F309691

General Info

Members Datasets Scaffolds Average Seq Length
202 122 201 1005

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100025569|Ga0070712_1000255692
Length 1118
Sequence MGRSDLLGLQSELPGCDEGAKLKRLGFSAQNAKNSFMGLKQMQKQVRGFACFMLLFLLALAGTYSFGQATATGTIQGTVTDKSNAVVSGAHVTATFKATGLTRTATTNETGSYRFDLLQAGTYEVKITKEGFATVAQTAELLVGQSASVNATLNPGAATTVVEVTXXXXLVDVDKTSVSQNITPSEVSELPLVGRDAANLAYLAPGVKATDSYDPTKNRYAVLSINGSDGRNVNTTINGVDNKDNTVGGAVMQMPLEAIQEFQISTQRFSAENGRSQGAAINMITKSGTNDYHGSVFGYFRNSALDTEEKVANGDGTSSPNLPDYSRQFFGGSIGGPIKKDKLFAFWAMERQRESQGLSESGTSYAELVLAQQAGLDAQPAKTIPRPFHEWRYNGRLDWTINSRNNAYVSYSSQANDSLNDQADGTQDLTAGNFTLNHLQIANVTLTSQLSSSAINTFTAGFQYWNNLIASHTQAPLITFPDASFGTNGNVPQQSFQRKWQFKDDFSKTIGKHTFKGGVDFIHNPVEGGFFEFNSTLEVDFVANPSCILGIDTSAGCGPSVFPDGFASAGAVTSMSYSNGDPYFLVATKQLGFYGQDDWKVSPRLTLNLGLRWDRDFNMLGMSDYKNSRTYQSLLAISSDPAAQQYSNYYVRSLPHDGTKDFSPRIGFAYDMTGRGKHMLRGGFGLYFGNVFQNIPLFMEQLANPTIFQTVMSLSQTDAVPCAGGQTVNQWSYSQAAADAVVACLPGPSTTAADGSVGRLIDPGYRNPVSEEFNVGYSWAINNNSVFEAEFTHVLGLHENKTINIDQRVVSGQDTSGTPCTAPGTPLGCNLYYGSDNLARPLSAAFANAGQPVLASVRNDESINRQHYDGINFSFRQRMSHHFSLNTNYTLSWAYGYDAGGFTAFRNYARDGYHPFASYEWGPMTNDERHHITVSGLVNLPKGFEFAPILQFGTARPYALTNSYSAINAGGGTTNAVIVPISDQRNFTYGPDFLANFVSQATTNDPTIDPADALAAAKQQLWTCYYESQCTMGKFDPVRGQAFFELDAKLAKDFKLGERVKVQIVAQAFNLTNRANYGNNYGGDVSSSTFGHPVGFINPSSTFTPRSIWSEFGVHLTF

