F309624

General Info

Members Datasets Scaffolds Average Seq Length
202 154 202 126

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_102572986|Ga0068859_1025729861
Length 126
Sequence MPEEQKHPYATHLDILYPAFSVVDVPPLVAACTDRWYNQTLCKVNESVMRLGVFQPGDYHWHKHDNDDEFFFVLEGRFCVDLEDRVVELRRWEGFTVPKGVVHRTRAPERAVVLMAETAAIVPTGD

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 2.48
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10002438 3300005293 Bacteria 6170
2 Ga0070670_101846090 3300005331 Bacteria 556
3 Ga0070677_10011929 3300005333 Bacteria 3006
4 Ga0068869_100771718 3300005334 Unclassified 824
5 Ga0070680_101214657 3300005336 Bacteria 652
6 Ga0070660_100445672 3300005339 Bacteria 1074
7 Ga0070689_100022328 3300005340 Bacteria 4724
8 Ga0070668_100590538 3300005347 Bacteria 970
9 Ga0070675_100041873 3300005354 Bacteria 3741
10 Ga0070674_100084160 3300005356 Bacteria 2280
11 Ga0070667_100082731 3300005367 Bacteria 2749
12 Ga0070667_101311774 3300005367 Unclassified 678
13 Ga0070703_10446747 3300005406 Bacteria 572
14 Ga0070709_10029003 3300005434 Bacteria 3305
15 Ga0070709_10055215 3300005434 Bacteria 2507
16 Ga0070714_100010582 3300005435 Bacteria 7296
17 Ga0070714_100100055 3300005435 Bacteria 2553
18 Ga0070713_100026485 3300005436 Bacteria 4553
19 Ga0070713_100334342 3300005436 Bacteria 1402
20 Ga0070700_100742201 3300005441 Bacteria 785
21 Ga0070700_100893433 3300005441 Unclassified 723
22 Ga0070700_101316289 3300005441 Bacteria 608
23 Ga0070694_100347576 3300005444 Bacteria 1148
24 Ga0070694_101671901 3300005444 Bacteria 541
25 Ga0070708_102122822 3300005445 Unclassified 519
26 Ga0070663_100061133 3300005455 Bacteria 2712
27 Ga0070662_100049265 3300005457 Bacteria 3037
28 Ga0070681_10018435 3300005458 Bacteria 6976
29 Ga0068867_100281915 3300005459 Bacteria 1363
30 Ga0070706_100009500 3300005467 Bacteria 9047
31 Ga0070706_100110776 3300005467 Bacteria 2555
32 Ga0070707_100000993 3300005468 Bacteria 28056
33 Ga0070707_100025974 3300005468 Bacteria 5558
34 Ga0070698_100051192 3300005471 Bacteria 4207
35 Ga0070699_100034322 3300005518 Bacteria 4384
36 Ga0070699_100218576 3300005518 Bacteria 1698
37 Ga0070699_100399242 3300005518 Bacteria 1243
38 Ga0070697_100160758 3300005536 Bacteria 1897
39 Ga0070697_100706572 3300005536 Unclassified 890
40 Ga0070672_100037477 3300005543 Bacteria 3700
41 Ga0070695_100024151 3300005545 Bacteria 3742
42 Ga0070695_100316663 3300005545 Unclassified 1158
43 Ga0070665_100927830 3300005548 Bacteria 883
44 Ga0070704_100404251 3300005549 Bacteria 1166
45 Ga0070704_101785112 3300005549 Bacteria 569
46 Ga0068857_100448206 3300005577 Bacteria 1206
47 Ga0068856_100027389 3300005614 Bacteria 5560
48 Ga0068859_100009324 3300005617 Bacteria 9907
49 Ga0068859_102572986 3300005617 Unclassified 560
50 Ga0068864_100016061 3300005618 Bacteria 6229
51 Ga0068866_10608184 3300005718 Unclassified 739
52 Ga0068861_100232243 3300005719 Unclassified 1565
53 Ga0068858_100022174 3300005842 Bacteria 5930
