F308781

General Info

Members Datasets Scaffolds Average Seq Length
201 101 402 117

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0125914|Ga0436364_0125914_514_876
Length 120
Sequence MPVRLRPAEPSVVQPALARFRAGDADREDLRVLVKHLLARLVDKAPGGAVEIRVPPYAVAQAVGGMQHKRGTPPAVVETDAETWIRLALGELTWADAESRGGVRASGERSDLSPWLPLTP

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
8 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
30 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
33 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
36 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
37 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
38 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
39 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
40 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
41 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
53 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
54 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
55 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
56 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
69 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
70 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
71 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
72 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
73 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
74 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
75 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
82 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
83 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
84 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
85 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
86 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
87 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
88 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
89 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
92 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
93 2643221590 Nocardioides sp. Root682 Isolate Unclassified
94 2738541305 Nocardioides sp. CF167 Isolate Unclassified
95 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
96 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
97 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
98 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
99 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
100 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
101 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 1
Isolates 4.48

Biome Distribution

Category Percentage (%)
Aerial Root 1
Bulb 0
Endosphere 37.81
Nodule 0.5
Rhizoplane 3.48
Rhizosphere 50.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0125914 3300037853 Bacteria 1558
2 Ga0006562J51391_1085552 3300003578 Bacteria 2890
3 Ga0006562J51391_1085554 3300003578 Bacteria 1640
4 Ga0070660_100691272 3300005339 Bacteria 855
5 Ga0070675_100619529 3300005354 Bacteria 982
6 Ga0070659_101185325 3300005366 Bacteria 675
7 Ga0070667_100193360 3300005367 Bacteria 1803
8 Ga0070672_100402864 3300005543 Bacteria 1173
9 Ga0068861_101563861 3300005719 Bacteria 649
10 Ga0068860_100066300 3300005843 Bacteria 3429
11 Ga0081455_10186648 3300005937 Bacteria 1565
12 Ga0081539_10095707 3300005985 Bacteria 1525
13 Ga0075365_10004817 3300006038 Bacteria 7199
14 Ga0075365_10008830 3300006038 Bacteria 5748
