | Ga0105237_10060592 | 3300009545 | Unclassified | 3785 |
| 60 | Ga0105237_10067856 | 3300009545 | Unclassified | 3560 |
| 61 | Ga0105237_10084231 | 3300009545 | Unclassified | 3170 |
| 62 | Ga0105238_10025496 | 3300009551 | Bacteria | 6027 |
| 63 | Ga0105238_10028256 | 3300009551 | Bacteria | 5715 |
| 64 | Ga0105238_10054927 | 3300009551 | Unclassified | 3999 |
| 65 | Ga0105239_10002686 | 3300010375 | Bacteria | 22390 |
| 66 | Ga0105239_10004157 | 3300010375 | Bacteria | 17382 |
| 67 | Ga0105239_10050858 | 3300010375 | Unclassified | 4544 |
| 68 | Ga0105246_10021970 | 3300011119 | Unclassified | 4113 |
| 69 | Ga0157370_10000012 | 3300013104 | Bacteria | 201181 |
| 70 | Ga0157369_10000112 | 3300013105 | Bacteria | 114309 |
| 71 | Ga0157369_10007463 | 3300013105 | Bacteria | 12592 |
| 72 | Ga0157369_10017186 | 3300013105 | Bacteria | 8128 |
| 73 | Ga0157369_10067196 | 3300013105 | Unclassified | 3855 |
| 74 | Ga0157374_10042346 | 3300013296 | Bacteria | 4200 |
| 75 | Ga0157374_10051017 | 3300013296 | Bacteria | 3848 |
| 76 | Ga0157374_10069197 | 3300013296 | Bacteria | 3323 |
| 77 | Ga0157374_10081419 | 3300013296 | Unclassified | 3072 |
| 78 | Ga0157378_10020897 | 3300013297 | Bacteria | 5758 |
| 79 | Ga0157378_10034366 | 3300013297 | Bacteria | 4484 |
| 80 | Ga0157372_10000111 | 3300013307 | Bacteria | 86033 |
| 81 | Ga0157372_10005629 | 3300013307 | Bacteria | 13320 |
| 82 | Ga0157372_10044381 | 3300013307 | Unclassified | 4926 |
| 83 | Ga0157372_10092812 | 3300013307 | Unclassified | 3434 |
| 84 | Ga0157372_10103380 | 3300013307 | Unclassified | 3255 |
| 85 | Ga0157375_10056491 | 3300013308 | Unclassified | 3875 |
| 86 | Ga0163163_10004659 | 3300014325 | Bacteria | 11725 |
| 87 | Ga0163163_10005808 | 3300014325 | Bacteria | 10723 |
| 88 | Ga0163163_10011525 | 3300014325 | Bacteria | 8028 |
| 89 | Ga0163163_10051134 | 3300014325 | Unclassified | 4074 |
| 90 | Ga0163163_10051751 | 3300014325 | Bacteria | 4049 |
| 91 | Ga0157379_10003870 | 3300014968 | Bacteria | 12760 |
| 92 | Ga0206352_10713486 | 3300020078 | Unclassified | 4364 |
| 93 | Ga0213872_10004715 | 3300021361 | Bacteria | 7160 |
| 94 | Ga0224712_10008155 | 3300022467 | Unclassified | 3087 |
| 95 | Ga0207710_10008433 | 3300025900 | Unclassified | 4345 |
| 96 | Ga0207699_10006835 | 3300025906 | Bacteria | 5548 |
| 97 | Ga0207684_10018657 | 3300025910 | Bacteria | 5939 |
| 98 | Ga0207654_10007179 | 3300025911 | Bacteria | 5612 |
| 99 | Ga0207654_10011811 | 3300025911 | Unclassified | 4461 |
| 100 | Ga0207654_10017828 | 3300025911 | Bacteria | 3719 |
| 101 | Ga0207707_10025704 | 3300025912 | Bacteria | 5150 |
| 102 | Ga0207695_10000028 | 3300025913 | Bacteria | 551835 |
| 103 | Ga0207695_10001044 | 3300025913 | Bacteria | 48722 |
| 104 | Ga0207695_10003019 | 3300025913 | Bacteria | 24176 |
| 105 | Ga0207695_10010410 | 3300025913 | Bacteria | 11379 |
| 106 | Ga0207695_10020942 | 3300025913 | Bacteria | 7473 |
| 107 | Ga0207695_10076758 | 3300025913 | Unclassified | 3395 |
| 108 | Ga0207671_10032339 | 3300025914 | Unclassified | 3895 |
| 109 | Ga0207693_10000453 | 3300025915 | Bacteria | 37587 |
| 110 | Ga0207693_10006092 | 3300025915 | Bacteria | 9989 |