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
106 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.14
Metatranscriptomes 13.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.46
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10058350 3300004799 Bacteria 3438
2 Ga0058863_10169089 3300004799 Unclassified 3151
3 Ga0058861_10093327 3300004800 Unclassified 3642
4 Ga0070670_100033486 3300005331 Unclassified 4425
5 Ga0070680_100034732 3300005336 Unclassified 4066
6 Ga0068868_100028248 3300005338 Unclassified 4287
7 Ga0070667_100011836 3300005367 Bacteria 7212
8 Ga0070709_10003386 3300005434 Bacteria 8563
9 Ga0070709_10004316 3300005434 Bacteria 7665
10 Ga0070714_100017959 3300005435 Bacteria 5736
11 Ga0070713_100025344 3300005436 Bacteria 4635
12 Ga0070711_100024253 3300005439 Bacteria 3954
13 Ga0070681_10064077 3300005458 Unclassified 3647
14 Ga0070706_100018917 3300005467 Bacteria 6353
15 Ga0070707_100002268 3300005468 Bacteria 18366
16 Ga0070698_100002721 3300005471 Bacteria 19441
17 Ga0070679_100063475 3300005530 Bacteria 3681
18 Ga0070684_100004720 3300005535 Bacteria 10409
19 Ga0070684_100023569 3300005535 Bacteria 5152
20 Ga0070684_100024336 3300005535 Bacteria 5079
21 Ga0070697_100013667 3300005536 Bacteria 6370
22 Ga0068853_100005886 3300005539 Bacteria 9669
23 Ga0068853_100006248 3300005539 Bacteria 9442
24 Ga0068855_100010399 3300005563 Bacteria 11223
25 Ga0068855_100031032 3300005563 Bacteria 6386
26 Ga0068857_100013615 3300005577 Bacteria 7086
27 Ga0068856_100020642 3300005614 Bacteria 6400
28 Ga0068852_100000027 3300005616 Bacteria 113819
29 Ga0068852_100043111 3300005616 Unclassified 3825
30 Ga0068864_100004276 3300005618 Bacteria 11747
31 Ga0068863_100000571 3300005841 Bacteria 37496
32 Ga0068863_100011598 3300005841 Bacteria 8528
33 Ga0068858_100023117 3300005842 Bacteria 5798
34 Ga0068860_100034690 3300005843 Unclassified 4840
35 Ga0081540_1002911 3300005983 Bacteria 13799
36 Ga0070717_10020434 3300006028 Bacteria 5207
37 Ga0070712_100002847 3300006175 Bacteria 10709
38 Ga0070712_100025569 3300006175 Bacteria 3926
39 Ga0068871_100024078 3300006358 Bacteria 4717
40 Ga0068871_100035582 3300006358 Unclassified 3958
41 Ga0075434_100000242 3300006871 Bacteria 38087
42 Ga0075436_100004852 3300006914 Bacteria 9239
43 Ga0075436_100018261 3300006914 Bacteria 4804
44 Ga0105240_10000222 3300009093 Bacteria 113825
45 Ga0105240_10002024 3300009093 Bacteria 33431
46 Ga0105240_10013982 3300009093 Bacteria 10985
47 Ga0105240_10033015 3300009093 Bacteria 6691
48 Ga0105240_10074355 3300009093 Unclassified 4195
49 Ga0105240_10104689 3300009093 Unclassified 3436
50 Ga0105240_10104690 3300009093 Unclassified 3436
51 Ga0105245_10011607 3300009098 Bacteria 7673
52 Ga0105241_10008796 3300009174 Bacteria 7419
53 Ga0105241_10011740 3300009174 Bacteria 6432
54 Ga0105241_10032733 3300009174 Unclassified 3900
55 Ga0105241_10035264 3300009174 Bacteria 3762
56 Ga0105248_10007728 3300009177 Bacteria 11807
57 Ga0105248_10074008 3300009177 Unclassified 3829
58 Ga0105248_10088576 3300009177 Bacteria 3484
59 Ga0105237_10060592 3300009545 Unclassified 3785
60 Ga0105237_10067856 3300009545 Unclassified 3560
61 Ga0105237_10084231 3300009545 Unclassified 3170
62 Ga0105238_10025496 3300009551 Bacteria 6027
63 Ga0105238_10028256 3300009551 Bacteria 5715