15 Ga0075365_10010012 3300006038 Bacteria 5492
16 Ga0075365_10014877 3300006038 Bacteria 4690
17 Ga0075365_10084880 3300006038 Bacteria 2150
18 Ga0075365_10095014 3300006038 Bacteria 2035
19 Ga0075365_10121660 3300006038 Bacteria 1801
20 Ga0075365_10174601 3300006038 Bacteria 1501
21 Ga0075365_10294473 3300006038 Bacteria 1142
22 Ga0075365_10663820 3300006038 Bacteria 737
23 Ga0075365_10677395 3300006038 Bacteria 729
24 Ga0075368_10001104 3300006042 Bacteria 8501
25 Ga0075368_10004242 3300006042 Bacteria 4842
26 Ga0075363_100004504 3300006048 Bacteria 6109
27 Ga0075363_100045265 3300006048 Bacteria 2333
28 Ga0075363_100069158 3300006048 Bacteria 1915
29 Ga0075363_100212219 3300006048 Bacteria 1108
30 Ga0075363_100423594 3300006048 Bacteria 784
31 Ga0075363_100446069 3300006048 Bacteria 764
32 Ga0075363_100813015 3300006048 Bacteria 569
33 Ga0075364_10004341 3300006051 Bacteria 8134
34 Ga0075364_10006371 3300006051 Bacteria 6935
35 Ga0075364_10012334 3300006051 Bacteria 5223
36 Ga0075364_10014744 3300006051 Bacteria 4834
37 Ga0075364_10192119 3300006051 Bacteria 1383
38 Ga0075364_10238377 3300006051 Bacteria 1235
39 Ga0075364_10506807 3300006051 Bacteria 825
40 Ga0075364_10888628 3300006051 Bacteria 607
41 Ga0075364_11124154 3300006051 Bacteria 533
42 Ga0075362_10002282 3300006177 Bacteria 6395
43 Ga0075367_10003878 3300006178 Bacteria 7209
44 Ga0075367_10069525 3300006178 Bacteria 2114
45 Ga0075367_10120718 3300006178 Bacteria 1615
46 Ga0075367_10187073 3300006178 Bacteria 1292
47 Ga0075370_10006372 3300006353 Bacteria 5928
48 Ga0075370_10007872 3300006353 Bacteria 5453
49 Ga0075370_10125689 3300006353 Bacteria 1495
50 Ga0075370_10434010 3300006353 Bacteria 790
51 Ga0105249_13052794 3300009553 Bacteria 538
52 Ga0163163_11784548 3300014325 Bacteria 676
53 Ga0163163_11848074 3300014325 Bacteria 664
54 Ga0207697_10340994 3300025315 Bacteria 665
55 Ga0207688_10900594 3300025901 Bacteria 560
56 Ga0207659_10409413 3300025926 Bacteria 1136
57 Ga0207691_10335267 3300025940 Bacteria 1295
58 Ga0207679_10476089 3300025945 Bacteria 1111
59 Ga0207658_10022930 3300025986 Bacteria 4351
60 Ga0207676_10911233 3300026095 Bacteria 863
61 Ga0207698_10431034 3300026142 Bacteria 1268
62 Ga0209813_10165242 3300027866 Bacteria 801
63 Ga0268265_10552150 3300028380 Bacteria 1094
64 Ga0268264_10000226 3300028381 Bacteria 109817
65 Ga0307410_10820797 3300031852 Bacteria 792
66 Ga0307410_12098416 3300031852 Bacteria 505
67 Ga0307407_10191056 3300031903 Bacteria 1365
68 Ga0307416_101112517 3300032002 Bacteria 895
69 Ga0373928_0099318 3300035084 Bacteria 757
70 Ga0395898_0372536 3300037466 Bacteria 1362
71 Ga0395898_0510801 3300037466 Bacteria 1143
72 Ga0436364_0227998 3300037853 Bacteria 1140
73 Ga0451789_0374801 3300041443 Bacteria 610
74 Ga0451793_0534441 3300041452 Bacteria 691
75 Ga0451793_1478902 3300041452 Bacteria 715
76 Ga0451841_1109854 3300041498 Bacteria 522
77 Ga0451853_1618204 3300041512 Bacteria 527
78 Ga0451853_3875897 3300041512 Bacteria 557
79 Ga0466972_0043949 3300044658 Bacteria 2169
80 Ga0466972_0201087 3300044658 Bacteria 933
81 Ga0466972_0203177 3300044658 Bacteria 928
82 Ga0466965_0055756 3300044683 Bacteria 1967
83 Ga0466965_0108574 3300044683 Bacteria 1424
84 Ga0466965_0619877 3300044683 Bacteria 616
85 Ga0466966_0049257 3300044684 Bacteria 2683
86 Ga0466961_0020256 3300044693 Bacteria 4279
87 Ga0466963_0310625 3300044694 Bacteria 1109