54 Ga0068860_100122049 3300005843 Bacteria 2496
55 Ga0068860_101205727 3300005843 Unclassified 777
56 Ga0068862_100581873 3300005844 Bacteria 1072
57 Ga0075364_10314821 3300006051 Bacteria 1066
58 Ga0070715_10125888 3300006163 Bacteria 1227
59 Ga0070712_100085267 3300006175 Bacteria 2299
60 Ga0075428_100002009 3300006844 Bacteria 21936
61 Ga0075428_100350804 3300006844 Bacteria 1584
62 Ga0075430_100002837 3300006846 Bacteria 14495
63 Ga0075430_100115054 3300006846 Bacteria 2241
64 Ga0075431_100000454 3300006847 Bacteria 33687
65 Ga0075431_100008218 3300006847 Bacteria 10430
66 Ga0075434_100730670 3300006871 Unclassified 1007
67 Ga0075434_101146717 3300006871 Unclassified 790
68 Ga0075429_100000220 3300006880 Bacteria 38587
69 Ga0075429_100002281 3300006880 Bacteria 16088
70 Ga0068865_100092991 3300006881 Bacteria 2192
71 Ga0075436_100076957 3300006914 Bacteria 2311
72 Ga0097620_100009323 3300006931 Bacteria 9907
73 Ga0097620_102573537 3300006931 Unclassified 560
74 Ga0099794_10121022 3300007265 Bacteria 1317
75 Ga0105244_10451550 3300009036 Bacteria 591
76 Ga0105245_11813217 3300009098 Bacteria 663
77 Ga0105247_10811488 3300009101 Bacteria 715
78 Ga0114129_10000065 3300009147 Bacteria 94355
79 Ga0114129_10022409 3300009147 Bacteria 8967
80 Ga0105243_10681666 3300009148 Bacteria 1000
81 Ga0105243_12285376 3300009148 Bacteria 578
82 Ga0105248_10006364 3300009177 Bacteria 12954
83 Ga0105249_10449866 3300009553 Bacteria 1326
84 Ga0157374_11191280 3300013296 Bacteria 783
85 Ga0163162_10691722 3300013306 Bacteria 1142
86 Ga0163162_11184417 3300013306 Bacteria 867
87 Ga0163163_10175472 3300014325 Bacteria 2189
88 Ga0163163_10860894 3300014325 Unclassified 970
89 Ga0157379_10001314 3300014968 Bacteria 20283
90 Ga0157379_11168172 3300014968 Bacteria 739
91 Ga0163161_10249461 3300017792 Bacteria 1383
92 Ga0213874_10035431 3300021377 Unclassified 1466
93 Ga0213876_10224916 3300021384 Unclassified 998
94 Ga0213871_10083793 3300021441 Unclassified 917
95 Ga0207697_10008356 3300025315 Bacteria 4533
96 Ga0207682_10008008 3300025893 Bacteria 4197
97 Ga0207710_10077422 3300025900 Bacteria 1536
98 Ga0207699_10083198 3300025906 Bacteria 1990
99 Ga0207645_10021947 3300025907 Bacteria 4159
100 Ga0207643_10021708 3300025908 Bacteria 3531
101 Ga0207684_10015300 3300025910 Bacteria 6606
102 Ga0207684_10019261 3300025910 Bacteria 5839
103 Ga0207707_10008136 3300025912 Bacteria 9106
104 Ga0207707_10364908 3300025912 Bacteria 1243
105 Ga0207695_10324254 3300025913 Bacteria 1429
106 Ga0207693_10131063 3300025915 Bacteria 1971
107 Ga0207663_10444037 3300025916 Bacteria 999
108 Ga0207660_11558312 3300025917 Bacteria 533
109 Ga0207652_10089573 3300025921 Bacteria 2702
110 Ga0207646_10006315 3300025922 Bacteria 12284
111 Ga0207646_10031579 3300025922 Bacteria 4795
112 Ga0207646_10944009 3300025922 Unclassified 764
113 Ga0207681_10601153 3300025923 Bacteria 909
114 Ga0207650_10749630 3300025925 Bacteria 826
115 Ga0207659_10409084 3300025926 Bacteria 1136