64 Ga0105238_10054927 3300009551 Unclassified 3999
65 Ga0105239_10002686 3300010375 Bacteria 22390
66 Ga0105239_10004157 3300010375 Bacteria 17382
67 Ga0105239_10050858 3300010375 Unclassified 4544
68 Ga0105246_10021970 3300011119 Unclassified 4113
69 Ga0157370_10000012 3300013104 Bacteria 201181
70 Ga0157369_10000112 3300013105 Bacteria 114309
71 Ga0157369_10007463 3300013105 Bacteria 12592
72 Ga0157369_10017186 3300013105 Bacteria 8128
73 Ga0157369_10067196 3300013105 Unclassified 3855
74 Ga0157374_10042346 3300013296 Bacteria 4200
75 Ga0157374_10051017 3300013296 Bacteria 3848
76 Ga0157374_10069197 3300013296 Bacteria 3323
77 Ga0157374_10081419 3300013296 Unclassified 3072
78 Ga0157378_10020897 3300013297 Bacteria 5758
79 Ga0157378_10034366 3300013297 Bacteria 4484
80 Ga0157372_10000111 3300013307 Bacteria 86033
81 Ga0157372_10005629 3300013307 Bacteria 13320
82 Ga0157372_10044381 3300013307 Unclassified 4926
83 Ga0157372_10092812 3300013307 Unclassified 3434
84 Ga0157372_10103380 3300013307 Unclassified 3255
85 Ga0157375_10056491 3300013308 Unclassified 3875
86 Ga0163163_10004659 3300014325 Bacteria 11725
87 Ga0163163_10005808 3300014325 Bacteria 10723
88 Ga0163163_10011525 3300014325 Bacteria 8028
89 Ga0163163_10051134 3300014325 Unclassified 4074
90 Ga0163163_10051751 3300014325 Bacteria 4049
91 Ga0157379_10003870 3300014968 Bacteria 12760
92 Ga0206352_10713486 3300020078 Unclassified 4364
93 Ga0213872_10004715 3300021361 Bacteria 7160
94 Ga0224712_10008155 3300022467 Unclassified 3087
95 Ga0207710_10008433 3300025900 Unclassified 4345
96 Ga0207699_10006835 3300025906 Bacteria 5548
97 Ga0207684_10018657 3300025910 Bacteria 5939
98 Ga0207654_10007179 3300025911 Bacteria 5612
99 Ga0207654_10011811 3300025911 Unclassified 4461
100 Ga0207654_10017828 3300025911 Bacteria 3719
101 Ga0207707_10025704 3300025912 Bacteria 5150
102 Ga0207695_10000028 3300025913 Bacteria 551835
103 Ga0207695_10001044 3300025913 Bacteria 48722
104 Ga0207695_10003019 3300025913 Bacteria 24176
105 Ga0207695_10010410 3300025913 Bacteria 11379
106 Ga0207695_10020942 3300025913 Bacteria 7473
107 Ga0207695_10076758 3300025913 Unclassified 3395
108 Ga0207671_10032339 3300025914 Unclassified 3895
109 Ga0207693_10000453 3300025915 Bacteria 37587
110 Ga0207693_10006092 3300025915 Bacteria 9989
111 Ga0207693_10022265 3300025915 Bacteria 5036
112 Ga0207663_10015281 3300025916 Archaea 4232
113 Ga0207660_10005724 3300025917 Bacteria 8064
114 Ga0207652_10009815 3300025921 Bacteria 7705
115 Ga0207652_10030018 3300025921 Bacteria 4550
116 Ga0207646_10002209 3300025922 Bacteria 23174
117 Ga0207694_10001131 3300025924 Bacteria 23075
118 Ga0207694_10003640 3300025924 Bacteria 12203
119 Ga0207694_10011309 3300025924 Bacteria 6737
120 Ga0207650_10023265 3300025925 Unclassified 4392
121 Ga0207700_10006582 3300025928 Bacteria 7036
122 Ga0207700_10010184 3300025928 Bacteria 5916
123 Ga0207665_10013348 3300025939 Bacteria 5400
124 Ga0207689_10009212 3300025942 Bacteria 8539
125 Ga0207667_10008478 3300025949 Bacteria 12207
126 Ga0207667_10030044 3300025949 Bacteria 5883
127 Ga0207667_10062252 3300025949 Unclassified 3902
128 Ga0207658_10008864 3300025986 Bacteria 6826
129 Ga0207639_10004717 3300026041 Bacteria 9181
130 Ga0207639_10005554 3300026041 Bacteria 8526
131 Ga0207702_10023818 3300026078 Bacteria 5079
132 Ga0207641_10000812 3300026088 Bacteria 33288