| 111 | Ga0207693_10022265 | 3300025915 | Bacteria | 5036 |
| 112 | Ga0207663_10015281 | 3300025916 | Archaea | 4232 |
| 113 | Ga0207660_10005724 | 3300025917 | Bacteria | 8064 |
| 114 | Ga0207652_10009815 | 3300025921 | Bacteria | 7705 |
| 115 | Ga0207652_10030018 | 3300025921 | Bacteria | 4550 |
| 116 | Ga0207646_10002209 | 3300025922 | Bacteria | 23174 |
| 117 | Ga0207694_10001131 | 3300025924 | Bacteria | 23075 |
| 118 | Ga0207694_10003640 | 3300025924 | Bacteria | 12203 |
| 119 | Ga0207694_10011309 | 3300025924 | Bacteria | 6737 |
| 120 | Ga0207650_10023265 | 3300025925 | Unclassified | 4392 |
| 121 | Ga0207700_10006582 | 3300025928 | Bacteria | 7036 |
| 122 | Ga0207700_10010184 | 3300025928 | Bacteria | 5916 |
| 123 | Ga0207665_10013348 | 3300025939 | Bacteria | 5400 |
| 124 | Ga0207689_10009212 | 3300025942 | Bacteria | 8539 |
| 125 | Ga0207667_10008478 | 3300025949 | Bacteria | 12207 |
| 126 | Ga0207667_10030044 | 3300025949 | Bacteria | 5883 |
| 127 | Ga0207667_10062252 | 3300025949 | Unclassified | 3902 |
| 128 | Ga0207658_10008864 | 3300025986 | Bacteria | 6826 |
| 129 | Ga0207639_10004717 | 3300026041 | Bacteria | 9181 |
| 130 | Ga0207639_10005554 | 3300026041 | Bacteria | 8526 |
| 131 | Ga0207702_10023818 | 3300026078 | Bacteria | 5079 |
| 132 | Ga0207641_10000812 | 3300026088 | Bacteria | 33288 |
| 133 | Ga0207641_10008871 | 3300026088 | Bacteria | 8303 |
| 134 | Ga0207641_10044888 | 3300026088 | Bacteria | 3718 |
| 135 | Ga0207674_10010124 | 3300026116 | Bacteria | 10721 |
| 136 | Ga0207698_10000021 | 3300026142 | Bacteria | 133280 |
| 137 | Ga0207698_10008414 | 3300026142 | Bacteria | 6525 |
| 138 | Ga0268264_10019084 | 3300028381 | Bacteria | 5606 |
| 139 | Ga0373926_0001381 | 3300035083 | Bacteria | 7343 |
| 140 | Ga0373923_0000699 | 3300035111 | Bacteria | 8566 |
| 141 | Ga0373945_0000995 | 3300035116 | Bacteria | 8462 |
| 142 | Ga0373943_0004368 | 3300035170 | Bacteria | 6408 |
| 143 | Ga0373924_0000450 | 3300035410 | Bacteria | 12637 |
| 144 | Ga0373935_0007805 | 3300035692 | Bacteria | 6413 |
| 145 | Ga0373927_0000400 | 3300035695 | Bacteria | 33593 |
| 146 | Ga0373927_0005776 | 3300035695 | Bacteria | 8494 |
| 147 | Ga0373947_0013395 | 3300035725 | Bacteria | 4699 |
| 148 | Ga0373925_0019479 | 3300037068 | Bacteria | 4936 |
| 149 | Ga0373925_0020084 | 3300037068 | Unclassified | 4861 |
| 150 | Ga0395905_0022509 | 3300037471 | Bacteria | 5961 |
| 151 | Ga0436364_0088945 | 3300037853 | Bacteria | 7056 |
| 152 | Ga0436361_0849457 | 3300039447 | Bacteria | 12881 |
| 153 | Ga0466963_0029672 | 3300044694 | Bacteria | 3523 |
| 154 | Ga0466957_0002766 | 3300044842 | Bacteria | 9497 |
| 155 | Ga0466959_0013629 | 3300045049 | Bacteria | 5897 |
| 156 | Ga0466967_0005863 | 3300045976 | Bacteria | 8597 |
| 157 | Ga0466967_0026743 | 3300045976 | Unclassified | 4786 |
| 158 | Ga0466967_0045199 | 3300045976 | Unclassified | 3825 |
| 159 | Ga0495651_0008511 | 3300046462 | Bacteria | 7860 |
| 160 | Ga0495652_0056090 | 3300046529 | Unclassified | 3348 |
| 161 | Ga0495665_0021291 | 3300046531 | Bacteria | 3483 |
| 162 | Ga0495669_0002726 | 3300046684 | Bacteria | 7240 |