88 Ga0466963_0453274 3300044694 Bacteria 905
89 Ga0466971_0047041 3300044719 Bacteria 1939
90 Ga0466971_0056627 3300044719 Bacteria 1768
91 Ga0466971_0172138 3300044719 Bacteria 1016
92 Ga0466970_0004610 3300044765 Bacteria 6799
93 Ga0466970_0014461 3300044765 Bacteria 4051
94 Ga0466970_0186164 3300044765 Bacteria 1153
95 Ga0466970_0245535 3300044765 Bacteria 1002
96 Ga0466970_0266827 3300044765 Bacteria 961
97 Ga0466957_0023670 3300044842 Bacteria 3631
98 Ga0466957_0348302 3300044842 Bacteria 1004
99 Ga0466960_0098004 3300044901 Bacteria 1505
100 Ga0466960_0189996 3300044901 Bacteria 1117
101 Ga0466960_0753457 3300044901 Bacteria 587
102 Ga0466959_0534714 3300045049 Bacteria 791
103 Ga0466967_0031051 3300045976 Bacteria 4493
104 Ga0466967_0053501 3300045976 Bacteria 3548
105 Ga0466967_0243275 3300045976 Bacteria 1717
106 Ga0466967_0807483 3300045976 Bacteria 931
107 Ga0466967_1404260 3300045976 Bacteria 695
108 Ga0496103_0712560 3300048906 Bacteria 636
109 Ga0496109_0533826 3300048912 Bacteria 1107
110 Ga0496109_1022885 3300048912 Bacteria 764
111 Ga0496114_0443542 3300048917 Bacteria 1149
112 Ga0496126_0669082 3300048929 Bacteria 810
113 Ga0501031_0301747 3300049568 Bacteria 1038
114 Ga0501032_0054552 3300049569 Bacteria 2690
115 Ga0501032_0155601 3300049569 Bacteria 1502
116 Ga0501033_0149962 3300049570 Bacteria 1683
117 Ga0501034_0007592 3300049571 Bacteria 11538
118 Ga0501036_0014025 3300049572 Bacteria 6660
119 Ga0501036_0167559 3300049572 Bacteria 1851
120 Ga0501037_0007085 3300049573 Bacteria 8192
121 Ga0501038_0003845 3300049574 Bacteria 13961
122 Ga0501039_0180900 3300049575 Bacteria 1658
123 Ga0501039_0554754 3300049575 Bacteria 901
124 Ga0501039_0772395 3300049575 Bacteria 750
125 Ga0501039_1131394 3300049575 Bacteria 606
126 Ga0501040_0242881 3300049576 Bacteria 1284
127 Ga0501042_0791338 3300049578 Bacteria 690
128 Ga0501046_0179432 3300049580 Bacteria 1584
129 Ga0501048_0180465 3300049582 Bacteria 1496
130 Ga0501067_0283027 3300049583 Bacteria 923
131 Ga0501068_0151840 3300049584 Bacteria 1456
132 Ga0501069_0200681 3300049585 Bacteria 1156
133 Ga0501070_0147114 3300049586 Bacteria 1944
134 Ga0501070_0207335 3300049586 Bacteria 1609
135 Ga0501070_1111546 3300049586 Bacteria 609
136 Ga0501071_0225350 3300049587 Bacteria 1412
137 Ga0501071_0405067 3300049587 Bacteria 1042
138 Ga0501072_0175187 3300049588 Bacteria 1711
139 Ga0501073_1254798 3300049589 Bacteria 508
140 Ga0501074_0780056 3300049590 Bacteria 674
141 Ga0501074_0886970 3300049590 Bacteria 628
142 Ga0501075_0201297 3300049591 Bacteria 1519
143 Ga0501075_0829707 3300049591 Bacteria 703
144 Ga0501080_0135315 3300049742 Bacteria 2281
145 Ga0501035_0122661 3300049822 Bacteria 2270
146 Ga0501044_0002740 3300049823 Bacteria 20041
147 Ga0501044_1107843 3300049823 Bacteria 661
148 Ga0501045_0133067 3300049824 Bacteria 1849
149 Ga0501045_0183478 3300049824 Bacteria 1559
150 Ga0501045_0197237 3300049824 Bacteria 1500
151 Ga0501045_0890487 3300049824 Bacteria 654
152 nmdc:mga03683_106706_c1 3300050489 Bacteria 1235
153 nmdc:mga03683_292212_c1 3300050489 Bacteria 763
154 nmdc:mga03n38_267198_c1 3300050490 Bacteria 909
155 nmdc:mga03n38_27090_c1 3300050490 Bacteria 2374
156 nmdc:mga03n38_32337_c1 3300050490 Bacteria 2216
157 nmdc:mga03n38_344006_c1 3300050490 Bacteria 810
158 nmdc:mga03n38_500946_c1 3300050490 Bacteria 681
159 nmdc:mga03n38_515373_c1 3300050490 Bacteria 673