133 Ga0207641_10008871 3300026088 Bacteria 8303
134 Ga0207641_10044888 3300026088 Bacteria 3718
135 Ga0207674_10010124 3300026116 Bacteria 10721
136 Ga0207698_10000021 3300026142 Bacteria 133280
137 Ga0207698_10008414 3300026142 Bacteria 6525
138 Ga0268264_10019084 3300028381 Bacteria 5606
139 Ga0373926_0001381 3300035083 Bacteria 7343
140 Ga0373923_0000699 3300035111 Bacteria 8566
141 Ga0373945_0000995 3300035116 Bacteria 8462
142 Ga0373943_0004368 3300035170 Bacteria 6408
143 Ga0373924_0000450 3300035410 Bacteria 12637
144 Ga0373935_0007805 3300035692 Bacteria 6413
145 Ga0373927_0000400 3300035695 Bacteria 33593
146 Ga0373927_0005776 3300035695 Bacteria 8494
147 Ga0373947_0013395 3300035725 Bacteria 4699
148 Ga0373925_0019479 3300037068 Bacteria 4936
149 Ga0373925_0020084 3300037068 Unclassified 4861
150 Ga0395905_0022509 3300037471 Bacteria 5961
151 Ga0436364_0088945 3300037853 Bacteria 7056
152 Ga0436361_0849457 3300039447 Bacteria 12881
153 Ga0466963_0029672 3300044694 Bacteria 3523
154 Ga0466957_0002766 3300044842 Bacteria 9497
155 Ga0466959_0013629 3300045049 Bacteria 5897
156 Ga0466967_0005863 3300045976 Bacteria 8597
157 Ga0466967_0026743 3300045976 Unclassified 4786
158 Ga0466967_0045199 3300045976 Unclassified 3825
159 Ga0495651_0008511 3300046462 Bacteria 7860
160 Ga0495652_0056090 3300046529 Unclassified 3348
161 Ga0495665_0021291 3300046531 Bacteria 3483
162 Ga0495669_0002726 3300046684 Bacteria 7240
163 Ga0495675_0004680 3300047444 Bacteria 8313
164 Ga0496105_0002825 3300048908 Bacteria 12699
165 Ga0496110_0002815 3300048913 Bacteria 13130
166 Ga0496112_0006604 3300048915 Bacteria 10209
167 Ga0496112_0012415 3300048915 Bacteria 7831
168 Ga0496112_0034054 3300048915 Bacteria 4956
169 Ga0496112_0035379 3300048915 Bacteria 4865
170 Ga0496113_0001232 3300048916 Bacteria 14076
171 Ga0496115_0002459 3300048918 Bacteria 13306
172 Ga0496115_0009895 3300048918 Bacteria 7101
173 Ga0496126_0007226 3300048929 Bacteria 12216
174 nmdc:mga0n895_14689_c1 3300050512 Bacteria 7121
175 nmdc:mga0n895_45653_c1 3300050512 Unclassified 4276
176 nmdc:mga0n895_83119_c1 3300050512 Unclassified 3193
177 nmdc:mga08x19_11045_c1 3300050514 Bacteria 5435
178 nmdc:mga08x19_2929_c1 3300050514 Bacteria 10262
179 Ga0587084_000408 3300059477 Bacteria 3302
180 Ga0587084_000454 3300059477 Unclassified 3213
181 Ga0587070_000471 3300059491 Unclassified 3356
182 Ga0587077_000329 3300059493 Bacteria 3743
183 Ga0587086_000294 3300059507 Bacteria 3312
184 Ga0587091_000515 3300059511 Bacteria 3386
185 Ga0587091_000614 3300059511 Bacteria 3250
186 Ga0587094_000341 3300059513 Bacteria 3379
187 Ga0587095_000095 3300059514 Bacteria 3387
188 Ga0587095_000113 3300059514 Bacteria 3258
189 Ga0587106_000205 3300059605 Bacteria 3457
190 Ga0587101_000350 3300059623 Unclassified 3087
191 Ga0587067_000503 3300059640 Bacteria 3460
192 Ga0587069_000332 3300059642 Unclassified 3381
193 Ga0587075_000316 3300059644 Bacteria 3539
194 Ga0587075_000400 3300059644 Unclassified 3352
195 Ga0587078_000391 3300059646 Unclassified 3201
196 Ga0587079_000489 3300059647 Bacteria 3544
197 Ga0587079_000614 3300059647 Bacteria 3356
198 Ga0587079_000715 3300059647 Unclassified 3231
199 Ga0587100_000105 3300059648 Bacteria 3158
200 Ga0587107_000168 3300059652 Bacteria 3543
201 Ga0587071_000843 3300060344 Bacteria 3458