116 Ga0207700_10086970 3300025928 Bacteria 2457
117 Ga0207664_10111087 3300025929 Bacteria 2280
118 Ga0207706_10055731 3300025933 Bacteria 3485
119 Ga0207670_10026602 3300025936 Bacteria 3648
120 Ga0207704_10139954 3300025938 Bacteria 1691
121 Ga0207691_10006004 3300025940 Bacteria 11726
122 Ga0207691_10802263 3300025940 Unclassified 791
123 Ga0207689_10195811 3300025942 Bacteria 1668
124 Ga0207679_10837627 3300025945 Bacteria 840
125 Ga0207667_10025217 3300025949 Bacteria 6512
126 Ga0207651_10137151 3300025960 Unclassified 1884
127 Ga0207668_10527757 3300025972 Bacteria 1019
128 Ga0207658_11105894 3300025986 Unclassified 724
129 Ga0207703_10002311 3300026035 Bacteria 16637
130 Ga0207678_10102584 3300026067 Bacteria 2442
131 Ga0207708_10047976 3300026075 Bacteria 3250
132 Ga0207708_11341743 3300026075 Bacteria 627
133 Ga0207702_10291961 3300026078 Bacteria 1545
134 Ga0207702_11910078 3300026078 Unclassified 585
135 Ga0207641_12060216 3300026088 Bacteria 572
136 Ga0207648_10029450 3300026089 Bacteria 4869
137 Ga0207674_11140576 3300026116 Unclassified 749
138 Ga0207675_100098418 3300026118 Bacteria 2755
139 Ga0207683_10081462 3300026121 Bacteria 2873
140 Ga0207698_10807887 3300026142 Bacteria 940
141 Ga0207428_11249646 3300027907 Bacteria 516
142 Ga0265357_1015966 3300028023 Bacteria 797
143 Ga0268266_10155579 3300028379 Bacteria 2064
144 Ga0268264_10322050 3300028381 Bacteria 1462
145 Ga0265320_10112763 3300031240 Unclassified 1244
146 Ga0265331_10247781 3300031250 Unclassified 799
147 Ga0265313_10007219 3300031595 Bacteria 7646
148 Ga0373945_0171175 3300035116 Unclassified 890
149 Ga0373935_0101205 3300035692 Bacteria 1900
150 Ga0373935_0113931 3300035692 Bacteria 1798
151 Ga0373927_0000926 3300035695 Bacteria 22228
152 Ga0373947_0876397 3300035725 Bacteria 613
153 Ga0373937_0730190 3300036401 Unclassified 937
154 Ga0373925_0068987 3300037068 Bacteria 2670
155 Ga0436365_0808797 3300039437 Unclassified 1151
156 Ga0436360_0148430 3300039438 Bacteria 2625
157 Ga0436360_0533324 3300039438 Unclassified 522
158 Ga0436360_0658954 3300039438 Bacteria 1169
159 Ga0436361_0698480 3300039447 Bacteria 1408
160 Ga0436363_0573331 3300039450 Bacteria 12447
161 Ga0436363_0682470 3300039450 Unclassified 756
162 Ga0436362_0054279 3300039453 Bacteria 2257
163 Ga0436362_0760125 3300039453 Unclassified 607
164 Ga0436362_1211449 3300039453 Bacteria 1506
165 Ga0451807_0159791 3300041486 Bacteria 2563
166 Ga0439462_0128234 3300042015 Bacteria 707
167 Ga0450913_002562 3300042117 Bacteria 1127
168 Ga0466958_0255293 3300045836 Unclassified 1122
169 Ga0495580_0764874 3300046472 Bacteria 628
170 Ga0495582_0647740 3300046473 Bacteria 611
171 Ga0495642_0040876 3300046528 Bacteria 1885
172 Ga0495621_0146560 3300046539 Bacteria 926
173 Ga0495659_0444541 3300046664 Bacteria 564
174 Ga0496101_0576090 3300048904 Bacteria 890
175 Ga0496102_0240427 3300048905 Bacteria 1707
176 Ga0496109_0605678 3300048912 Bacteria 1032
177 Ga0496112_0230017 3300048915 Bacteria 1809
