F308672

General Info

Members Datasets Scaffolds Average Seq Length
201 125 201 285

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100018360|Ga0307408_1000183603
Length 315
Sequence MERIISENAAVSDLSPDGKVEPTAVSDETLAKSGFYWRERGGVKVLVCRPLEEAGFANGFSTRLGGVSNLAGGLELQASADGYPVEGELNLAGFNEDAGDKIHENRRRFLAVFEAPYRLALAWQVHGDNIRTVKNAEEAGDSDERADAVISGLEGILAGVKTADCVPVLLGDPENMAFAAVHAGWRGTALGIVGKTVEKMRTEFGTDPTSLIAAIGPAAGCEAYEIGHDVIDAFAEKFSTGGKYFRETRPGHALVDLHAANRDQLADAGVGAGNIPTAPFCTISRVDLFFSYRIEKKKFGRTGRLLSVIGKGRKA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
118 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
119 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
120 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
121 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
122 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 1
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001491 3300003203 Bacteria 11046
2 Ga0065704_10113348 3300005289 Bacteria 1914
3 Ga0065707_10114447 3300005295 Bacteria 2297
4 Ga0070676_10156879 3300005328 Unclassified 1461
5 Ga0070690_100356906 3300005330 Unclassified 1062
6 Ga0070670_100073627 3300005331 Unclassified 2934
7 Ga0068869_100153424 3300005334 Unclassified 1788
8 Ga0070666_10249030 3300005335 Unclassified 1257
9 Ga0070689_100097151 3300005340 Bacteria 2329
10 Ga0070689_100170219 3300005340 Unclassified 1765
11 Ga0070661_100006709 3300005344 Bacteria 7939
12 Ga0070668_100172784 3300005347 Bacteria 1760
13 Ga0070671_100405493 3300005355 Bacteria 1166
14 Ga0070688_100261919 3300005365 Bacteria 1235
15 Ga0070667_100094848 3300005367 Unclassified 2571
16 Ga0070678_100027162 3300005456 Bacteria 3883
17 Ga0070681_10028440 3300005458 Bacteria 5620
18 Ga0070681_10279118 3300005458 Bacteria 1581
19 Ga0068867_100269550 3300005459 Bacteria 1391
20 Ga0068867_100332086 3300005459 Unclassified 1263
21 Ga0070685_10117753 3300005466 Bacteria 1646
22 Ga0070679_100124574 3300005530 Unclassified 2560
23 Ga0070679_100252689 3300005530 Bacteria 1719
24 Ga0070684_100533489 3300005535 Bacteria 1088
25 Ga0068853_100052633 3300005539 Bacteria 3506
26 Ga0068853_100095630 3300005539 Unclassified 2620
27 Ga0068853_100163063 3300005539 Unclassified 2012
28 Ga0070686_100186820 3300005544 Unclassified 1476
29 Ga0070704_100022424 3300005549 Bacteria 4109
30 Ga0070664_100107467 3300005564 Bacteria 2432
31 Ga0070664_100116037 3300005564 Bacteria 2341
32 Ga0068857_100085829 3300005577 Unclassified 2814
33 Ga0068857_100087994 3300005577 Bacteria 2779
34 Ga0068854_100018471 3300005578 Unclassified 4682
35 Ga0068854_100046291 3300005578 Bacteria 3097
36 Ga0068854_100275446 3300005578 Unclassified 1353
37 Ga0068854_100290665 3300005578 Bacteria 1319
38 Ga0068852_100205495 3300005616 Unclassified 1865
39 Ga0068859_100066000 3300005617 Bacteria 3653
40 Ga0068859_100066833 3300005617 Bacteria 3630
41 Ga0068859_100337128 3300005617 Bacteria 1602
42 Ga0068859_100546054 3300005617 Unclassified 1253
43 Ga0068859_100647875 3300005617 Unclassified 1148
44 Ga0068864_100169391 3300005618 Unclassified 1990