| 163 | Ga0495675_0004680 | 3300047444 | Bacteria | 8313 |
| 164 | Ga0496105_0002825 | 3300048908 | Bacteria | 12699 |
| 165 | Ga0496110_0002815 | 3300048913 | Bacteria | 13130 |
| 166 | Ga0496112_0006604 | 3300048915 | Bacteria | 10209 |
| 167 | Ga0496112_0012415 | 3300048915 | Bacteria | 7831 |
| 168 | Ga0496112_0034054 | 3300048915 | Bacteria | 4956 |
| 169 | Ga0496112_0035379 | 3300048915 | Bacteria | 4865 |
| 170 | Ga0496113_0001232 | 3300048916 | Bacteria | 14076 |
| 171 | Ga0496115_0002459 | 3300048918 | Bacteria | 13306 |
| 172 | Ga0496115_0009895 | 3300048918 | Bacteria | 7101 |
| 173 | Ga0496126_0007226 | 3300048929 | Bacteria | 12216 |
| 174 | nmdc:mga0n895_14689_c1 | 3300050512 | Bacteria | 7121 |
| 175 | nmdc:mga0n895_45653_c1 | 3300050512 | Unclassified | 4276 |
| 176 | nmdc:mga0n895_83119_c1 | 3300050512 | Unclassified | 3193 |
| 177 | nmdc:mga08x19_11045_c1 | 3300050514 | Bacteria | 5435 |
| 178 | nmdc:mga08x19_2929_c1 | 3300050514 | Bacteria | 10262 |
| 179 | Ga0587084_000408 | 3300059477 | Bacteria | 3302 |
| 180 | Ga0587084_000454 | 3300059477 | Unclassified | 3213 |
| 181 | Ga0587070_000471 | 3300059491 | Unclassified | 3356 |
| 182 | Ga0587077_000329 | 3300059493 | Bacteria | 3743 |
| 183 | Ga0587086_000294 | 3300059507 | Bacteria | 3312 |
| 184 | Ga0587091_000515 | 3300059511 | Bacteria | 3386 |
| 185 | Ga0587091_000614 | 3300059511 | Bacteria | 3250 |
| 186 | Ga0587094_000341 | 3300059513 | Bacteria | 3379 |
| 187 | Ga0587095_000095 | 3300059514 | Bacteria | 3387 |
| 188 | Ga0587095_000113 | 3300059514 | Bacteria | 3258 |
| 189 | Ga0587106_000205 | 3300059605 | Bacteria | 3457 |
| 190 | Ga0587101_000350 | 3300059623 | Unclassified | 3087 |
| 191 | Ga0587067_000503 | 3300059640 | Bacteria | 3460 |
| 192 | Ga0587069_000332 | 3300059642 | Unclassified | 3381 |
| 193 | Ga0587075_000316 | 3300059644 | Bacteria | 3539 |
| 194 | Ga0587075_000400 | 3300059644 | Unclassified | 3352 |
| 195 | Ga0587078_000391 | 3300059646 | Unclassified | 3201 |
| 196 | Ga0587079_000489 | 3300059647 | Bacteria | 3544 |
| 197 | Ga0587079_000614 | 3300059647 | Bacteria | 3356 |
| 198 | Ga0587079_000715 | 3300059647 | Unclassified | 3231 |
| 199 | Ga0587100_000105 | 3300059648 | Bacteria | 3158 |
| 200 | Ga0587107_000168 | 3300059652 | Bacteria | 3543 |
| 201 | Ga0587071_000843 | 3300060344 | Bacteria | 3458 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050514 | nmdc:mga08x19_2929_c1 | nmdc:mga08x19_2929_c1_7765_10239 | 789 |
| 2 | 3300046684 | Ga0495669_0002726 | Ga0495669_0002726_4698_7208 | 827 |
| 3 | 3300059623 | Ga0587101_000350 | Ga0587101_000350_66_2681 | 857 |
| 4 | 3300046529 | Ga0495652_0056090 | Ga0495652_0056090_34_2799 | 889 |
| 5 | 3300013296 | Ga0157374_10081419 | Ga0157374_100814191 | 895 |
| 6 | 3300009545 | Ga0105237_10067856 | Ga0105237_100678562 | 911 |
| 7 | 3300037068 | Ga0373925_0019479 | Ga0373925_0019479_2106_4919 | 917 |
| 8 | 3300048929 | Ga0496126_0007226 | Ga0496126_0007226_4084_7290 | 935 |
| 9 | 3300048918 | Ga0496115_0002459 | Ga0496115_0002459_6469_9465 | 941 |
| 10 | 3300048915 | Ga0496112_0012415 | Ga0496112_0012415_801_3683 | 942 |