178 Ga0501034_1301264 3300049571 Bacteria 604
179 Ga0501038_0080849 3300049574 Bacteria 2739
180 Ga0501039_0048585 3300049575 Bacteria 3280
181 Ga0501040_0106507 3300049576 Bacteria 1959
182 Ga0501041_0038697 3300049577 Bacteria 2892
183 Ga0501043_0570821 3300049579 Bacteria 838
184 Ga0501046_0471487 3300049580 Bacteria 901
185 Ga0501048_0082262 3300049582 Bacteria 2271
186 Ga0501045_0062240 3300049824 Bacteria 2738
187 nmdc:mga0k408_645158_c1 3300050493 Unclassified 623
188 nmdc:mga0k408_77346_c1 3300050493 Bacteria 1946
189 nmdc:mga0k408_933165_c1 3300050493 Archaea 503
190 nmdc:mga05p37_3522_c1 3300050507 Bacteria 18284
191 nmdc:mga05p37_431_c1 3300050507 Bacteria 45404
192 nmdc:mga09592_229_c1 3300050508 Bacteria 40458
193 nmdc:mga09592_2638_c1 3300050508 Bacteria 14500
194 nmdc:mga0qj67_23055_c1 3300050509 Bacteria 4785
195 nmdc:mga0qj67_37342_c1 3300050509 Bacteria 3804
196 nmdc:mga06r32_14314_c1 3300050510 Bacteria 7196
197 nmdc:mga06r32_1559_c1 3300050510 Bacteria 20685
198 nmdc:mga06r32_7293_c1 3300050510 Bacteria 9956
199 nmdc:mga0rr50_1053462_c1 3300050513 Unclassified 692
200 Ga0495612_0074207 3300053078 Bacteria 1422
201 Ga0495612_0439418 3300053078 Unclassified 595
202 Ga0500556_0000540 3300053104 Bacteria 25527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100350804 Ga0075428_1003508042 121
2 3300006846 Ga0075430_100002837 Ga0075430_1000028378 121
3 3300050509 nmdc:mga0qj67_23055_c1 nmdc:mga0qj67_23055_c1_806_1171 121
4 3300050510 nmdc:mga06r32_14314_c1 nmdc:mga06r32_14314_c1_3326_3691 121
5 3300005340 Ga0070689_100022328 Ga0070689_1000223284 122
6 3300005444 Ga0070694_100347576 Ga0070694_1003475761 122
7 3300005545 Ga0070695_100316663 Ga0070695_1003166631 122
8 3300005549 Ga0070704_100404251 Ga0070704_1004042512 122
9 3300005549 Ga0070704_101785112 Ga0070704_1017851121 122
10 3300005617 Ga0068859_100009324 Ga0068859_1000093242 122
11 3300005842 Ga0068858_100022174 Ga0068858_1000221742 122
12 3300006847 Ga0075431_100008218 Ga0075431_1000082188 122
13 3300006871 Ga0075434_100730670 Ga0075434_1007306702 122
14 3300006880 Ga0075429_100000220 Ga0075429_10000022025 122
15 3300006931 Ga0097620_100009323 Ga0097620_1000093232 122
16 3300009101 Ga0105247_10811488 Ga0105247_108114882 122
17 3300009147 Ga0114129_10022409 Ga0114129_1002240911 122
18 3300009148 Ga0105243_12285376 Ga0105243_122853762 122
19 3300009177 Ga0105248_10006364 Ga0105248_100063647 122
20 3300014968 Ga0157379_10001314 Ga0157379_100013148 122
21 3300014968 Ga0157379_11168172 Ga0157379_111681722 122
22 3300025900 Ga0207710_10077422 Ga0207710_100774222 122
23 3300025936 Ga0207670_10026602 Ga0207670_100266022 122
24 3300026035 Ga0207703_10002311 Ga0207703_100023117 122
25 3300042117 Ga0450913_002562 Ga0450913_002562_355_723 122
26 3300049571 Ga0501034_1301264 Ga0501034_1301264_200_568 122
27 3300049574 Ga0501038_0080849 Ga0501038_0080849_881_1249 122
28 3300049575 Ga0501039_0048585 Ga0501039_0048585_1155_1523 122