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_2929_c1 nmdc:mga08x19_2929_c1_7765_10239 789
2 3300046684 Ga0495669_0002726 Ga0495669_0002726_4698_7208 827
3 3300059623 Ga0587101_000350 Ga0587101_000350_66_2681 857
4 3300046529 Ga0495652_0056090 Ga0495652_0056090_34_2799 889
5 3300013296 Ga0157374_10081419 Ga0157374_100814191 895
6 3300009545 Ga0105237_10067856 Ga0105237_100678562 911
7 3300037068 Ga0373925_0019479 Ga0373925_0019479_2106_4919 917
8 3300048929 Ga0496126_0007226 Ga0496126_0007226_4084_7290 935
9 3300048918 Ga0496115_0002459 Ga0496115_0002459_6469_9465 941
10 3300048915 Ga0496112_0012415 Ga0496112_0012415_801_3683 942
11 3300005983 Ga0081540_1002911 Ga0081540_10029116 954
12 3300005331 Ga0070670_100033486 Ga0070670_1000334862 956
13 3300005338 Ga0068868_100028248 Ga0068868_1000282481 956
14 3300005367 Ga0070667_100011836 Ga0070667_1000118363 956
15 3300005535 Ga0070684_100004720 Ga0070684_1000047207 956
16 3300005577 Ga0068857_100013615 Ga0068857_1000136154 956
17 3300005614 Ga0068856_100020642 Ga0068856_1000206423 956
18 3300005841 Ga0068863_100011598 Ga0068863_1000115981 956
19 3300005843 Ga0068860_100034690 Ga0068860_1000346901 956
20 3300006358 Ga0068871_100035582 Ga0068871_1000355822 956
21 3300009174 Ga0105241_10008796 Ga0105241_100087964 956
22 3300009177 Ga0105248_10007728 Ga0105248_100077284 956
23 3300009551 Ga0105238_10025496 Ga0105238_100254963 956
24 3300010375 Ga0105239_10050858 Ga0105239_100508581 956
25 3300011119 Ga0105246_10021970 Ga0105246_100219701 956
26 3300013297 Ga0157378_10020897 Ga0157378_100208971 956
27 3300013308 Ga0157375_10056491 Ga0157375_100564911 956
28 3300014325 Ga0163163_10051134 Ga0163163_100511341 956
29 3300025900 Ga0207710_10008433 Ga0207710_100084331 956
30 3300025911 Ga0207654_10011811 Ga0207654_100118111 956
31 3300025913 Ga0207695_10020942 Ga0207695_100209424 956
32 3300025924 Ga0207694_10011309 Ga0207694_100113093 956
33 3300025925 Ga0207650_10023265 Ga0207650_100232651 956
34 3300025942 Ga0207689_10009212 Ga0207689_100092122 956
35 3300025986 Ga0207658_10008864 Ga0207658_100088643 956
36 3300026078 Ga0207702_10023818 Ga0207702_100238182 956
37 3300026088 Ga0207641_10008871 Ga0207641_100088713 956
38 3300026116 Ga0207674_10010124 Ga0207674_100101245 956
39 3300028381 Ga0268264_10019084 Ga0268264_100190843 956
40 3300005439 Ga0070711_100024253 Ga0070711_1000242532 957
41 3300013296 Ga0157374_10051017 Ga0157374_100510172 958
42 3300014325 Ga0163163_10011525 Ga0163163_100115252 958
43 3300046462 Ga0495651_0008511 Ga0495651_0008511_3904_6891 962
44 3300009093 Ga0105240_10033015 Ga0105240_100330155 963
45 3300013297 Ga0157378_10034366 Ga0157378_100343662 964
46 3300005434 Ga0070709_10003386 Ga0070709_100033862 966
47 3300013296 Ga0157374_10069197 Ga0157374_100691971 966
48 3300025939 Ga0207665_10013348 Ga0207665_100133482 966
49 3300059644 Ga0587075_000400 Ga0587075_000400_20_3106 967
50 3300005539 Ga0068853_100005886 Ga0068853_1000058862 968
51 3300005616 Ga0068852_100043111 Ga0068852_1000431112 968
52 3300009093 Ga0105240_10104690 Ga0105240_101046901 968
53 3300009174 Ga0105241_10032733 Ga0105241_100327331 968
54 3300009545 Ga0105237_10060592 Ga0105237_100605921 968
55 3300009551 Ga0105238_10028256 Ga0105238_100282563 968
56 3300010375 Ga0105239_10004157 Ga0105239_1000415712 968
57 3300013105 Ga0157369_10067196 Ga0157369_100671961 968
58 3300013307 Ga0157372_10092812 Ga0157372_100928121 968