| 11 | 3300005983 | Ga0081540_1002911 | Ga0081540_10029116 | 954 |
| 12 | 3300005331 | Ga0070670_100033486 | Ga0070670_1000334862 | 956 |
| 13 | 3300005338 | Ga0068868_100028248 | Ga0068868_1000282481 | 956 |
| 14 | 3300005367 | Ga0070667_100011836 | Ga0070667_1000118363 | 956 |
| 15 | 3300005535 | Ga0070684_100004720 | Ga0070684_1000047207 | 956 |
| 16 | 3300005577 | Ga0068857_100013615 | Ga0068857_1000136154 | 956 |
| 17 | 3300005614 | Ga0068856_100020642 | Ga0068856_1000206423 | 956 |
| 18 | 3300005841 | Ga0068863_100011598 | Ga0068863_1000115981 | 956 |
| 19 | 3300005843 | Ga0068860_100034690 | Ga0068860_1000346901 | 956 |
| 20 | 3300006358 | Ga0068871_100035582 | Ga0068871_1000355822 | 956 |
| 21 | 3300009174 | Ga0105241_10008796 | Ga0105241_100087964 | 956 |
| 22 | 3300009177 | Ga0105248_10007728 | Ga0105248_100077284 | 956 |
| 23 | 3300009551 | Ga0105238_10025496 | Ga0105238_100254963 | 956 |
| 24 | 3300010375 | Ga0105239_10050858 | Ga0105239_100508581 | 956 |
| 25 | 3300011119 | Ga0105246_10021970 | Ga0105246_100219701 | 956 |
| 26 | 3300013297 | Ga0157378_10020897 | Ga0157378_100208971 | 956 |
| 27 | 3300013308 | Ga0157375_10056491 | Ga0157375_100564911 | 956 |
| 28 | 3300014325 | Ga0163163_10051134 | Ga0163163_100511341 | 956 |
| 29 | 3300025900 | Ga0207710_10008433 | Ga0207710_100084331 | 956 |
| 30 | 3300025911 | Ga0207654_10011811 | Ga0207654_100118111 | 956 |
| 31 | 3300025913 | Ga0207695_10020942 | Ga0207695_100209424 | 956 |
| 32 | 3300025924 | Ga0207694_10011309 | Ga0207694_100113093 | 956 |
| 33 | 3300025925 | Ga0207650_10023265 | Ga0207650_100232651 | 956 |
| 34 | 3300025942 | Ga0207689_10009212 | Ga0207689_100092122 | 956 |
| 35 | 3300025986 | Ga0207658_10008864 | Ga0207658_100088643 | 956 |
| 36 | 3300026078 | Ga0207702_10023818 | Ga0207702_100238182 | 956 |
| 37 | 3300026088 | Ga0207641_10008871 | Ga0207641_100088713 | 956 |
| 38 | 3300026116 | Ga0207674_10010124 | Ga0207674_100101245 | 956 |
| 39 | 3300028381 | Ga0268264_10019084 | Ga0268264_100190843 | 956 |
| 40 | 3300005439 | Ga0070711_100024253 | Ga0070711_1000242532 | 957 |
| 41 | 3300013296 | Ga0157374_10051017 | Ga0157374_100510172 | 958 |
| 42 | 3300014325 | Ga0163163_10011525 | Ga0163163_100115252 | 958 |
| 43 | 3300046462 | Ga0495651_0008511 | Ga0495651_0008511_3904_6891 | 962 |
| 44 | 3300009093 | Ga0105240_10033015 | Ga0105240_100330155 | 963 |
| 45 | 3300013297 | Ga0157378_10034366 | Ga0157378_100343662 | 964 |
| 46 | 3300005434 | Ga0070709_10003386 | Ga0070709_100033862 | 966 |
| 47 | 3300013296 | Ga0157374_10069197 | Ga0157374_100691971 | 966 |
| 48 | 3300025939 | Ga0207665_10013348 | Ga0207665_100133482 | 966 |
| 49 | 3300059644 | Ga0587075_000400 | Ga0587075_000400_20_3106 | 967 |
| 50 | 3300005539 | Ga0068853_100005886 | Ga0068853_1000058862 | 968 |
| 51 | 3300005616 | Ga0068852_100043111 | Ga0068852_1000431112 | 968 |
| 52 | 3300009093 | Ga0105240_10104690 | Ga0105240_101046901 | 968 |
| 53 | 3300009174 | Ga0105241_10032733 | Ga0105241_100327331 | 968 |
| 54 | 3300009545 | Ga0105237_10060592 | Ga0105237_100605921 | 968 |
| 55 | 3300009551 | Ga0105238_10028256 | Ga0105238_100282563 | 968 |