29 3300049576 Ga0501040_0106507 Ga0501040_0106507_683_1051 122
30 3300049577 Ga0501041_0038697 Ga0501041_0038697_1492_1860 122
31 3300049579 Ga0501043_0570821 Ga0501043_0570821_454_822 122
32 3300049580 Ga0501046_0471487 Ga0501046_0471487_29_397 122
33 3300049582 Ga0501048_0082262 Ga0501048_0082262_766_1134 122
34 3300049824 Ga0501045_0062240 Ga0501045_0062240_1888_2256 122
35 3300050507 nmdc:mga05p37_431_c1 nmdc:mga05p37_431_c1_16417_16785 122
36 3300050508 nmdc:mga09592_229_c1 nmdc:mga09592_229_c1_22869_23237 122
37 3300050510 nmdc:mga06r32_7293_c1 nmdc:mga06r32_7293_c1_4184_4552 122
38 3300005441 Ga0070700_101316289 Ga0070700_1013162892 123
39 3300005467 Ga0070706_100009500 Ga0070706_1000095001 123
40 3300005468 Ga0070707_100000993 Ga0070707_10000099310 123
41 3300005518 Ga0070699_100218576 Ga0070699_1002185761 123
42 3300005518 Ga0070699_100399242 Ga0070699_1003992422 123
43 3300005536 Ga0070697_100706572 Ga0070697_1007065722 123
44 3300025910 Ga0207684_10019261 Ga0207684_100192612 123
45 3300025912 Ga0207707_10008136 Ga0207707_100081367 123
46 3300025913 Ga0207695_10324254 Ga0207695_103242542 123
47 3300025921 Ga0207652_10089573 Ga0207652_100895732 123
48 3300025922 Ga0207646_10006315 Ga0207646_100063153 123
49 3300025922 Ga0207646_10944009 Ga0207646_109440092 123
50 3300025949 Ga0207667_10025217 Ga0207667_100252175 123
51 3300026075 Ga0207708_11341743 Ga0207708_113417431 123
52 3300026078 Ga0207702_11910078 Ga0207702_119100781 123
53 3300031250 Ga0265331_10247781 Ga0265331_102477813 123
54 3300039438 Ga0436360_0533324 Ga0436360_0533324_56_427 123
55 3300039453 Ga0436362_0760125 Ga0436362_0760125_71_442 123
56 3300045836 Ga0466958_0255293 Ga0466958_0255293_206_577 123
57 3300046528 Ga0495642_0040876 Ga0495642_0040876_606_977 123
58 3300046539 Ga0495621_0146560 Ga0495621_0146560_283_654 123
59 3300046664 Ga0495659_0444541 Ga0495659_0444541_56_427 123
60 3300048915 Ga0496112_0230017 Ga0496112_0230017_1295_1666 123
61 3300050493 nmdc:mga0k408_645158_c1 nmdc:mga0k408_645158_c1_23_394 123
62 3300005467 Ga0070706_100110776 Ga0070706_1001107765 124
63 3300005468 Ga0070707_100025974 Ga0070707_1000259744 124
64 3300005471 Ga0070698_100051192 Ga0070698_1000511921 124
65 3300005536 Ga0070697_100160758 Ga0070697_1001607582 124
66 3300006844 Ga0075428_100002009 Ga0075428_1000020095 124
67 3300006846 Ga0075430_100115054 Ga0075430_1001150543 124
68 3300006847 Ga0075431_100000454 Ga0075431_10000045431 124
69 3300006880 Ga0075429_100002281 Ga0075429_10000228113 124
70 3300009147 Ga0114129_10000065 Ga0114129_1000006565 124
71 3300025910 Ga0207684_10015300 Ga0207684_100153004 124
72 3300025922 Ga0207646_10031579 Ga0207646_100315792 124
73 3300050507 nmdc:mga05p37_3522_c1 nmdc:mga05p37_3522_c1_12211_12585 124
74 3300050508 nmdc:mga09592_2638_c1 nmdc:mga09592_2638_c1_10202_10576 124
75 3300050509 nmdc:mga0qj67_37342_c1 nmdc:mga0qj67_37342_c1_1202_1576 124
76 3300050510 nmdc:mga06r32_1559_c1 nmdc:mga06r32_1559_c1_16021_16395 124