160 nmdc:mga00v17_126944_c1 3300050491 Bacteria 1628
161 nmdc:mga00v17_13683_c1 3300050491 Bacteria 4509
162 nmdc:mga00v17_19904_c1 3300050491 Bacteria 3838
163 nmdc:mga00v17_225296_c1 3300050491 Bacteria 1214
164 nmdc:mga00v17_413411_c1 3300050491 Bacteria 876
165 nmdc:mga00v17_534514_c1 3300050491 Bacteria 759
166 nmdc:mga0yw44_109580_c1 3300050492 Bacteria 1768
167 nmdc:mga0yw44_115983_c1 3300050492 Bacteria 1721
168 nmdc:mga0yw44_16726_c1 3300050492 Bacteria 3972
169 nmdc:mga0yw44_22499_c1 3300050492 Bacteria 3536
170 nmdc:mga0yw44_22890_c1 3300050492 Bacteria 3511
171 nmdc:mga0yw44_24068_c1 3300050492 Bacteria 3440
172 nmdc:mga0yw44_47386_c1 3300050492 Bacteria 2587
173 nmdc:mga0yw44_512804_c1 3300050492 Bacteria 814
174 nmdc:mga0yw44_632466_c1 3300050492 Bacteria 727
175 nmdc:mga0yw44_741195_c1 3300050492 Bacteria 667
176 nmdc:mga0yw44_80786_c1 3300050492 Bacteria 2037
177 nmdc:mga0yw44_85335_c1 3300050492 Bacteria 1987
178 nmdc:mga06z11_162335_c1 3300050494 Bacteria 1278
179 nmdc:mga06z11_37620_c1 3300050494 Bacteria 2398
180 nmdc:mga06z11_49528_c1 3300050494 Bacteria 2144
181 nmdc:mga06z11_848069_c1 3300050494 Bacteria 557
182 nmdc:mga04h51_122928_c1 3300050495 Bacteria 969
183 nmdc:mga04h51_30064_c1 3300050495 Bacteria 1707
184 nmdc:mga07m45_19783_c1 3300050496 Bacteria 3650
185 nmdc:mga07m45_7189_c1 3300050496 Bacteria 5675
186 nmdc:mga07m45_88292_c1 3300050496 Bacteria 1774
187 Ga0500644_0000203 3300053088 Bacteria 35985
188 Ga0500644_0030579 3300053088 Bacteria 1705
189 Ga0501084_0173687 3300054114 Bacteria 1819
190 Ga0501082_0163418 3300060353 Bacteria 1935
191 Ga0466962_0011099 3300061719 Bacteria 4335
192 Ga0530510_0725590 3300061734 Bacteria 758
193 2643959514 2643221590 Bacteria 5214697
194 2738871872 2738541305 Bacteria 4910150
195 2774396131 2773857762 Bacteria 5971770
196 2809197770 2808606439 Bacteria 5952208
197 2812347739 2811994878 Bacteria 5992952
198 2891968851 2891968417 Bacteria 5821697
199 2984577788 2984576629 Bacteria 4248407
200 2990260512 2990256926 Bacteria 4252839
201 8054609704 8054609563 Bacteria 5170090
202 Ga0436364_0125914
203 Ga0006562J51391_1085552
204 Ga0006562J51391_1085554
205 Ga0070660_100691272
206 Ga0070675_100619529
207 Ga0070659_101185325
208 Ga0070667_100193360
209 Ga0070672_100402864
210 Ga0068861_101563861
211 Ga0068860_100066300
212 Ga0081455_10186648
213 Ga0081539_10095707
214 Ga0075365_10004817
215 Ga0075365_10008830
216 Ga0075365_10010012
217 Ga0075365_10014877
218 Ga0075365_10084880
219 Ga0075365_10095014
220 Ga0075365_10121660
221 Ga0075365_10174601
222 Ga0075365_10294473
223 Ga0075365_10663820
224 Ga0075365_10677395
225 Ga0075368_10001104
226 Ga0075368_10004242
227 Ga0075363_100004504
228 Ga0075363_100045265
229 Ga0075363_100069158
230 Ga0075363_100212219
231 Ga0075363_100423594
232 Ga0075363_100446069
233 Ga0075363_100813015
234 Ga0075364_10004341
235 Ga0075364_10006371
236 Ga0075364_10012334
237 Ga0075364_10014744
238 Ga0075364_10192119
239 Ga0075364_10238377
240 Ga0075364_10506807
241 Ga0075364_10888628
242 Ga0075364_11124154
243 Ga0075362_10002282
244 Ga0075367_10003878
245 Ga0075367_10069525
246 Ga0075367_10120718
247 Ga0075367_10187073
248 Ga0075370_10006372
249 Ga0075370_10007872
250 Ga0075370_10125689
251 Ga0075370_10434010
252 Ga0105249_13052794
253 Ga0163163_11784548
254 Ga0163163_11848074
255 Ga0207697_10340994
256 Ga0207688_10900594
257 Ga0207659_10409413