| 56 | 3300010375 | Ga0105239_10004157 | Ga0105239_1000415712 | 968 |
| 57 | 3300013105 | Ga0157369_10067196 | Ga0157369_100671961 | 968 |
| 58 | 3300013307 | Ga0157372_10092812 | Ga0157372_100928121 | 968 |
| 59 | 3300025911 | Ga0207654_10007179 | Ga0207654_100071792 | 968 |
| 60 | 3300025913 | Ga0207695_10076758 | Ga0207695_100767581 | 968 |
| 61 | 3300025914 | Ga0207671_10032339 | Ga0207671_100323392 | 968 |
| 62 | 3300025924 | Ga0207694_10001131 | Ga0207694_100011312 | 968 |
| 63 | 3300025949 | Ga0207667_10062252 | Ga0207667_100622522 | 968 |
| 64 | 3300026041 | Ga0207639_10004717 | Ga0207639_100047171 | 968 |
| 65 | 3300026142 | Ga0207698_10008414 | Ga0207698_100084143 | 968 |
| 66 | 3300035695 | Ga0373927_0000400 | Ga0373927_0000400_16657_19710 | 968 |
| 67 | 3300037853 | Ga0436364_0088945 | Ga0436364_0088945_1232_4315 | 970 |
| 68 | 3300059647 | Ga0587079_000715 | Ga0587079_000715_156_3212 | 972 |
| 69 | 3300005535 | Ga0070684_100023569 | Ga0070684_1000235692 | 973 |
| 70 | 3300005563 | Ga0068855_100010399 | Ga0068855_1000103997 | 973 |
| 71 | 3300005616 | Ga0068852_100000027 | Ga0068852_10000002734 | 973 |
| 72 | 3300009093 | Ga0105240_10000222 | Ga0105240_1000022233 | 973 |
| 73 | 3300013104 | Ga0157370_10000012 | Ga0157370_10000012170 | 973 |
| 74 | 3300013105 | Ga0157369_10000112 | Ga0157369_1000011234 | 973 |
| 75 | 3300013307 | Ga0157372_10000111 | Ga0157372_1000011173 | 973 |
| 76 | 3300014325 | Ga0163163_10051751 | Ga0163163_100517512 | 973 |
| 77 | 3300025913 | Ga0207695_10000028 | Ga0207695_10000028185 | 973 |
| 78 | 3300025949 | Ga0207667_10008478 | Ga0207667_100084788 | 973 |
| 79 | 3300026142 | Ga0207698_10000021 | Ga0207698_1000002190 | 973 |
| 80 | 3300006358 | Ga0068871_100024078 | Ga0068871_1000240782 | 974 |
| 81 | 3300010375 | Ga0105239_10002686 | Ga0105239_1000268612 | 974 |
| 82 | 3300013296 | Ga0157374_10042346 | Ga0157374_100423462 | 974 |
| 83 | 3300025913 | Ga0207695_10001044 | Ga0207695_100010448 | 974 |
| 84 | 3300025924 | Ga0207694_10003640 | Ga0207694_100036405 | 974 |
| 85 | 3300037471 | Ga0395905_0022509 | Ga0395905_0022509_616_3651 | 974 |
| 86 | 3300005530 | Ga0070679_100063475 | Ga0070679_1000634751 | 975 |
| 87 | 3300009093 | Ga0105240_10104689 | Ga0105240_101046891 | 975 |
| 88 | 3300009545 | Ga0105237_10084231 | Ga0105237_100842311 | 975 |
| 89 | 3300009551 | Ga0105238_10054927 | Ga0105238_100549273 | 975 |
| 90 | 3300013307 | Ga0157372_10103380 | Ga0157372_101033801 | 975 |
| 91 | 3300005563 | Ga0068855_100031032 | Ga0068855_1000310323 | 981 |
| 92 | 3300009093 | Ga0105240_10013982 | Ga0105240_100139824 | 981 |
| 93 | 3300013105 | Ga0157369_10007463 | Ga0157369_1000746311 | 981 |
| 94 | 3300013307 | Ga0157372_10005629 | Ga0157372_100056293 | 981 |
| 95 | 3300025913 | Ga0207695_10010410 | Ga0207695_100104103 | 981 |
| 96 | 3300004799 | Ga0058863_10169089 | Ga0058863_101690891 | 983 |
| 97 | 3300005336 | Ga0070680_100034732 | Ga0070680_1000347323 | 983 |
| 98 | 3300005471 | Ga0070698_100002721 | Ga0070698_1000027215 | 983 |
| 99 | 3300025917 | Ga0207660_10005724 | Ga0207660_100057241 | 983 |
| 100 | 3300025921 | Ga0207652_10009815 | Ga0207652_100098154 | 983 |