59 3300025911 Ga0207654_10007179 Ga0207654_100071792 968
60 3300025913 Ga0207695_10076758 Ga0207695_100767581 968
61 3300025914 Ga0207671_10032339 Ga0207671_100323392 968
62 3300025924 Ga0207694_10001131 Ga0207694_100011312 968
63 3300025949 Ga0207667_10062252 Ga0207667_100622522 968
64 3300026041 Ga0207639_10004717 Ga0207639_100047171 968
65 3300026142 Ga0207698_10008414 Ga0207698_100084143 968
66 3300035695 Ga0373927_0000400 Ga0373927_0000400_16657_19710 968
67 3300037853 Ga0436364_0088945 Ga0436364_0088945_1232_4315 970
68 3300059647 Ga0587079_000715 Ga0587079_000715_156_3212 972
69 3300005535 Ga0070684_100023569 Ga0070684_1000235692 973
70 3300005563 Ga0068855_100010399 Ga0068855_1000103997 973
71 3300005616 Ga0068852_100000027 Ga0068852_10000002734 973
72 3300009093 Ga0105240_10000222 Ga0105240_1000022233 973
73 3300013104 Ga0157370_10000012 Ga0157370_10000012170 973
74 3300013105 Ga0157369_10000112 Ga0157369_1000011234 973
75 3300013307 Ga0157372_10000111 Ga0157372_1000011173 973
76 3300014325 Ga0163163_10051751 Ga0163163_100517512 973
77 3300025913 Ga0207695_10000028 Ga0207695_10000028185 973
78 3300025949 Ga0207667_10008478 Ga0207667_100084788 973
79 3300026142 Ga0207698_10000021 Ga0207698_1000002190 973
80 3300006358 Ga0068871_100024078 Ga0068871_1000240782 974
81 3300010375 Ga0105239_10002686 Ga0105239_1000268612 974
82 3300013296 Ga0157374_10042346 Ga0157374_100423462 974
83 3300025913 Ga0207695_10001044 Ga0207695_100010448 974
84 3300025924 Ga0207694_10003640 Ga0207694_100036405 974
85 3300037471 Ga0395905_0022509 Ga0395905_0022509_616_3651 974
86 3300005530 Ga0070679_100063475 Ga0070679_1000634751 975
87 3300009093 Ga0105240_10104689 Ga0105240_101046891 975
88 3300009545 Ga0105237_10084231 Ga0105237_100842311 975
89 3300009551 Ga0105238_10054927 Ga0105238_100549273 975
90 3300013307 Ga0157372_10103380 Ga0157372_101033801 975
91 3300005563 Ga0068855_100031032 Ga0068855_1000310323 981
92 3300009093 Ga0105240_10013982 Ga0105240_100139824 981
93 3300013105 Ga0157369_10007463 Ga0157369_1000746311 981
94 3300013307 Ga0157372_10005629 Ga0157372_100056293 981
95 3300025913 Ga0207695_10010410 Ga0207695_100104103 981
96 3300004799 Ga0058863_10169089 Ga0058863_101690891 983
97 3300005336 Ga0070680_100034732 Ga0070680_1000347323 983
98 3300005471 Ga0070698_100002721 Ga0070698_1000027215 983
99 3300025917 Ga0207660_10005724 Ga0207660_100057241 983
100 3300025921 Ga0207652_10009815 Ga0207652_100098154 983
101 3300059477 Ga0587084_000454 Ga0587084_000454_20_3109 983
102 3300059491 Ga0587070_000471 Ga0587070_000471_25_3114 983
103 3300059513 Ga0587094_000341 Ga0587094_000341_274_3363 983
104 3300059642 Ga0587069_000332 Ga0587069_000332_17_3106 983
105 3300059646 Ga0587078_000391 Ga0587078_000391_94_3183 983
106 3300059648 Ga0587100_000105 Ga0587100_000105_57_3146 986
107 3300005841 Ga0068863_100000571 Ga0068863_10000057115 987
108 3300005842 Ga0068858_100023117 Ga0068858_1000231172 987
109 3300009177 Ga0105248_10074008 Ga0105248_100740082 987
110 3300014968 Ga0157379_10003870 Ga0157379_100038704 987
111 3300026088 Ga0207641_10000812 Ga0207641_100008128 987
112 3300050512 nmdc:mga0n895_45653_c1 nmdc:mga0n895_45653_c1_314_3397 987
113 3300014325 Ga0163163_10005808 Ga0163163_100058081 988
114 3300047444 Ga0495675_0004680 Ga0495675_0004680_4339_7449 988
115 3300009093 Ga0105240_10002024 Ga0105240_1000202420 991
116 3300025913 Ga0207695_10003019 Ga0207695_1000301915 991
117 3300045976 Ga0466967_0026743 Ga0466967_0026743_533_3622 993