77 3300050513 nmdc:mga0rr50_1053462_c1 nmdc:mga0rr50_1053462_c1_251_640 124
78 3300005334 Ga0068869_100771718 Ga0068869_1007717182 125
79 3300005406 Ga0070703_10446747 Ga0070703_104467471 125
80 3300005436 Ga0070713_100334342 Ga0070713_1003343422 125
81 3300005617 Ga0068859_102572986 Ga0068859_1025729861 125
82 3300005843 Ga0068860_101205727 Ga0068860_1012057272 125
83 3300006914 Ga0075436_100076957 Ga0075436_1000769572 125
84 3300006931 Ga0097620_102573537 Ga0097620_1025735371 125
85 3300021377 Ga0213874_10035431 Ga0213874_100354312 125
86 3300021384 Ga0213876_10224916 Ga0213876_102249162 125
87 3300031240 Ga0265320_10112763 Ga0265320_101127633 125
88 3300031595 Ga0265313_10007219 Ga0265313_100072194 125
89 3300035116 Ga0373945_0171175 Ga0373945_0171175_330_707 125
90 3300035692 Ga0373935_0101205 Ga0373935_0101205_1281_1658 125
91 3300035695 Ga0373927_0000926 Ga0373927_0000926_7824_8201 125
92 3300039437 Ga0436365_0808797 Ga0436365_0808797_436_816 125
93 3300039450 Ga0436363_0573331 Ga0436363_0573331_10195_10575 125
94 3300042015 Ga0439462_0128234 Ga0439462_0128234_65_442 125
95 3300046473 Ga0495582_0647740 Ga0495582_0647740_81_461 125
96 3300048905 Ga0496102_0240427 Ga0496102_0240427_650_1027 125
97 3300053104 Ga0500556_0000540 Ga0500556_0000540_10300_10680 125
98 3300005293 Ga0065715_10002438 Ga0065715_100024387 126
99 3300005331 Ga0070670_101846090 Ga0070670_1018460901 126
100 3300005333 Ga0070677_10011929 Ga0070677_100119294 126
101 3300005336 Ga0070680_101214657 Ga0070680_1012146572 126
102 3300005339 Ga0070660_100445672 Ga0070660_1004456722 126
103 3300005347 Ga0070668_100590538 Ga0070668_1005905382 126
104 3300005354 Ga0070675_100041873 Ga0070675_1000418731 126
105 3300005356 Ga0070674_100084160 Ga0070674_1000841603 126
106 3300005367 Ga0070667_100082731 Ga0070667_1000827313 126
107 3300005367 Ga0070667_101311774 Ga0070667_1013117742 126
108 3300005434 Ga0070709_10029003 Ga0070709_100290032 126
109 3300005434 Ga0070709_10055215 Ga0070709_100552153 126
110 3300005435 Ga0070714_100010582 Ga0070714_1000105825 126
111 3300005435 Ga0070714_100100055 Ga0070714_1001000553 126
112 3300005436 Ga0070713_100026485 Ga0070713_1000264854 126
113 3300005441 Ga0070700_100742201 Ga0070700_1007422011 126
114 3300005441 Ga0070700_100893433 Ga0070700_1008934332 126
115 3300005444 Ga0070694_101671901 Ga0070694_1016719011 126
116 3300005445 Ga0070708_102122822 Ga0070708_1021228221 126
117 3300005455 Ga0070663_100061133 Ga0070663_1000611333 126
118 3300005457 Ga0070662_100049265 Ga0070662_1000492653 126
119 3300005458 Ga0070681_10018435 Ga0070681_100184354 126
120 3300005459 Ga0068867_100281915 Ga0068867_1002819151 126
121 3300005518 Ga0070699_100034322 Ga0070699_1000343224 126
122 3300005543 Ga0070672_100037477 Ga0070672_1000374774 126
123 3300005545 Ga0070695_100024151 Ga0070695_1000241513 126
124 3300005548 Ga0070665_100927830 Ga0070665_1009278302 126
125 3300005577 Ga0068857_100448206 Ga0068857_1004482061 126