| 101 | 3300059477 | Ga0587084_000454 | Ga0587084_000454_20_3109 | 983 |
| 102 | 3300059491 | Ga0587070_000471 | Ga0587070_000471_25_3114 | 983 |
| 103 | 3300059513 | Ga0587094_000341 | Ga0587094_000341_274_3363 | 983 |
| 104 | 3300059642 | Ga0587069_000332 | Ga0587069_000332_17_3106 | 983 |
| 105 | 3300059646 | Ga0587078_000391 | Ga0587078_000391_94_3183 | 983 |
| 106 | 3300059648 | Ga0587100_000105 | Ga0587100_000105_57_3146 | 986 |
| 107 | 3300005841 | Ga0068863_100000571 | Ga0068863_10000057115 | 987 |
| 108 | 3300005842 | Ga0068858_100023117 | Ga0068858_1000231172 | 987 |
| 109 | 3300009177 | Ga0105248_10074008 | Ga0105248_100740082 | 987 |
| 110 | 3300014968 | Ga0157379_10003870 | Ga0157379_100038704 | 987 |
| 111 | 3300026088 | Ga0207641_10000812 | Ga0207641_100008128 | 987 |
| 112 | 3300050512 | nmdc:mga0n895_45653_c1 | nmdc:mga0n895_45653_c1_314_3397 | 987 |
| 113 | 3300014325 | Ga0163163_10005808 | Ga0163163_100058081 | 988 |
| 114 | 3300047444 | Ga0495675_0004680 | Ga0495675_0004680_4339_7449 | 988 |
| 115 | 3300009093 | Ga0105240_10002024 | Ga0105240_1000202420 | 991 |
| 116 | 3300025913 | Ga0207695_10003019 | Ga0207695_1000301915 | 991 |
| 117 | 3300045976 | Ga0466967_0026743 | Ga0466967_0026743_533_3622 | 993 |
| 118 | 3300050512 | nmdc:mga0n895_83119_c1 | nmdc:mga0n895_83119_c1_89_3163 | 993 |
| 119 | 3300009177 | Ga0105248_10088576 | Ga0105248_100885761 | 994 |
| 120 | 3300009098 | Ga0105245_10011607 | Ga0105245_100116073 | 995 |
| 121 | 3300009174 | Ga0105241_10035264 | Ga0105241_100352641 | 995 |
| 122 | 3300025911 | Ga0207654_10017828 | Ga0207654_100178281 | 995 |
| 123 | 3300045976 | Ga0466967_0045199 | Ga0466967_0045199_28_3156 | 996 |
| 124 | 3300005467 | Ga0070706_100018917 | Ga0070706_1000189172 | 997 |
| 125 | 3300005468 | Ga0070707_100002268 | Ga0070707_1000022688 | 997 |
| 126 | 3300005536 | Ga0070697_100013667 | Ga0070697_1000136672 | 997 |
| 127 | 3300006175 | Ga0070712_100002847 | Ga0070712_1000028477 | 997 |
| 128 | 3300025910 | Ga0207684_10018657 | Ga0207684_100186572 | 997 |
| 129 | 3300025915 | Ga0207693_10006092 | Ga0207693_1000609211 | 997 |
| 130 | 3300025922 | Ga0207646_10002209 | Ga0207646_1000220910 | 997 |
| 131 | 3300004800 | Ga0058861_10093327 | Ga0058861_100933272 | 1000 |
| 132 | 3300005458 | Ga0070681_10064077 | Ga0070681_100640772 | 1000 |
| 133 | 3300009093 | Ga0105240_10074355 | Ga0105240_100743552 | 1000 |
| 134 | 3300013307 | Ga0157372_10044381 | Ga0157372_100443812 | 1000 |
| 135 | 3300020078 | Ga0206352_10713486 | Ga0206352_107134862 | 1000 |
| 136 | 3300022467 | Ga0224712_10008155 | Ga0224712_100081551 | 1000 |
| 137 | 3300009174 | Ga0105241_10011740 | Ga0105241_100117401 | 1001 |
| 138 | 3300025949 | Ga0207667_10030044 | Ga0207667_100300442 | 1001 |
| 139 | 3300045976 | Ga0466967_0005863 | Ga0466967_0005863_4893_7979 | 1001 |
| 140 | 3300006914 | Ga0075436_100004852 | Ga0075436_1000048525 | 1002 |
| 141 | 3300044694 | Ga0466963_0029672 | Ga0466963_0029672_358_3510 | 1004 |
| 142 | 3300048918 | Ga0496115_0009895 | Ga0496115_0009895_3192_6512 | 1005 |
| 143 | 3300021361 | Ga0213872_10004715 | Ga0213872_100047153 | 1006 |