45 Ga0068864_100679407 3300005618 Bacteria 1004
46 Ga0068861_100075076 3300005719 Unclassified 2631
47 Ga0068861_100276534 3300005719 Unclassified 1444
48 Ga0068870_10034366 3300005840 Bacteria 2594
49 Ga0068863_100245230 3300005841 Unclassified 1730
50 Ga0068858_100254196 3300005842 Unclassified 1669
51 Ga0068860_100043539 3300005843 Bacteria 4282
52 Ga0068860_100077340 3300005843 Bacteria 3164
53 Ga0068862_100661452 3300005844 Bacteria 1008
54 Ga0081539_10000049 3300005985 Bacteria 271978
55 Ga0097621_100086003 3300006237 Unclassified 2623
56 Ga0097621_100332013 3300006237 Bacteria 1349
57 Ga0068871_100001876 3300006358 Bacteria 14214
58 Ga0097620_100066002 3300006931 Bacteria 3653
59 Ga0097620_100066832 3300006931 Bacteria 3630
60 Ga0097620_100337128 3300006931 Bacteria 1602
61 Ga0097620_100546052 3300006931 Unclassified 1253
62 Ga0097620_100647865 3300006931 Unclassified 1148
63 Ga0105240_10166490 3300009093 Unclassified 2614
64 Ga0111539_10027398 3300009094 Bacteria 6960
65 Ga0105245_10000607 3300009098 Bacteria 32457
66 Ga0105245_10296010 3300009098 Bacteria 1586
67 Ga0105247_10007604 3300009101 Bacteria 6638
68 Ga0105247_10093515 3300009101 Bacteria 1911
69 Ga0105241_10023114 3300009174 Bacteria 4608
70 Ga0105241_10026386 3300009174 Bacteria 4322
71 Ga0105241_10081769 3300009174 Unclassified 2531
72 Ga0105242_10139506 3300009176 Bacteria 2102
73 Ga0105248_10081212 3300009177 Unclassified 3644
74 Ga0105237_10074142 3300009545 Unclassified 3395
75 Ga0105237_10286451 3300009545 Bacteria 1650
76 Ga0105249_10142802 3300009553 Bacteria 2297
77 Ga0105249_10472803 3300009553 Unclassified 1295
78 Ga0105239_10448324 3300010375 Unclassified 1464
79 Ga0157373_10061474 3300013100 Bacteria 2660
80 Ga0157369_10021370 3300013105 Bacteria 7239
81 Ga0157369_10053406 3300013105 Unclassified 4368
82 Ga0157374_10226064 3300013296 Unclassified 1838
83 Ga0157374_10602070 3300013296 Bacteria 1109
84 Ga0157378_10083836 3300013297 Unclassified 2885
85 Ga0163162_10183302 3300013306 Bacteria 2220
86 Ga0163162_10220677 3300013306 Bacteria 2026
87 Ga0163162_10248466 3300013306 Unclassified 1911
88 Ga0163162_10265754 3300013306 Bacteria 1847
89 Ga0163162_10604534 3300013306 Bacteria 1223
90 Ga0157372_10145192 3300013307 Bacteria 2736
91 Ga0157372_10198717 3300013307 Bacteria 2322
92 Ga0157375_10103500 3300013308 Unclassified 2934
93 Ga0157375_10492497 3300013308 Unclassified 1390
94 Ga0163163_10027552 3300014325 Bacteria 5445
95 Ga0163163_10457440 3300014325 Unclassified 1337
96 Ga0157380_10044055 3300014326 Unclassified 3495
97 Ga0163161_10005972 3300017792 Bacteria 8442
98 Ga0163161_10103492 3300017792 Bacteria 2122
99 Ga0207682_10016510 3300025893 Bacteria 2880
100 Ga0207647_10081333 3300025904 Bacteria 1941
101 Ga0207645_10167162 3300025907 Bacteria 1440
102 Ga0207643_10041407 3300025908 Bacteria 2595
103 Ga0207705_10032113 3300025909 Unclassified 3751
104 Ga0207654_10004530 3300025911 Bacteria 7022
105 Ga0207707_10003284 3300025912 Bacteria 14371
106 Ga0207695_10144045 3300025913 Unclassified 2329
107 Ga0207649_10113532 3300025920 Bacteria 1814