118 3300050512 nmdc:mga0n895_83119_c1 nmdc:mga0n895_83119_c1_89_3163 993
119 3300009177 Ga0105248_10088576 Ga0105248_100885761 994
120 3300009098 Ga0105245_10011607 Ga0105245_100116073 995
121 3300009174 Ga0105241_10035264 Ga0105241_100352641 995
122 3300025911 Ga0207654_10017828 Ga0207654_100178281 995
123 3300045976 Ga0466967_0045199 Ga0466967_0045199_28_3156 996
124 3300005467 Ga0070706_100018917 Ga0070706_1000189172 997
125 3300005468 Ga0070707_100002268 Ga0070707_1000022688 997
126 3300005536 Ga0070697_100013667 Ga0070697_1000136672 997
127 3300006175 Ga0070712_100002847 Ga0070712_1000028477 997
128 3300025910 Ga0207684_10018657 Ga0207684_100186572 997
129 3300025915 Ga0207693_10006092 Ga0207693_1000609211 997
130 3300025922 Ga0207646_10002209 Ga0207646_1000220910 997
131 3300004800 Ga0058861_10093327 Ga0058861_100933272 1000
132 3300005458 Ga0070681_10064077 Ga0070681_100640772 1000
133 3300009093 Ga0105240_10074355 Ga0105240_100743552 1000
134 3300013307 Ga0157372_10044381 Ga0157372_100443812 1000
135 3300020078 Ga0206352_10713486 Ga0206352_107134862 1000
136 3300022467 Ga0224712_10008155 Ga0224712_100081551 1000
137 3300009174 Ga0105241_10011740 Ga0105241_100117401 1001
138 3300025949 Ga0207667_10030044 Ga0207667_100300442 1001
139 3300045976 Ga0466967_0005863 Ga0466967_0005863_4893_7979 1001
140 3300006914 Ga0075436_100004852 Ga0075436_1000048525 1002
141 3300044694 Ga0466963_0029672 Ga0466963_0029672_358_3510 1004
142 3300048918 Ga0496115_0009895 Ga0496115_0009895_3192_6512 1005
143 3300021361 Ga0213872_10004715 Ga0213872_100047153 1006
144 3300039447 Ga0436361_0849457 Ga0436361_0849457_3733_6795 1006
145 3300005618 Ga0068864_100004276 Ga0068864_1000042769 1007
146 3300006871 Ga0075434_100000242 Ga0075434_10000024237 1007
147 3300026088 Ga0207641_10044888 Ga0207641_100448881 1007
148 3300048915 Ga0496112_0006604 Ga0496112_0006604_3565_6624 1007
149 3300050512 nmdc:mga0n895_14689_c1 nmdc:mga0n895_14689_c1_267_3425 1007
150 3300013105 Ga0157369_10017186 Ga0157369_100171863 1008
151 3300035725 Ga0373947_0013395 Ga0373947_0013395_26_3106 1009
152 3300035111 Ga0373923_0000699 Ga0373923_0000699_4282_7380 1010
153 3300035116 Ga0373945_0000995 Ga0373945_0000995_505_3603 1010
154 3300035410 Ga0373924_0000450 Ga0373924_0000450_6098_9196 1010
155 3300046531 Ga0495665_0021291 Ga0495665_0021291_65_3163 1010
156 3300048916 Ga0496113_0001232 Ga0496113_0001232_10808_13906 1010
157 3300005435 Ga0070714_100017959 Ga0070714_1000179594 1012
158 3300005436 Ga0070713_100025344 Ga0070713_1000253442 1012
159 3300006028 Ga0070717_10020434 Ga0070717_100204343 1012
160 3300059514 Ga0587095_000113 Ga0587095_000113_18_3134 1015
161 3300005618 Ga0068864_100004276 Ga0068864_1000042767 1017
162 3300014325 Ga0163163_10004659 Ga0163163_100046592 1017
163 3300035083 Ga0373926_0001381 Ga0373926_0001381_3062_6175 1020
164 3300035170 Ga0373943_0004368 Ga0373943_0004368_2201_5314 1020
165 3300035692 Ga0373935_0007805 Ga0373935_0007805_360_3473 1020
166 3300035695 Ga0373927_0005776 Ga0373927_0005776_1168_4281 1020
167 3300037068 Ga0373925_0020084 Ga0373925_0020084_672_3785 1020
168 3300005434 Ga0070709_10004316 Ga0070709_100043163 1022
169 3300045049 Ga0466959_0013629 Ga0466959_0013629_2702_5860 1025
170 3300048908 Ga0496105_0002825 Ga0496105_0002825_8798_11905 1025
171 3300059477 Ga0587084_000408 Ga0587084_000408_137_3292 1025
172 3300059493 Ga0587077_000329 Ga0587077_000329_81_3452 1025