258 Ga0207691_10335267
259 Ga0207679_10476089
260 Ga0207658_10022930
261 Ga0207676_10911233
262 Ga0207698_10431034
263 Ga0209813_10165242
264 Ga0268265_10552150
265 Ga0268264_10000226
266 Ga0307410_10820797
267 Ga0307410_12098416
268 Ga0307407_10191056
269 Ga0307416_101112517
270 Ga0373928_0099318
271 Ga0395898_0372536
272 Ga0395898_0510801
273 Ga0436364_0227998
274 Ga0451789_0374801
275 Ga0451793_0534441
276 Ga0451793_1478902
277 Ga0451841_1109854
278 Ga0451853_1618204
279 Ga0451853_3875897
280 Ga0466972_0043949
281 Ga0466972_0201087
282 Ga0466972_0203177
283 Ga0466965_0055756
284 Ga0466965_0108574
285 Ga0466965_0619877
286 Ga0466966_0049257
287 Ga0466961_0020256
288 Ga0466963_0310625
289 Ga0466963_0453274
290 Ga0466971_0047041
291 Ga0466971_0056627
292 Ga0466971_0172138
293 Ga0466970_0004610
294 Ga0466970_0014461
295 Ga0466970_0186164
296 Ga0466970_0245535
297 Ga0466970_0266827
298 Ga0466957_0023670
299 Ga0466957_0348302
300 Ga0466960_0098004
301 Ga0466960_0189996
302 Ga0466960_0753457
303 Ga0466959_0534714
304 Ga0466967_0031051
305 Ga0466967_0053501
306 Ga0466967_0243275
307 Ga0466967_0807483
308 Ga0466967_1404260
309 Ga0496103_0712560
310 Ga0496109_0533826
311 Ga0496109_1022885
312 Ga0496114_0443542
313 Ga0496126_0669082
314 Ga0501031_0301747
315 Ga0501032_0054552
316 Ga0501032_0155601
317 Ga0501033_0149962
318 Ga0501034_0007592
319 Ga0501036_0014025
320 Ga0501036_0167559
321 Ga0501037_0007085
322 Ga0501038_0003845
323 Ga0501039_0180900
324 Ga0501039_0554754
325 Ga0501039_0772395
326 Ga0501039_1131394
327 Ga0501040_0242881
328 Ga0501042_0791338
329 Ga0501046_0179432
330 Ga0501048_0180465
331 Ga0501067_0283027
332 Ga0501068_0151840
333 Ga0501069_0200681
334 Ga0501070_0147114
335 Ga0501070_0207335
336 Ga0501070_1111546
337 Ga0501071_0225350
338 Ga0501071_0405067
339 Ga0501072_0175187
340 Ga0501073_1254798
341 Ga0501074_0780056
342 Ga0501074_0886970
343 Ga0501075_0201297
344 Ga0501075_0829707
345 Ga0501080_0135315
346 Ga0501035_0122661
347 Ga0501044_0002740
348 Ga0501044_1107843
349 Ga0501045_0133067
350 Ga0501045_0183478
351 Ga0501045_0197237
352 Ga0501045_0890487
353 nmdc:mga03683_106706_c1
354 nmdc:mga03683_292212_c1
355 nmdc:mga03n38_267198_c1
356 nmdc:mga03n38_27090_c1
357 nmdc:mga03n38_32337_c1
358 nmdc:mga03n38_344006_c1
359 nmdc:mga03n38_500946_c1
360 nmdc:mga03n38_515373_c1
361 nmdc:mga00v17_126944_c1
362 nmdc:mga00v17_13683_c1
363 nmdc:mga00v17_19904_c1
364 nmdc:mga00v17_225296_c1
365 nmdc:mga00v17_413411_c1
366 nmdc:mga00v17_534514_c1
367 nmdc:mga0yw44_109580_c1
368 nmdc:mga0yw44_115983_c1
369 nmdc:mga0yw44_16726_c1
370 nmdc:mga0yw44_22499_c1
371 nmdc:mga0yw44_22890_c1
372 nmdc:mga0yw44_24068_c1
373 nmdc:mga0yw44_47386_c1
374 nmdc:mga0yw44_512804_c1
375 nmdc:mga0yw44_632466_c1
376 nmdc:mga0yw44_741195_c1
377 nmdc:mga0yw44_80786_c1
378 nmdc:mga0yw44_85335_c1
379 nmdc:mga06z11_162335_c1
380 nmdc:mga06z11_37620_c1
381 nmdc:mga06z11_49528_c1
382 nmdc:mga06z11_848069_c1
383 nmdc:mga04h51_122928_c1
384 nmdc:mga04h51_30064_c1
385 nmdc:mga07m45_19783_c1
386 nmdc:mga07m45_7189_c1
387 nmdc:mga07m45_88292_c1
388 Ga0500644_0000203
389 Ga0500644_0030579
390 Ga0501084_0173687
391 Ga0501082_0163418
392 Ga0466962_0011099
393 Ga0530510_0725590
394 2643959514
395 2738871872
396 2774396131
397 2809197770
398 2812347739
399 2891968851
400 2984577788
401 2990260512
402 8054609704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17844