108 Ga0207650_10084628 3300025925 Bacteria 2411
109 Ga0207659_10166171 3300025926 Bacteria 1737
110 Ga0207687_10019085 3300025927 Bacteria 4538
111 Ga0207644_10104708 3300025931 Unclassified 2131
112 Ga0207706_10043299 3300025933 Bacteria 3990
113 Ga0207686_10031317 3300025934 Bacteria 3157
114 Ga0207670_10018663 3300025936 Unclassified 4223
115 Ga0207661_10101550 3300025944 Bacteria 2417
116 Ga0207679_10072289 3300025945 Bacteria 2605
117 Ga0207679_10138009 3300025945 Bacteria 1966
118 Ga0207679_10438099 3300025945 Unclassified 1157
119 Ga0207667_10100583 3300025949 Bacteria 2982
120 Ga0207712_10029846 3300025961 Bacteria 3662
121 Ga0207712_10180857 3300025961 Bacteria 1656
122 Ga0207658_10029546 3300025986 Unclassified 3872
123 Ga0207677_10436539 3300026023 Unclassified 1119
124 Ga0207703_10190659 3300026035 Bacteria 1815
125 Ga0207702_10329979 3300026078 Unclassified 1455
126 Ga0207641_10143032 3300026088 Bacteria 2160
127 Ga0207648_10073504 3300026089 Unclassified 2979
128 Ga0207648_10306286 3300026089 Unclassified 1426
129 Ga0207648_10384959 3300026089 Unclassified 1269
130 Ga0207676_10052192 3300026095 Unclassified 3195
131 Ga0207676_10372803 3300026095 Bacteria 1326
132 Ga0207674_10008290 3300026116 Bacteria 12034
133 Ga0207674_10103485 3300026116 Unclassified 2826
134 Ga0207683_10029624 3300026121 Bacteria 4739
135 Ga0207698_10081006 3300026142 Bacteria 2618
136 Ga0207428_10467083 3300027907 Unclassified 919
137 Ga0268264_10020991 3300028381 Bacteria 5336
138 Ga0268264_10392177 3300028381 Unclassified 1332
139 Ga0265320_10105876 3300031240 Unclassified 1292
140 Ga0307408_100018360 3300031548 Bacteria 4694
141 Ga0307408_100050873 3300031548 Bacteria 2981
142 Ga0307408_100324513 3300031548 Bacteria 1298
143 Ga0307405_10004995 3300031731 Bacteria 6340
144 Ga0307405_10023800 3300031731 Bacteria 3487
145 Ga0307405_10209554 3300031731 Bacteria 1422
146 Ga0307413_10006571 3300031824 Bacteria 5325
147 Ga0307413_10020665 3300031824 Bacteria 3507
148 Ga0307413_10029329 3300031824 Bacteria 3076
149 Ga0307410_10002723 3300031852 Bacteria 8630
150 Ga0307410_10003387 3300031852 Bacteria 7992
151 Ga0307410_10016372 3300031852 Bacteria 4421
152 Ga0307410_10240643 3300031852 Bacteria 1402
153 Ga0307406_10006994 3300031901 Bacteria 6245
154 Ga0307406_10026155 3300031901 Bacteria 3501
155 Ga0307406_10037694 3300031901 Bacteria 2988
156 Ga0307406_10209700 3300031901 Bacteria 1440
157 Ga0307407_10000650 3300031903 Bacteria 11130
158 Ga0307407_10000706 3300031903 Bacteria 10877
159 Ga0307407_10057834 3300031903 Bacteria 2251
160 Ga0307407_10081175 3300031903 Bacteria 1962
161 Ga0307407_10195331 3300031903 Bacteria 1352
162 Ga0307412_10004497 3300031911 Bacteria 7771
163 Ga0307412_10004612 3300031911 Bacteria 7682
164 Ga0307412_10036980 3300031911 Bacteria 3133
165 Ga0307409_100004012 3300031995 Bacteria 8170
166 Ga0307409_100014696 3300031995 Bacteria 5104
167 Ga0307409_100121668 3300031995 Bacteria 2211
168 Ga0307409_100537638 3300031995 Bacteria 1145
169 Ga0307416_100013600 3300032002 Bacteria 5539
170 Ga0307416_100018189 3300032002 Bacteria 4944