126 3300005614 Ga0068856_100027389 Ga0068856_1000273893 126
127 3300005618 Ga0068864_100016061 Ga0068864_1000160618 126
128 3300005718 Ga0068866_10608184 Ga0068866_106081841 126
129 3300005719 Ga0068861_100232243 Ga0068861_1002322433 126
130 3300005843 Ga0068860_100122049 Ga0068860_1001220493 126
131 3300005844 Ga0068862_100581873 Ga0068862_1005818731 126
132 3300006051 Ga0075364_10314821 Ga0075364_103148212 126
133 3300006163 Ga0070715_10125888 Ga0070715_101258883 126
134 3300006175 Ga0070712_100085267 Ga0070712_1000852674 126
135 3300006871 Ga0075434_101146717 Ga0075434_1011467172 126
136 3300006881 Ga0068865_100092991 Ga0068865_1000929913 126
137 3300007265 Ga0099794_10121022 Ga0099794_101210222 126
138 3300009036 Ga0105244_10451550 Ga0105244_104515501 126
139 3300009098 Ga0105245_11813217 Ga0105245_118132172 126
140 3300009148 Ga0105243_10681666 Ga0105243_106816662 126
141 3300009553 Ga0105249_10449866 Ga0105249_104498662 126
142 3300013296 Ga0157374_11191280 Ga0157374_111912802 126
143 3300013306 Ga0163162_10691722 Ga0163162_106917221 126
144 3300013306 Ga0163162_11184417 Ga0163162_111844171 126
145 3300014325 Ga0163163_10175472 Ga0163163_101754723 126
146 3300014325 Ga0163163_10860894 Ga0163163_108608942 126
147 3300017792 Ga0163161_10249461 Ga0163161_102494612 126
148 3300021441 Ga0213871_10083793 Ga0213871_100837932 126
149 3300025315 Ga0207697_10008356 Ga0207697_100083563 126
150 3300025893 Ga0207682_10008008 Ga0207682_100080086 126
151 3300025906 Ga0207699_10083198 Ga0207699_100831983 126
152 3300025907 Ga0207645_10021947 Ga0207645_100219475 126
153 3300025908 Ga0207643_10021708 Ga0207643_100217083 126
154 3300025912 Ga0207707_10364908 Ga0207707_103649082 126
155 3300025915 Ga0207693_10131063 Ga0207693_101310633 126
156 3300025916 Ga0207663_10444037 Ga0207663_104440372 126
157 3300025917 Ga0207660_11558312 Ga0207660_115583121 126
158 3300025923 Ga0207681_10601153 Ga0207681_106011531 126
159 3300025925 Ga0207650_10749630 Ga0207650_107496302 126
160 3300025926 Ga0207659_10409084 Ga0207659_104090843 126
161 3300025928 Ga0207700_10086970 Ga0207700_100869703 126
162 3300025929 Ga0207664_10111087 Ga0207664_101110872 126
163 3300025933 Ga0207706_10055731 Ga0207706_100557314 126
164 3300025938 Ga0207704_10139954 Ga0207704_101399542 126
165 3300025940 Ga0207691_10006004 Ga0207691_1000600410 126
166 3300025940 Ga0207691_10802263 Ga0207691_108022632 126
167 3300025942 Ga0207689_10195811 Ga0207689_101958112 126
168 3300025945 Ga0207679_10837627 Ga0207679_108376271 126
169 3300025960 Ga0207651_10137151 Ga0207651_101371512 126
170 3300025972 Ga0207668_10527757 Ga0207668_105277572 126
171 3300025986 Ga0207658_11105894 Ga0207658_111058942 126
172 3300026067 Ga0207678_10102584 Ga0207678_101025843 126
173 3300026075 Ga0207708_10047976 Ga0207708_100479762 126
174 3300026078 Ga0207702_10291961 Ga0207702_102919612 126
175 3300026088 Ga0207641_12060216 Ga0207641_120602161 126
176 3300026089 Ga0207648_10029450 Ga0207648_100294507 126
177 3300026116 Ga0207674_11140576 Ga0207674_111405762 126
178 3300026118 Ga0207675_100098418 Ga0207675_1000984184 126
179 3300026121 Ga0207683_10081462 Ga0207683_100814621 126
180 3300026142 Ga0207698_10807887 Ga0207698_108078872 126
181 3300027907 Ga0207428_11249646 Ga0207428_112496461 126
182 3300028023 Ga0265357_1015966 Ga0265357_10159662 126
183 3300028379 Ga0268266_10155579 Ga0268266_101555795 126
184 3300028381 Ga0268264_10322050 Ga0268264_103220503 126
185 3300035692 Ga0373935_0113931 Ga0373935_0113931_1344_1724 126
186 3300035725 Ga0373947_0876397 Ga0373947_0876397_124_504 126
187 3300036401 Ga0373937_0730190 Ga0373937_0730190_255_635 126
188 3300037068 Ga0373925_0068987 Ga0373925_0068987_1918_2298 126
189 3300039438 Ga0436360_0148430 Ga0436360_0148430_1472_1852 126
190 3300039438 Ga0436360_0658954 Ga0436360_0658954_302_685 126
191 3300039447 Ga0436361_0698480 Ga0436361_0698480_613_993 126
192 3300039450 Ga0436363_0682470 Ga0436363_0682470_272_652 126
193 3300039453 Ga0436362_0054279 Ga0436362_0054279_897_1277 126
194 3300039453 Ga0436362_1211449 Ga0436362_1211449_133_513 126
195 3300041486 Ga0451807_0159791 Ga0451807_0159791_1066_1446 126
196 3300046472 Ga0495580_0764874 Ga0495580_0764874_160_540 126
197 3300048904 Ga0496101_0576090 Ga0496101_0576090_166_621 126
198 3300048912 Ga0496109_0605678 Ga0496109_0605678_273_728 126
199 3300050493 nmdc:mga0k408_77346_c1 nmdc:mga0k408_77346_c1_184_564 126
200 3300050493 nmdc:mga0k408_933165_c1 nmdc:mga0k408_933165_c1_41_421 126
201 3300053078 Ga0495612_0074207 Ga0495612_0074207_494_874 126
202 3300053078 Ga0495612_0439418 Ga0495612_0439418_155_535 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

50

117

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9537 23 117
4xfh-assembly1.cif.gz_A cysteine dioxygenase variant - y157f at ph 6.2 with cysteine 0.9191 35 118
4ubg-assembly1.cif.gz_A resting state of rat cysteine dioxygenase c93g variant 0.9189 35 118
5ezw-assembly1.cif.gz_A thiosulfate bound rat cysteine dioxygenase y157h variant 0.9185 35 120
4ysf-assembly1.cif.gz_A resting state of rat cysteine dioxygenase h155n variant 0.9183 35 118
ID Description Score Start End Superfamily
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9391 59 117 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9311 21 114 2.60.120.10
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.917 35 120 2.60.120.10
af_Q10LJ3_463_844_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.899 85 117 2.60.120.650
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8977 38 117 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2B3L6T5-F1-model_v4 deleted 0.9934 42 117
AF-A0A7Z7CCP4-F1-model_v4 Cupin domain-containing protein 0.9852 44 122
AF-A0A434AYR3-F1-model_v4 Cupin domain-containing protein 0.9833 7 125
AF-A0A256Z3T5-F1-model_v4 Cupin 0.9783 19 125
AF-A0A117SJV9-F1-model_v4 Cupin 0.9771 9 125

Feature Viewer

pLDDT pTM Quality
89.66 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map