SCP_3

Bacterial SCP ortholog

26

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zy7-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.8662 9 117
4nss-assembly1.cif.gz_A a structural and functional investigation of a novel protein from mycobacterium smegmatis implicated in mycobacterial macrophage survivability 0.8398 10 117
4nss-assembly2.cif.gz_B a structural and functional investigation of a novel protein from mycobacterium smegmatis implicated in mycobacterial macrophage survivability 0.8288 9 117
4zy7-assembly2.cif.gz_B crystal structure of a mycobacterial protein 0.821 4 117
4zy7-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.7989 9 117
ID Description Score Start End Superfamily
af_I6Y8U3_1_129_3.30.1050.40 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8293 1 118 3.30.1050.40
4nssB00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8288 9 117 3.30.1050.40
af_I6Y8U3_1_129_3.30.1050.40 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8229 1 118 3.30.1050.40
af_Q19272_279_488_1.10.1420.10 Mainly Alpha;Orthogonal Bundle;MutS, DNA mismatch repair protein; Chain A, domain 3; 0.7925 15 46 1.10.1420.10
4nssB00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.7816 9 117 3.30.1050.40
ID Description Score Start End GO Terms
AF-A0A7K1DA95-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9918 26 117
AF-A0A7W0KRE7-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9889 31 117
AF-A0A1A9GI90-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9884 1 118
AF-D6ZKH6-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.981 27 118
AF-A0A847CMV9-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9803 7 118

Map