171 Ga0307416_100106029 3300032002 Bacteria 2462
172 Ga0307416_100126904 3300032002 Bacteria 2287
173 Ga0307416_100149620 3300032002 Unclassified 2139
174 Ga0307416_100480148 3300032002 Bacteria 1303
175 Ga0307414_10013104 3300032004 Unclassified 4927
176 Ga0307414_10027596 3300032004 Bacteria 3671
177 Ga0307411_10002312 3300032005 Bacteria 8368
178 Ga0307411_10024951 3300032005 Bacteria 3572
179 Ga0307415_100014341 3300032126 Bacteria 4656
180 Ga0307415_100033125 3300032126 Bacteria 3351
181 Ga0373955_0119619 3300035172 Bacteria 1530
182 Ga0373937_0008314 3300036401 Bacteria 9011
183 Ga0395905_0011158 3300037471 Bacteria 8689
184 Ga0436360_1023729 3300039438 Bacteria 1403
185 Ga0436362_0874482 3300039453 Unclassified 1631
186 Ga0453683_0091122 3300044673 Bacteria 1911
187 Ga0466967_0225856 3300045976 Unclassified 1781
188 Ga0495628_0323169 3300046516 Unclassified 1138
189 Ga0495668_0001373 3300046616 Bacteria 23852
190 Ga0496110_0364608 3300048913 Unclassified 1316
191 Ga0496114_0271985 3300048917 Bacteria 1493
192 Ga0501072_0043780 3300049588 Unclassified 3519
193 Ga0501235_033708 3300049669 Bacteria 1161
194 Ga0501247_002898 3300049677 Bacteria 1812
195 Ga0501249_036780 3300049679 Unclassified 1104
196 Ga0501252_001140 3300049682 Bacteria 2365
197 Ga0501268_000850 3300049765 Bacteria 3551
198 Ga0501273_004311 3300049770 Bacteria 1557
199 nmdc:mga08y16_52697_c1 3300050511 Unclassified 4256
200 Ga0500577_0000536 3300053142 Bacteria 9827
201 Ga0500616_0002862 3300053153 Bacteria 13848

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10044055 Ga0157380_100440553 248
2 3300005617 Ga0068859_100337128 Ga0068859_1003371283 252
3 3300006931 Ga0097620_100337128 Ga0097620_1003371283 252
4 3300005347 Ga0070668_100172784 Ga0070668_1001727843 253
5 3300005458 Ga0070681_10028440 Ga0070681_100284402 253
6 3300005530 Ga0070679_100124574 Ga0070679_1001245742 253
7 3300005719 Ga0068861_100075076 Ga0068861_1000750763 253
8 3300017792 Ga0163161_10005972 Ga0163161_100059725 253
9 3300025912 Ga0207707_10003284 Ga0207707_1000328414 253
10 3300031240 Ga0265320_10105876 Ga0265320_101058762 253
11 3300031731 Ga0307405_10209554 Ga0307405_102095542 253
12 3300031901 Ga0307406_10209700 Ga0307406_102097002 253
13 3300032002 Ga0307416_100126904 Ga0307416_1001269042 253
14 3300035172 Ga0373955_0119619 Ga0373955_0119619_536_1393 253
15 3300036401 Ga0373937_0008314 Ga0373937_0008314_2969_3826 253
16 3300048917 Ga0496114_0271985 Ga0496114_0271985_668_1432 253
17 3300005617 Ga0068859_100546054 Ga0068859_1005460542 254
18 3300006931 Ga0097620_100546052 Ga0097620_1005460522 254
19 3300009098 Ga0105245_10000607 Ga0105245_1000060712 254
20 3300009174 Ga0105241_10026386 Ga0105241_100263863 254
21 3300009176 Ga0105242_10139506 Ga0105242_101395062 254
22 3300009553 Ga0105249_10142802 Ga0105249_101428023 254
23 3300013307 Ga0157372_10145192 Ga0157372_101451924 254
24 3300025911 Ga0207654_10004530 Ga0207654_100045304 254
25 3300025927 Ga0207687_10019085 Ga0207687_100190853 254
26 3300025961 Ga0207712_10180857 Ga0207712_101808572 254