| 144 | 3300039447 | Ga0436361_0849457 | Ga0436361_0849457_3733_6795 | 1006 |
| 145 | 3300005618 | Ga0068864_100004276 | Ga0068864_1000042769 | 1007 |
| 146 | 3300006871 | Ga0075434_100000242 | Ga0075434_10000024237 | 1007 |
| 147 | 3300026088 | Ga0207641_10044888 | Ga0207641_100448881 | 1007 |
| 148 | 3300048915 | Ga0496112_0006604 | Ga0496112_0006604_3565_6624 | 1007 |
| 149 | 3300050512 | nmdc:mga0n895_14689_c1 | nmdc:mga0n895_14689_c1_267_3425 | 1007 |
| 150 | 3300013105 | Ga0157369_10017186 | Ga0157369_100171863 | 1008 |
| 151 | 3300035725 | Ga0373947_0013395 | Ga0373947_0013395_26_3106 | 1009 |
| 152 | 3300035111 | Ga0373923_0000699 | Ga0373923_0000699_4282_7380 | 1010 |
| 153 | 3300035116 | Ga0373945_0000995 | Ga0373945_0000995_505_3603 | 1010 |
| 154 | 3300035410 | Ga0373924_0000450 | Ga0373924_0000450_6098_9196 | 1010 |
| 155 | 3300046531 | Ga0495665_0021291 | Ga0495665_0021291_65_3163 | 1010 |
| 156 | 3300048916 | Ga0496113_0001232 | Ga0496113_0001232_10808_13906 | 1010 |
| 157 | 3300005435 | Ga0070714_100017959 | Ga0070714_1000179594 | 1012 |
| 158 | 3300005436 | Ga0070713_100025344 | Ga0070713_1000253442 | 1012 |
| 159 | 3300006028 | Ga0070717_10020434 | Ga0070717_100204343 | 1012 |
| 160 | 3300059514 | Ga0587095_000113 | Ga0587095_000113_18_3134 | 1015 |
| 161 | 3300005618 | Ga0068864_100004276 | Ga0068864_1000042767 | 1017 |
| 162 | 3300014325 | Ga0163163_10004659 | Ga0163163_100046592 | 1017 |
| 163 | 3300035083 | Ga0373926_0001381 | Ga0373926_0001381_3062_6175 | 1020 |
| 164 | 3300035170 | Ga0373943_0004368 | Ga0373943_0004368_2201_5314 | 1020 |
| 165 | 3300035692 | Ga0373935_0007805 | Ga0373935_0007805_360_3473 | 1020 |
| 166 | 3300035695 | Ga0373927_0005776 | Ga0373927_0005776_1168_4281 | 1020 |
| 167 | 3300037068 | Ga0373925_0020084 | Ga0373925_0020084_672_3785 | 1020 |
| 168 | 3300005434 | Ga0070709_10004316 | Ga0070709_100043163 | 1022 |
| 169 | 3300045049 | Ga0466959_0013629 | Ga0466959_0013629_2702_5860 | 1025 |
| 170 | 3300048908 | Ga0496105_0002825 | Ga0496105_0002825_8798_11905 | 1025 |
| 171 | 3300059477 | Ga0587084_000408 | Ga0587084_000408_137_3292 | 1025 |
| 172 | 3300059493 | Ga0587077_000329 | Ga0587077_000329_81_3452 | 1025 |
| 173 | 3300059507 | Ga0587086_000294 | Ga0587086_000294_147_3302 | 1025 |
| 174 | 3300059511 | Ga0587091_000515 | Ga0587091_000515_18_3173 | 1025 |
| 175 | 3300059511 | Ga0587091_000614 | Ga0587091_000614_25_3141 | 1025 |
| 176 | 3300059514 | Ga0587095_000095 | Ga0587095_000095_215_3370 | 1025 |
| 177 | 3300059605 | Ga0587106_000205 | Ga0587106_000205_292_3447 | 1025 |
| 178 | 3300059640 | Ga0587067_000503 | Ga0587067_000503_15_3170 | 1025 |
| 179 | 3300059644 | Ga0587075_000316 | Ga0587075_000316_211_3327 | 1025 |
| 180 | 3300059647 | Ga0587079_000489 | Ga0587079_000489_99_3254 | 1025 |
| 181 | 3300059647 | Ga0587079_000614 | Ga0587079_000614_16_3132 | 1025 |
| 182 | 3300059652 | Ga0587107_000168 | Ga0587107_000168_97_3252 | 1025 |
| 183 | 3300060344 | Ga0587071_000843 | Ga0587071_000843_288_3443 | 1025 |
| 184 | 3300025928 | Ga0207700_10006582 | Ga0207700_100065826 | 1026 |
| 185 | 3300050514 | nmdc:mga08x19_11045_c1 | nmdc:mga08x19_11045_c1_1742_4879 | 1029 |