173 3300059507 Ga0587086_000294 Ga0587086_000294_147_3302 1025
174 3300059511 Ga0587091_000515 Ga0587091_000515_18_3173 1025
175 3300059511 Ga0587091_000614 Ga0587091_000614_25_3141 1025
176 3300059514 Ga0587095_000095 Ga0587095_000095_215_3370 1025
177 3300059605 Ga0587106_000205 Ga0587106_000205_292_3447 1025
178 3300059640 Ga0587067_000503 Ga0587067_000503_15_3170 1025
179 3300059644 Ga0587075_000316 Ga0587075_000316_211_3327 1025
180 3300059647 Ga0587079_000489 Ga0587079_000489_99_3254 1025
181 3300059647 Ga0587079_000614 Ga0587079_000614_16_3132 1025
182 3300059652 Ga0587107_000168 Ga0587107_000168_97_3252 1025
183 3300060344 Ga0587071_000843 Ga0587071_000843_288_3443 1025
184 3300025928 Ga0207700_10006582 Ga0207700_100065826 1026
185 3300050514 nmdc:mga08x19_11045_c1 nmdc:mga08x19_11045_c1_1742_4879 1029
186 3300005539 Ga0068853_100006248 Ga0068853_1000062482 1030
187 3300026041 Ga0207639_10005554 Ga0207639_100055547 1030
188 3300006175 Ga0070712_100025569 Ga0070712_1000255692 1031
189 3300025906 Ga0207699_10006835 Ga0207699_100068352 1031
190 3300025915 Ga0207693_10000453 Ga0207693_1000045330 1031
191 3300025928 Ga0207700_10010184 Ga0207700_100101841 1031
192 3300005535 Ga0070684_100024336 Ga0070684_1000243363 1032
193 3300025915 Ga0207693_10022265 Ga0207693_100222654 1032
194 3300025916 Ga0207663_10015281 Ga0207663_100152812 1032
195 3300048915 Ga0496112_0034054 Ga0496112_0034054_264_3536 1032
196 3300044842 Ga0466957_0002766 Ga0466957_0002766_4884_8066 1034
197 3300048913 Ga0496110_0002815 Ga0496110_0002815_293_3442 1035
198 3300006914 Ga0075436_100018261 Ga0075436_1000182612 1039
199 3300004799 Ga0058863_10058350 Ga0058863_100583501 1049
200 3300025912 Ga0207707_10025704 Ga0207707_100257043 1049
201 3300025921 Ga0207652_10030018 Ga0207652_100300182 1049
202 3300048915 Ga0496112_0035379 Ga0496112_0035379_602_3751 1049

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

74

154

0.98

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

372

732

0.53

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.9172 33 115
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.8853 33 115
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.8539 28 111
4p0d-assembly1.cif.gz_A the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions 0.808 30 96
2ysu-assembly1.cif.gz_A structure of the complex between btub and colicin e2 receptor binding domain 0.8069 135 1049
ID Description Score Start End Superfamily
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9356 33 115 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9142 33 115 2.60.40.1120
af_E7F254_344_443_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9101 33 116 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8927 33 115 2.60.40.1120
af_F1RAC0_1040_1118_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8877 33 115 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A355UVY8-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9634 29 118
AF-A0A838U5F0-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9363 29 111 GO:0004180
GO:0016020
GO:0030246
AF-A0A2V8PEP7-F1-model_v4 TonB-dependent receptor 0.9325 24 95 GO:0030246
AF-A0A2V9JJX5-F1-model_v4 TonB-dependent receptor 0.9253 24 101 GO:0030246
AF-A0A7J2SRQ5-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9226 25 114 GO:0004180
GO:0030246

Feature Viewer

pLDDT pTM Quality
77.79 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map