27 3300025986 Ga0207658_10029546 Ga0207658_100295462 254
28 3300026089 Ga0207648_10073504 Ga0207648_100735042 254
29 3300045976 Ga0466967_0225856 Ga0466967_0225856_367_1158 254
30 3300025936 Ga0207670_10018663 Ga0207670_100186634 256
31 3300032002 Ga0307416_100106029 Ga0307416_1001060292 256
32 3300032002 Ga0307416_100149620 Ga0307416_1001496202 256
33 3300039438 Ga0436360_1023729 Ga0436360_1023729_158_940 257
34 3300005331 Ga0070670_100073627 Ga0070670_1000736274 258
35 3300005459 Ga0068867_100269550 Ga0068867_1002695502 258
36 3300014325 Ga0163163_10027552 Ga0163163_100275524 258
37 3300025945 Ga0207679_10072289 Ga0207679_100722893 258
38 3300025944 Ga0207661_10101550 Ga0207661_101015502 259
39 3300031901 Ga0307406_10026155 Ga0307406_100261553 265
40 3300005334 Ga0068869_100153424 Ga0068869_1001534241 269
41 3300005335 Ga0070666_10249030 Ga0070666_102490302 269
42 3300005340 Ga0070689_100170219 Ga0070689_1001702191 269
43 3300005367 Ga0070667_100094848 Ga0070667_1000948482 269
44 3300005544 Ga0070686_100186820 Ga0070686_1001868202 269
45 3300005618 Ga0068864_100169391 Ga0068864_1001693912 269
46 3300005842 Ga0068858_100254196 Ga0068858_1002541963 269
47 3300005843 Ga0068860_100077340 Ga0068860_1000773404 269
48 3300006237 Ga0097621_100086003 Ga0097621_1000860033 269
49 3300006358 Ga0068871_100001876 Ga0068871_1000018762 269
50 3300017792 Ga0163161_10103492 Ga0163161_101034923 269
51 3300025934 Ga0207686_10031317 Ga0207686_100313173 269
52 3300026035 Ga0207703_10190659 Ga0207703_101906593 269
53 3300026088 Ga0207641_10143032 Ga0207641_101430323 269
54 3300026142 Ga0207698_10081006 Ga0207698_100810063 269
55 3300028381 Ga0268264_10392177 Ga0268264_103921772 269
56 3300005843 Ga0068860_100043539 Ga0068860_1000435395 270
57 3300025904 Ga0207647_10081333 Ga0207647_100813333 270
58 3300025961 Ga0207712_10029846 Ga0207712_100298462 270
59 3300028381 Ga0268264_10020991 Ga0268264_100209912 270
60 3300031852 Ga0307410_10240643 Ga0307410_102406432 270
61 3300032004 Ga0307414_10013104 Ga0307414_100131045 270
62 3300005330 Ga0070690_100356906 Ga0070690_1003569062 272
63 3300005535 Ga0070684_100533489 Ga0070684_1005334891 272
64 3300005578 Ga0068854_100275446 Ga0068854_1002754462 272
65 3300009098 Ga0105245_10296010 Ga0105245_102960102 272
66 3300013297 Ga0157378_10083836 Ga0157378_100838363 272
67 3300013306 Ga0163162_10220677 Ga0163162_102206773 272
68 3300025909 Ga0207705_10032113 Ga0207705_100321132 272
69 3300005340 Ga0070689_100097151 Ga0070689_1000971512 273
70 3300005617 Ga0068859_100066000 Ga0068859_1000660003 273
71 3300005841 Ga0068863_100245230 Ga0068863_1002452302 273
72 3300006931 Ga0097620_100066002 Ga0097620_1000660023 273
73 3300009553 Ga0105249_10472803 Ga0105249_104728032 273
74 3300013306 Ga0163162_10265754 Ga0163162_102657543 273
75 3300014325 Ga0163163_10457440 Ga0163163_104574402 273
76 3300025925 Ga0207650_10084628 Ga0207650_100846284 273
77 3300005365 Ga0070688_100261919 Ga0070688_1002619191 274
78 3300005458 Ga0070681_10279118 Ga0070681_102791182 274
79 3300005466 Ga0070685_10117753 Ga0070685_101177532 274
80 3300005530 Ga0070679_100252689 Ga0070679_1002526893 274
81 3300005539 Ga0068853_100052633 Ga0068853_1000526332 274
82 3300005564 Ga0070664_100107467 Ga0070664_1001074672 274
83 3300025893 Ga0207682_10016510 Ga0207682_100165102 274
84 3300025920 Ga0207649_10113532 Ga0207649_101135322 274
85 3300025926 Ga0207659_10166171 Ga0207659_101661713 274
86 3300025945 Ga0207679_10138009 Ga0207679_101380092 274
87 3300049588 Ga0501072_0043780 Ga0501072_0043780_252_1097 274
88 3300049679 Ga0501249_036780 Ga0501249_036780_47_940 274
89 3300005549 Ga0070704_100022424 Ga0070704_1000224241 275
90 3300031824 Ga0307413_10029329 Ga0307413_100293292 275
91 3300031852 Ga0307410_10002723 Ga0307410_100027237 275
92 3300031903 Ga0307407_10000650 Ga0307407_1000065011 275
93 3300031911 Ga0307412_10004612 Ga0307412_100046123 275
94 3300031995 Ga0307409_100004012 Ga0307409_1000040126 275
95 3300032005 Ga0307411_10002312 Ga0307411_100023127 275
96 3300005539 Ga0068853_100095630 Ga0068853_1000956301 276
97 3300005578 Ga0068854_100290665 Ga0068854_1002906652 276
98 3300005617 Ga0068859_100647875 Ga0068859_1006478752 276
99 3300005719 Ga0068861_100276534 Ga0068861_1002765342 276
100 3300006931 Ga0097620_100647865 Ga0097620_1006478652 276
101 3300009093 Ga0105240_10166490 Ga0105240_101664902 276
102 3300009101 Ga0105247_10007604 Ga0105247_100076047 276
103 3300009174 Ga0105241_10081769 Ga0105241_100817692 276
104 3300009177 Ga0105248_10081212 Ga0105248_100812122 276
105 3300013105 Ga0157369_10053406 Ga0157369_100534062 276
106 3300013296 Ga0157374_10226064 Ga0157374_102260641 276
107 3300013306 Ga0163162_10248466 Ga0163162_102484662 276
108 3300013307 Ga0157372_10198717 Ga0157372_101987172 276
109 3300013308 Ga0157375_10103500 Ga0157375_101035001 276
110 3300026023 Ga0207677_10436539 Ga0207677_104365392 276
111 3300026089 Ga0207648_10384959 Ga0207648_103849592 276
112 3300032002 Ga0307416_100480148 Ga0307416_1004801482 276
113 3300044673 Ga0453683_0091122 Ga0453683_0091122_481_1347 276
114 3300046516 Ga0495628_0323169 Ga0495628_0323169_23_934 276
115 3300048913 Ga0496110_0364608 Ga0496110_0364608_172_1038 276
116 3300005328 Ga0070676_10156879 Ga0070676_101568792 277
117 3300005459 Ga0068867_100332086 Ga0068867_1003320862 277
118 3300005617 Ga0068859_100066833 Ga0068859_1000668335 277
119 3300006931 Ga0097620_100066832 Ga0097620_1000668325 277
120 3300009101 Ga0105247_10093515 Ga0105247_100935153 277
121 3300009174 Ga0105241_10023114 Ga0105241_100231145 277
122 3300009545 Ga0105237_10286451 Ga0105237_102864512 277
123 3300046616 Ga0495668_0001373 Ga0495668_0001373_4583_5473 277
124 3300053153 Ga0500616_0002862 Ga0500616_0002862_2419_3258 277
125 3300005289 Ga0065704_10113348 Ga0065704_101133482 278
126 3300005539 Ga0068853_100163063 Ga0068853_1001630633 278
127 3300005578 Ga0068854_100018471 Ga0068854_1000184713 278
128 3300005616 Ga0068852_100205495 Ga0068852_1002054953 278
129 3300009545 Ga0105237_10074142 Ga0105237_100741423 278
130 3300013100 Ga0157373_10061474 Ga0157373_100614742 278
131 3300013105 Ga0157369_10021370 Ga0157369_100213702 278
132 3300013308 Ga0157375_10492497 Ga0157375_104924972 278
133 3300025913 Ga0207695_10144045 Ga0207695_101440452 278
134 3300025931 Ga0207644_10104708 Ga0207644_101047082 278
135 3300026078 Ga0207702_10329979 Ga0207702_103299792 278
136 3300031548 Ga0307408_100018360 Ga0307408_1000183603 278
137 3300031548 Ga0307408_100050873 Ga0307408_1000508733 278
138 3300031731 Ga0307405_10004995 Ga0307405_100049954 278
139 3300031731 Ga0307405_10023800 Ga0307405_100238003 278
140 3300031824 Ga0307413_10006571 Ga0307413_100065713 278
141 3300031824 Ga0307413_10020665 Ga0307413_100206652 278
142 3300031852 Ga0307410_10003387 Ga0307410_100033875 278
143 3300031852 Ga0307410_10016372 Ga0307410_100163725 278
144 3300031901 Ga0307406_10006994 Ga0307406_100069942 278
145 3300031903 Ga0307407_10000706 Ga0307407_100007066 278
146 3300031903 Ga0307407_10057834 Ga0307407_100578343 278
147 3300031903 Ga0307407_10081175 Ga0307407_100811751 278
148 3300031911 Ga0307412_10004497 Ga0307412_100044975 278
149 3300031911 Ga0307412_10036980 Ga0307412_100369801 278
150 3300031995 Ga0307409_100014696 Ga0307409_1000146963 278
151 3300031995 Ga0307409_100121668 Ga0307409_1001216682 278
152 3300031995 Ga0307409_100537638 Ga0307409_1005376382 278
153 3300032002 Ga0307416_100013600 Ga0307416_1000136003 278
154 3300032002 Ga0307416_100018189 Ga0307416_1000181893 278
155 3300032004 Ga0307414_10027596 Ga0307414_100275963 278
156 3300032005 Ga0307411_10024951 Ga0307411_100249514 278
157 3300032126 Ga0307415_100014341 Ga0307415_1000143413 278
158 3300032126 Ga0307415_100033125 Ga0307415_1000331252 278
159 3300037471 Ga0395905_0011158 Ga0395905_0011158_5189_6034 278
160 3300039453 Ga0436362_0874482 Ga0436362_0874482_462_1310 278
161 3300049677 Ga0501247_002898 Ga0501247_002898_349_1230 278
162 3300049682 Ga0501252_001140 Ga0501252_001140_542_1423 278
163 3300049770 Ga0501273_004311 Ga0501273_004311_65_946 278
164 3300005295 Ga0065707_10114447 Ga0065707_101144473 279
165 3300005355 Ga0070671_100405493 Ga0070671_1004054932 279
166 3300005456 Ga0070678_100027162 Ga0070678_1000271623 279
167 3300005618 Ga0068864_100679407 Ga0068864_1006794071 279
168 3300005840 Ga0068870_10034366 Ga0068870_100343663 279
169 3300009094 Ga0111539_10027398 Ga0111539_100273986 279
170 3300025907 Ga0207645_10167162 Ga0207645_101671622 279
171 3300025908 Ga0207643_10041407 Ga0207643_100414073 279
172 3300026089 Ga0207648_10306286 Ga0207648_103062862 279
173 3300026095 Ga0207676_10052192 Ga0207676_100521922 279
174 3300026095 Ga0207676_10372803 Ga0207676_103728031 279
175 3300026121 Ga0207683_10029624 Ga0207683_100296242 279
176 3300031901 Ga0307406_10037694 Ga0307406_100376942 279
177 3300050511 nmdc:mga08y16_52697_c1 nmdc:mga08y16_52697_c1_2655_3515 279
178 3300005344 Ga0070661_100006709 Ga0070661_1000067092 280
179 3300005564 Ga0070664_100116037 Ga0070664_1001160371 280
180 3300005577 Ga0068857_100085829 Ga0068857_1000858292 280
181 3300005577 Ga0068857_100087994 Ga0068857_1000879942 280
182 3300005578 Ga0068854_100046291 Ga0068854_1000462913 280
183 3300006237 Ga0097621_100332013 Ga0097621_1003320132 280