| 186 | 3300005539 | Ga0068853_100006248 | Ga0068853_1000062482 | 1030 |
| 187 | 3300026041 | Ga0207639_10005554 | Ga0207639_100055547 | 1030 |
| 188 | 3300006175 | Ga0070712_100025569 | Ga0070712_1000255692 | 1031 |
| 189 | 3300025906 | Ga0207699_10006835 | Ga0207699_100068352 | 1031 |
| 190 | 3300025915 | Ga0207693_10000453 | Ga0207693_1000045330 | 1031 |
| 191 | 3300025928 | Ga0207700_10010184 | Ga0207700_100101841 | 1031 |
| 192 | 3300005535 | Ga0070684_100024336 | Ga0070684_1000243363 | 1032 |
| 193 | 3300025915 | Ga0207693_10022265 | Ga0207693_100222654 | 1032 |
| 194 | 3300025916 | Ga0207663_10015281 | Ga0207663_100152812 | 1032 |
| 195 | 3300048915 | Ga0496112_0034054 | Ga0496112_0034054_264_3536 | 1032 |
| 196 | 3300044842 | Ga0466957_0002766 | Ga0466957_0002766_4884_8066 | 1034 |
| 197 | 3300048913 | Ga0496110_0002815 | Ga0496110_0002815_293_3442 | 1035 |
| 198 | 3300006914 | Ga0075436_100018261 | Ga0075436_1000182612 | 1039 |
| 199 | 3300004799 | Ga0058863_10058350 | Ga0058863_100583501 | 1049 |
| 200 | 3300025912 | Ga0207707_10025704 | Ga0207707_100257043 | 1049 |
| 201 | 3300025921 | Ga0207652_10030018 | Ga0207652_100300182 | 1049 |
| 202 | 3300048915 | Ga0496112_0035379 | Ga0496112_0035379_602_3751 | 1049 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5aq0-assembly1.cif.gz_A | the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d | 0.9172 | 33 | 115 |
| 5aq0-assembly1.cif.gz_A | the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d | 0.8853 | 33 | 115 |
| 4v4c-assembly3.cif.gz_F | crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici | 0.8539 | 28 | 111 |
| 4p0d-assembly1.cif.gz_A | the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions | 0.808 | 30 | 96 |
| 2ysu-assembly1.cif.gz_A | structure of the complex between btub and colicin e2 receptor binding domain | 0.8069 | 135 | 1049 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FFQ7_314_405_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.9356 | 33 | 115 | 2.60.40.1120 |
| af_O75976_383_462_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.9142 | 33 | 115 | 2.60.40.1120 |
| af_E7F254_344_443_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.9101 | 33 | 116 | 2.60.40.1120 |
| af_O75976_383_462_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.8927 | 33 | 115 | 2.60.40.1120 |
| af_F1RAC0_1040_1118_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.8877 | 33 | 115 | 2.60.40.1120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A355UVY8-F1-model_v4 | Carboxypeptidase regulatory-like domain-containing protein | 0.9634 | 29 | 118 |
|
| AF-A0A838U5F0-F1-model_v4 | Carboxypeptidase regulatory-like domain-containing protein | 0.9363 | 29 | 111 |
GO:0004180
GO:0016020 GO:0030246 |
| AF-A0A2V8PEP7-F1-model_v4 | TonB-dependent receptor | 0.9325 | 24 | 95 |
GO:0030246
|
| AF-A0A2V9JJX5-F1-model_v4 | TonB-dependent receptor | 0.9253 | 24 | 101 |
GO:0030246
|
| AF-A0A7J2SRQ5-F1-model_v4 | Carboxypeptidase regulatory-like domain-containing protein | 0.9226 | 25 | 114 |
GO:0004180
GO:0030246 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar