F309599

General Info

Members Datasets Scaffolds Average Seq Length
202 138 404 117

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100078395|Ga0068855_1000783954
Length 126
Sequence VSGGLILIPVLNRSQDLDRLFHALADPARRAILERLGRGPAPVSELAKPLPMSLPAAMQHLGVLEAAGLIRTRKAGRTRACAIEPQAMSRAEQWISARRREWEGRLDRLDDYLKTLERGGDDRGSK

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
13 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
14 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
15 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
24 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
49 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
54 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
55 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
57 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
58 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
59 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
128 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
129 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
130 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
131 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
134 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
137 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
138 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0.99
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0
Rhizoplane 1.98
Rhizosphere 82.67
Stem 0
Stem Tuber 0
Unclassified 16.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100078395 3300005563 Bacteria 3833
2 Ga0070680_100111250 3300005336 Bacteria 2280
3 Ga0070714_100481322 3300005435 Unclassified 1182
4 Ga0070714_100561302 3300005435 Unclassified 1094
5 Ga0070713_100028247 3300005436 Bacteria 4428
6 Ga0070713_100381180 3300005436 Bacteria 1314
7 Ga0070708_100476000 3300005445 Bacteria 1178
8 Ga0070708_100899371 3300005445 Bacteria 831
9 Ga0070706_100107480 3300005467 Bacteria 2596
10 Ga0070698_100590372 3300005471 Bacteria 1051
11 Ga0070697_101115657 3300005536 Bacteria 702
12 Ga0081455_10012921 3300005937 Bacteria 8283
13 Ga0081455_10322109 3300005937 Bacteria 1100
14 Ga0081455_10363131 3300005937 Bacteria 1017
15 Ga0081538_10046115 3300005981 Bacteria 2693
16 Ga0070717_10141149 3300006028 Bacteria 2078
17 Ga0070717_10538915 3300006028 Bacteria 1056
18 Ga0070716_100173299 3300006173 Bacteria 1410
19 Ga0070716_101695587 3300006173 Bacteria 521
20 Ga0075433_11190628 3300006852 Unclassified 661
21 Ga0075436_100010792 3300006914 Bacteria 6267
22 Ga0099794_10004300 3300007265 Bacteria 5570
23 Ga0105240_10024386 3300009093 Bacteria 7973
24 Ga0105240_11689035 3300009093 Bacteria 661
25 Ga0105237_10250791 3300009545 Bacteria 1772
26 Ga0099796_10191628 3300010159 Unclassified 825
27 Ga0105239_12426937 3300010375 Bacteria 611
28 Ga0157369_10008089 3300013105 Bacteria 12058
29 Ga0157374_11101943 3300013296 Unclassified 814
30 Ga0163163_10188469 3300014325 Bacteria 2111
31 Ga0163163_10995273 3300014325 Bacteria 902
32 Ga0157379_11359491 3300014968 Bacteria 687
33 Ga0206354_11322440 3300020081 Unclassified 691
34 Ga0206353_11235121 3300020082 Bacteria 1030
35 Ga0213874_10067990 3300021377 Bacteria 1130
36 Ga0213875_10084715 3300021388 Bacteria 1479
37 Ga0213875_10236825 3300021388 Bacteria 860
38 Ga0207692_10562637 3300025898 Unclassified 730
39 Ga0207707_10052249 3300025912 Bacteria 3559
40 Ga0207695_10124396 3300025913 Bacteria 2543
41 Ga0207695_11145337 3300025913 Bacteria 658
42 Ga0207671_11572702 3300025914 Unclassified 506
43 Ga0207657_10130296 3300025919 Bacteria 2062
44 Ga0207652_10184850 3300025921 Bacteria 1874
45 Ga0207694_10186490 3300025924 Unclassified 1684
46 Ga0207694_11072149 3300025924 Unclassified 682
47 Ga0207687_10778567 3300025927 Bacteria 815
48 Ga0207700_10022089 3300025928 Bacteria 4359
49 Ga0207664_10416850 3300025929 Unclassified 1196
50 Ga0207665_10025076 3300025939 Bacteria 3933
51 Ga0207661_10754522 3300025944 Bacteria 896
52 Ga0207667_10064239 3300025949 Bacteria 3833
53 Ga0207678_10218204 3300026067 Bacteria 1632
54 Ga0209588_1256301 3300027671 Unclassified 533
55 Ga0265318_10016808 3300028577 Bacteria 3014
56 Ga0265338_10013871 3300028800 Bacteria 9052
57 Ga0265338_10023077 3300028800 Bacteria 6409
58 Ga0265338_10107921 3300028800 Bacteria 2250
59 Ga0265320_10060079 3300031240 Bacteria 1816
60 Ga0265325_10009971 3300031241 Bacteria 5523
61 Ga0265340_10134264 3300031247 Bacteria 1134
62 Ga0265340_10323849 3300031247 Bacteria 682
63 Ga0265339_10036949 3300031249 Bacteria 2730
64 Ga0265331_10008132 3300031250 Bacteria 5991
65 Ga0265316_10295646 3300031344 Bacteria 1181
66 Ga0265313_10002786 3300031595 Bacteria 14745
67 Ga0265313_10008687 3300031595 Bacteria 6716
68 Ga0265313_10012626 3300031595 Bacteria 5139
69 Ga0265314_10017688 3300031711 Bacteria 5587
70 Ga0265314_10105349 3300031711 Bacteria 1803
71 Ga0373934_0403381 3300035086 Bacteria 571
72 Ga0373944_0126905 3300035089 Bacteria 884
73 Ga0373923_0018516 3300035111 Bacteria 2682
74 Ga0373923_0184079 3300035111 Bacteria 961
75 Ga0373945_0014360 3300035116 Bacteria 2653
76 Ga0373953_0014773 3300035117 Bacteria 2816
77 Ga0373953_0143454 3300035117 Bacteria 1022
78 Ga0373954_0045010 3300035118 Bacteria 2061
79 Ga0373954_0058507 3300035118 Bacteria 1816
80 Ga0373954_0200654 3300035118 Bacteria 980
81 Ga0373956_0082990 3300035119 Bacteria 1472
82 Ga0373943_0159235 3300035170 Bacteria 1228
83 Ga0373943_0580689 3300035170 Bacteria 659
84 Ga0373943_0711572 3300035170 Bacteria 595
85 Ga0373946_0203479 3300035171 Bacteria 949
86 Ga0373946_0209469 3300035171 Bacteria 937
87 Ga0373955_0006692 3300035172 Bacteria 5260
88 Ga0373935_0080842 3300035692 Bacteria 2112
89 Ga0373927_0041982 3300035695 Bacteria 2966
90 Ga0373927_0050399 3300035695 Bacteria 2692
91 Ga0373927_0234440 3300035695 Unclassified 1206
92 Ga0373933_0732300 3300035724 Bacteria 650
93 Ga0373947_0096718 3300035725 Bacteria 1849
94 Ga0373947_0630485 3300035725 Bacteria 731
95 Ga0373937_0008826 3300036401 Bacteria 8745
96 Ga0373937_0050750 3300036401 Bacteria 3801
97 Ga0373925_0095104 3300037068 Bacteria 2282
98 Ga0373925_0153758 3300037068 Bacteria 1808
99 Ga0373925_0198718 3300037068 Bacteria 1594
100 Ga0373925_0586750 3300037068 Bacteria 917
101 Ga0373925_0730481 3300037068 Bacteria 816
102 Ga0395899_0257992 3300037312 Unclassified 1193
103 Ga0395900_0248815 3300037418 Bacteria 1780
104 Ga0395900_0687366 3300037418 Unclassified 957
105 Ga0395900_0688217 3300037418 Bacteria 957
106 Ga0395898_0003629 3300037466 Bacteria 17189
107 Ga0395898_0048387 3300037466 Bacteria 4170
108 Ga0395898_0410494 3300037466 Unclassified 1291
109 Ga0395905_0479276 3300037471 Unclassified 1143
110 Ga0436364_0229679 3300037853 Bacteria 1384
111 Ga0436364_0312544 3300037853 Bacteria 3599
112 Ga0436364_0742076 3300037853 Bacteria 899
113 Ga0436364_0828377 3300037853 Bacteria 506
114 Ga0436364_1006245 3300037853 Bacteria 3395
115 Ga0436364_1215970 3300037853 Bacteria 1398
116 Ga0395901_0546359 3300038443 Unclassified 1174
117 Ga0436365_0382730 3300039437 Unclassified 667
118 Ga0436365_1421197 3300039437 Bacteria 1227
119 Ga0436365_1533815 3300039437 Bacteria 803
120 Ga0436365_1910139 3300039437 Unclassified 1514
121 Ga0436360_1355978 3300039438 Bacteria 2489
122 Ga0436361_0261423 3300039447 Unclassified 738
123 Ga0436361_0301276 3300039447 Bacteria 4478
124 Ga0436361_0772386 3300039447 Unclassified 1233
125 Ga0436361_1002359 3300039447 Bacteria 4290
126 Ga0436363_0147355 3300039450 Unclassified 618
127 Ga0436363_1123692 3300039450 Bacteria 2684
128 Ga0436363_1604822 3300039450 Bacteria 1588
129 Ga0436362_0905771 3300039453 Bacteria 800
130 Ga0466963_0931942 3300044694 Unclassified 612
131 Ga0466959_0262686 3300045049 Bacteria 1188
132 Ga0466967_0543037 3300045976 Bacteria 1144
133 Ga0466967_0681332 3300045976 Bacteria 1018
134 Ga0495592_0632245 3300046454 Unclassified 650
135 Ga0495603_0357230 3300046455 Bacteria 838
136 Ga0495651_0215639 3300046462 Bacteria 1332
137 Ga0495664_0570056 3300046477 Bacteria 674
138 Ga0495608_0483987 3300046511 Bacteria 751
139 Ga0495630_0344539 3300046517 Bacteria 1140
140 Ga0495637_0015744 3300046520 Bacteria 3544
141 Ga0495643_0036321 3300046522 Bacteria 2708
142 Ga0495640_0115099 3300046533 Bacteria 1753
143 Ga0495640_0283689 3300046533 Bacteria 1031
144 Ga0495640_0394684 3300046533 Bacteria 850
145 Ga0495587_0059681 3300046536 Bacteria 2238
146 Ga0495609_0039416 3300046538 Bacteria 2127
147 Ga0495597_0079915 3300046542 Bacteria 1400
148 Ga0495667_0408760 3300046559 Bacteria 855
149 Ga0495634_0231007 3300046642 Bacteria 1138
150 Ga0495625_0142151 3300046660 Bacteria 1618
151 Ga0495657_0025226 3300046675 Bacteria 4225
152 Ga0495623_0100376 3300046679 Bacteria 1764
153 Ga0495658_0353795 3300046683 Bacteria 934
154 Ga0495658_0575701 3300046683 Unclassified 721
155 Ga0495670_0428371 3300046691 Bacteria 716
156 Ga0495660_0511318 3300046810 Unclassified 512
157 Ga0495674_0159164 3300047319 Bacteria 1890
158 Ga0495674_1111373 3300047319 Bacteria 601
159 Ga0495684_0226187 3300047471 Bacteria 1370
160 Ga0495684_0326826 3300047471 Unclassified 1095
161 Ga0495686_0006640 3300047472 Bacteria 8812
162 Ga0495602_0136450 3300048088 Bacteria 1948
163 Ga0496105_0000017 3300048908 Bacteria 210323
164 Ga0496109_1992057 3300048912 Unclassified 513
165 Ga0496112_1528125 3300048915 Unclassified 581
166 Ga0496115_0107804 3300048918 Bacteria 2287
167 Ga0496121_0000248 3300048924 Bacteria 114460
168 Ga0501032_0114338 3300049569 Bacteria 1785
169 Ga0501033_0170243 3300049570 Bacteria 1564
170 Ga0501034_0000944 3300049571 Bacteria 42142
171 Ga0501038_1050381 3300049574 Bacteria 596
172 Ga0501039_0070599 3300049575 Bacteria 2713
173 Ga0501040_0589154 3300049576 Bacteria 803
174 Ga0501081_0151539 3300049743 Bacteria 1666
175 Ga0501044_0067611 3300049823 Bacteria 3640
176 Ga0501044_0605800 3300049823 Bacteria 988
177 nmdc:mga08x19_8901_c1 3300050514 Bacteria 5989
178 Ga0495601_0006555 3300053077 Bacteria 6810
179 Ga0495601_0431661 3300053077 Unclassified 853
180 Ga0495601_0657075 3300053077 Bacteria 670
181 Ga0495601_0689722 3300053077 Bacteria 652
182 Ga0495612_0001061 3300053078 Bacteria 11253
183 Ga0495595_0051135 3300053084 Bacteria 1914
184 Ga0495619_0054511 3300053085 Bacteria 2647
185 Ga0495619_0228651 3300053085 Bacteria 1288
186 Ga0495619_0304085 3300053085 Bacteria 1105
187 Ga0495619_1177544 3300053085 Bacteria 508
188 Ga0500651_0061509 3300053093 Bacteria 2345
189 Ga0500651_0225038 3300053093 Bacteria 1099
190 Ga0500641_0023310 3300053096 Unclassified 2379
191 Ga0500650_0289919 3300053098 Bacteria 726
192 Ga0500614_003254 3300053123 Bacteria 3516
193 Ga0500618_014981 3300053125 Bacteria 1968
194 Ga0500642_0001072 3300053130 Bacteria 7889
195 Ga0500655_000140 3300053133 Bacteria 18182
196 Ga0500559_0359106 3300053136 Unclassified 681
197 Ga0500577_0045270 3300053142 Bacteria 1625
198 Ga0500590_010406 3300053148 Bacteria 4698
199 Ga0500622_0121275 3300053156 Bacteria 1267
200 Ga0500639_163236 3300053163 Bacteria 1010
201 Ga0500570_000853 3300053724 Bacteria 12965
202 2585259700 2582581305 Bacteria 4895574
203 Ga0068855_100078395
204 Ga0070680_100111250
205 Ga0070714_100481322
206 Ga0070714_100561302
207 Ga0070713_100028247
208 Ga0070713_100381180
209 Ga0070708_100476000
210 Ga0070708_100899371
211 Ga0070706_100107480
212 Ga0070698_100590372
213 Ga0070697_101115657
214 Ga0081455_10012921
215 Ga0081455_10322109
216 Ga0081455_10363131
217 Ga0081538_10046115
218 Ga0070717_10141149
219 Ga0070717_10538915
220 Ga0070716_100173299
221 Ga0070716_101695587
222 Ga0075433_11190628
223 Ga0075436_100010792
224 Ga0099794_10004300
225 Ga0105240_10024386
226 Ga0105240_11689035
227 Ga0105237_10250791
228 Ga0099796_10191628
229 Ga0105239_12426937
230 Ga0157369_10008089
231 Ga0157374_11101943
232 Ga0163163_10188469
233 Ga0163163_10995273
234 Ga0157379_11359491
235 Ga0206354_11322440
236 Ga0206353_11235121
237 Ga0213874_10067990
238 Ga0213875_10084715
239 Ga0213875_10236825
240 Ga0207692_10562637
241 Ga0207707_10052249
242 Ga0207695_10124396
243 Ga0207695_11145337
244 Ga0207671_11572702
245 Ga0207657_10130296
246 Ga0207652_10184850
247 Ga0207694_10186490
248 Ga0207694_11072149
249 Ga0207687_10778567
250 Ga0207700_10022089
251 Ga0207664_10416850
252 Ga0207665_10025076
253 Ga0207661_10754522
254 Ga0207667_10064239
255 Ga0207678_10218204
256 Ga0209588_1256301
257 Ga0265318_10016808
258 Ga0265338_10013871
259 Ga0265338_10023077
260 Ga0265338_10107921
261 Ga0265320_10060079
262 Ga0265325_10009971
263 Ga0265340_10134264
264 Ga0265340_10323849
265 Ga0265339_10036949
266 Ga0265331_10008132
267 Ga0265316_10295646
268 Ga0265313_10002786
269 Ga0265313_10008687
270 Ga0265313_10012626
271 Ga0265314_10017688
272 Ga0265314_10105349
273 Ga0373934_0403381
274 Ga0373944_0126905
275 Ga0373923_0018516
276 Ga0373923_0184079
277 Ga0373945_0014360
278 Ga0373953_0014773
279 Ga0373953_0143454
280 Ga0373954_0045010
281 Ga0373954_0058507
282 Ga0373954_0200654
283 Ga0373956_0082990
284 Ga0373943_0159235
285 Ga0373943_0580689
286 Ga0373943_0711572
287 Ga0373946_0203479
288 Ga0373946_0209469
289 Ga0373955_0006692
290 Ga0373935_0080842
291 Ga0373927_0041982
292 Ga0373927_0050399
293 Ga0373927_0234440
294 Ga0373933_0732300
295 Ga0373947_0096718
296 Ga0373947_0630485
297 Ga0373937_0008826
298 Ga0373937_0050750
299 Ga0373925_0095104
300 Ga0373925_0153758
301 Ga0373925_0198718
302 Ga0373925_0586750
303 Ga0373925_0730481
304 Ga0395899_0257992
305 Ga0395900_0248815
306 Ga0395900_0687366
307 Ga0395900_0688217
308 Ga0395898_0003629
309 Ga0395898_0048387
310 Ga0395898_0410494
311 Ga0395905_0479276
312 Ga0436364_0229679
313 Ga0436364_0312544
314 Ga0436364_0742076
315 Ga0436364_0828377
316 Ga0436364_1006245
317 Ga0436364_1215970
318 Ga0395901_0546359
319 Ga0436365_0382730
320 Ga0436365_1421197
321 Ga0436365_1533815
322 Ga0436365_1910139
323 Ga0436360_1355978
324 Ga0436361_0261423
325 Ga0436361_0301276
326 Ga0436361_0772386
327 Ga0436361_1002359
328 Ga0436363_0147355
329 Ga0436363_1123692
330 Ga0436363_1604822
331 Ga0436362_0905771
332 Ga0466963_0931942
333 Ga0466959_0262686
334 Ga0466967_0543037
335 Ga0466967_0681332
336 Ga0495592_0632245
337 Ga0495603_0357230
338 Ga0495651_0215639
339 Ga0495664_0570056
340 Ga0495608_0483987
341 Ga0495630_0344539
342 Ga0495637_0015744
343 Ga0495643_0036321
344 Ga0495640_0115099
345 Ga0495640_0283689
346 Ga0495640_0394684
347 Ga0495587_0059681
348 Ga0495609_0039416
349 Ga0495597_0079915
350 Ga0495667_0408760
351 Ga0495634_0231007
352 Ga0495625_0142151
353 Ga0495657_0025226
354 Ga0495623_0100376
355 Ga0495658_0353795
356 Ga0495658_0575701
357 Ga0495670_0428371
358 Ga0495660_0511318
359 Ga0495674_0159164
360 Ga0495674_1111373
361 Ga0495684_0226187
362 Ga0495684_0326826
363 Ga0495686_0006640
364 Ga0495602_0136450
365 Ga0496105_0000017
366 Ga0496109_1992057
367 Ga0496112_1528125
368 Ga0496115_0107804
369 Ga0496121_0000248
370 Ga0501032_0114338
371 Ga0501033_0170243
372 Ga0501034_0000944
373 Ga0501038_1050381
374 Ga0501039_0070599
375 Ga0501040_0589154
376 Ga0501081_0151539
377 Ga0501044_0067611
378 Ga0501044_0605800
379 nmdc:mga08x19_8901_c1
380 Ga0495601_0006555
381 Ga0495601_0431661
382 Ga0495601_0657075
383 Ga0495601_0689722
384 Ga0495612_0001061
385 Ga0495595_0051135
386 Ga0495619_0054511
387 Ga0495619_0228651
388 Ga0495619_0304085
389 Ga0495619_1177544
390 Ga0500651_0061509
391 Ga0500651_0225038
392 Ga0500641_0023310
393 Ga0500650_0289919
394 Ga0500614_003254
395 Ga0500618_014981
396 Ga0500642_0001072
397 Ga0500655_000140
398 Ga0500559_0359106
399 Ga0500577_0045270
400 Ga0500590_010406
401 Ga0500622_0121275
402 Ga0500639_163236
403 Ga0500570_000853
404 2585259700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

26

72

0.98

PF12840

HTH_20

Helix-turn-helix domain

24

73

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9561 7 88
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9388 7 92
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.935 7 94
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9133 20 74
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9102 4 86
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9646 17 73 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9534 7 84 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9502 7 87 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9486 4 87 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.935 7 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3E0NLZ0-F1-model_v4 ArsR family transcriptional regulator 0.9923 10 86 GO:0003700
AF-A0A350BCY4-F1-model_v4 Transcriptional regulator 0.9886 4 90 GO:0003700
AF-A0A1R1DFK4-F1-model_v4 Transcriptional regulator 0.9876 9 85 GO:0003677
GO:0003700
AF-A0A316RQ87-F1-model_v4 ArsR family transcriptional regulator 0.9859 8 88 GO:0003700
AF-A0A4Q9BAR1-F1-model_v4 ArsR family transcriptional regulator 0.9854 7 88 GO:0003700
GO:0005737

Map