184 3300010375 Ga0105239_10448324 Ga0105239_104483241 280
185 3300013296 Ga0157374_10602070 Ga0157374_106020701 280
186 3300025933 Ga0207706_10043299 Ga0207706_100432993 280
187 3300025945 Ga0207679_10438099 Ga0207679_104380992 280
188 3300025949 Ga0207667_10100583 Ga0207667_101005832 280
189 3300026116 Ga0207674_10008290 Ga0207674_1000829011 280
190 3300026116 Ga0207674_10103485 Ga0207674_101034851 280
191 3300031548 Ga0307408_100324513 Ga0307408_1003245132 280
192 3300031903 Ga0307407_10195331 Ga0307407_101953312 280
193 3300049669 Ga0501235_033708 Ga0501235_033708_108_995 280
194 3300049765 Ga0501268_000850 Ga0501268_000850_2638_3525 280
195 3300005844 Ga0068862_100661452 Ga0068862_1006614521 281
196 3300013306 Ga0163162_10183302 Ga0163162_101833024 281
197 3300013306 Ga0163162_10604534 Ga0163162_106045342 281
198 3300027907 Ga0207428_10467083 Ga0207428_104670831 281
199 3300053142 Ga0500577_0000536 Ga0500577_0000536_613_1464 281
200 3300003203 JGI25406J46586_10001491 JGI25406J46586_100014916 283
201 3300005985 Ga0081539_10000049 Ga0081539_10000049141 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02578

Cu-oxidase_4

Multi-copper polyphenol oxidoreductase laccase

61

310

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f3v-assembly4.cif.gz_D crystal structure of yfih with c107a mutation in complex with endogenous udp-murnac 0.9381 39 282
1rw0-assembly1.cif.gz_B crystal structure of protein yfih from salmonella enterica serovar typhi, pfam duf152 0.935 39 282
1xaf-assembly1.cif.gz_B crystal structure of protein of unknown function yfih from shigella flexneri 2a str. 2457t 0.9277 39 282
7f3v-assembly3.cif.gz_C crystal structure of yfih with c107a mutation in complex with endogenous udp-murnac 0.9233 39 282
1z9t-assembly1.cif.gz_A crystal structure of a putative laccase (yfih) from escherichia coli at 1.54 a resolution 0.9195 39 282
ID Description Score Start End Superfamily
1xfjA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9157 34 282 3.60.140.10
af_Q9UAG7_265_396_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9041 227 247 3.40.50.80
1t8hA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8979 18 281 3.60.140.10
af_Q8IV20_177_430_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8961 27 282 3.60.140.10
af_P9WKD5_9_250_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8877 22 280 3.60.140.10
ID Description Score Start End GO Terms
AF-A0A7V9C2Z1-F1-model_v4 Laccase domain-containing protein 0.9891 184 282 GO:0005507
GO:0016740
GO:0016787
AF-A0A1Q7Y840-F1-model_v4 Purine nucleoside phosphorylase 0.9875 29 282 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A353C9T3-F1-model_v4 Multicopper polyphenol oxidase 0.9749 99 281 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A7C2JHY9-F1-model_v4 Purine nucleoside phosphorylase 0.9715 117 280 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A7C6ZP03-F1-model_v4 Laccase domain-containing protein 0.966 114 280 GO:0004000
GO:0005507
GO:0017061
GO:0046936

Feature Viewer

pLDDT pTM Quality
91.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map