F308672
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 201 | 125 | 201 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100018360|Ga0307408_1000183603 |
| Length | 315 |
| Sequence | MERIISENAAVSDLSPDGKVEPTAVSDETLAKSGFYWRERGGVKVLVCRPLEEAGFANGFSTRLGGVSNLAGGLELQASADGYPVEGELNLAGFNEDAGDKIHENRRRFLAVFEAPYRLALAWQVHGDNIRTVKNAEEAGDSDERADAVISGLEGILAGVKTADCVPVLLGDPENMAFAAVHAGWRGTALGIVGKTVEKMRTEFGTDPTSLIAAIGPAAGCEAYEIGHDVIDAFAEKFSTGGKYFRETRPGHALVDLHAANRDQLADAGVGAGNIPTAPFCTISRVDLFFSYRIEKKKFGRTGRLLSVIGKGRKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 93 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 96 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 97 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 98 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 99 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 101 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 102 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 103 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 104 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 105 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 109 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 110 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 111 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 112 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 115 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 116 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 118 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 119 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 120 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 121 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 122 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 123 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 125 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1 |
| Nodule | 0 |
| Rhizoplane | 1 |
| Rhizosphere | 98.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001491 | 3300003203 | Bacteria | 11046 |
| 2 | Ga0065704_10113348 | 3300005289 | Bacteria | 1914 |
| 3 | Ga0065707_10114447 | 3300005295 | Bacteria | 2297 |
| 4 | Ga0070676_10156879 | 3300005328 | Unclassified | 1461 |
| 5 | Ga0070690_100356906 | 3300005330 | Unclassified | 1062 |
| 6 | Ga0070670_100073627 | 3300005331 | Unclassified | 2934 |
| 7 | Ga0068869_100153424 | 3300005334 | Unclassified | 1788 |
| 8 | Ga0070666_10249030 | 3300005335 | Unclassified | 1257 |
| 9 | Ga0070689_100097151 | 3300005340 | Bacteria | 2329 |
| 10 | Ga0070689_100170219 | 3300005340 | Unclassified | 1765 |
| 11 | Ga0070661_100006709 | 3300005344 | Bacteria | 7939 |
| 12 | Ga0070668_100172784 | 3300005347 | Bacteria | 1760 |
| 13 | Ga0070671_100405493 | 3300005355 | Bacteria | 1166 |
| 14 | Ga0070688_100261919 | 3300005365 | Bacteria | 1235 |
| 15 | Ga0070667_100094848 | 3300005367 | Unclassified | 2571 |
| 16 | Ga0070678_100027162 | 3300005456 | Bacteria | 3883 |
| 17 | Ga0070681_10028440 | 3300005458 | Bacteria | 5620 |
| 18 | Ga0070681_10279118 | 3300005458 | Bacteria | 1581 |
| 19 | Ga0068867_100269550 | 3300005459 | Bacteria | 1391 |
| 20 | Ga0068867_100332086 | 3300005459 | Unclassified | 1263 |
| 21 | Ga0070685_10117753 | 3300005466 | Bacteria | 1646 |
| 22 | Ga0070679_100124574 | 3300005530 | Unclassified | 2560 |
| 23 | Ga0070679_100252689 | 3300005530 | Bacteria | 1719 |
| 24 | Ga0070684_100533489 | 3300005535 | Bacteria | 1088 |
| 25 | Ga0068853_100052633 | 3300005539 | Bacteria | 3506 |
| 26 | Ga0068853_100095630 | 3300005539 | Unclassified | 2620 |
| 27 | Ga0068853_100163063 | 3300005539 | Unclassified | 2012 |
| 28 | Ga0070686_100186820 | 3300005544 | Unclassified | 1476 |
| 29 | Ga0070704_100022424 | 3300005549 | Bacteria | 4109 |
| 30 | Ga0070664_100107467 | 3300005564 | Bacteria | 2432 |
| 31 | Ga0070664_100116037 | 3300005564 | Bacteria | 2341 |
| 32 | Ga0068857_100085829 | 3300005577 | Unclassified | 2814 |
| 33 | Ga0068857_100087994 | 3300005577 | Bacteria | 2779 |
| 34 | Ga0068854_100018471 | 3300005578 | Unclassified | 4682 |
| 35 | Ga0068854_100046291 | 3300005578 | Bacteria | 3097 |
| 36 | Ga0068854_100275446 | 3300005578 | Unclassified | 1353 |
| 37 | Ga0068854_100290665 | 3300005578 | Bacteria | 1319 |
| 38 | Ga0068852_100205495 | 3300005616 | Unclassified | 1865 |
| 39 | Ga0068859_100066000 | 3300005617 | Bacteria | 3653 |
| 40 | Ga0068859_100066833 | 3300005617 | Bacteria | 3630 |
| 41 | Ga0068859_100337128 | 3300005617 | Bacteria | 1602 |
| 42 | Ga0068859_100546054 | 3300005617 | Unclassified | 1253 |
| 43 | Ga0068859_100647875 | 3300005617 | Unclassified | 1148 |
| 44 | Ga0068864_100169391 | 3300005618 | Unclassified | 1990 |
| 45 | Ga0068864_100679407 | 3300005618 | Bacteria | 1004 |
| 46 | Ga0068861_100075076 | 3300005719 | Unclassified | 2631 |
| 47 | Ga0068861_100276534 | 3300005719 | Unclassified | 1444 |
| 48 | Ga0068870_10034366 | 3300005840 | Bacteria | 2594 |
| 49 | Ga0068863_100245230 | 3300005841 | Unclassified | 1730 |
| 50 | Ga0068858_100254196 | 3300005842 | Unclassified | 1669 |
| 51 | Ga0068860_100043539 | 3300005843 | Bacteria | 4282 |
| 52 | Ga0068860_100077340 | 3300005843 | Bacteria | 3164 |
| 53 | Ga0068862_100661452 | 3300005844 | Bacteria | 1008 |
| 54 | Ga0081539_10000049 | 3300005985 | Bacteria | 271978 |
| 55 | Ga0097621_100086003 | 3300006237 | Unclassified | 2623 |
| 56 | Ga0097621_100332013 | 3300006237 | Bacteria | 1349 |
| 57 | Ga0068871_100001876 | 3300006358 | Bacteria | 14214 |
| 58 | Ga0097620_100066002 | 3300006931 | Bacteria | 3653 |
| 59 | Ga0097620_100066832 | 3300006931 | Bacteria | 3630 |
| 60 | Ga0097620_100337128 | 3300006931 | Bacteria | 1602 |
| 61 | Ga0097620_100546052 | 3300006931 | Unclassified | 1253 |
| 62 | Ga0097620_100647865 | 3300006931 | Unclassified | 1148 |
| 63 | Ga0105240_10166490 | 3300009093 | Unclassified | 2614 |
| 64 | Ga0111539_10027398 | 3300009094 | Bacteria | 6960 |
| 65 | Ga0105245_10000607 | 3300009098 | Bacteria | 32457 |
| 66 | Ga0105245_10296010 | 3300009098 | Bacteria | 1586 |
| 67 | Ga0105247_10007604 | 3300009101 | Bacteria | 6638 |
| 68 | Ga0105247_10093515 | 3300009101 | Bacteria | 1911 |
| 69 | Ga0105241_10023114 | 3300009174 | Bacteria | 4608 |
| 70 | Ga0105241_10026386 | 3300009174 | Bacteria | 4322 |
| 71 | Ga0105241_10081769 | 3300009174 | Unclassified | 2531 |
| 72 | Ga0105242_10139506 | 3300009176 | Bacteria | 2102 |
| 73 | Ga0105248_10081212 | 3300009177 | Unclassified | 3644 |
| 74 | Ga0105237_10074142 | 3300009545 | Unclassified | 3395 |
| 75 | Ga0105237_10286451 | 3300009545 | Bacteria | 1650 |
| 76 | Ga0105249_10142802 | 3300009553 | Bacteria | 2297 |
| 77 | Ga0105249_10472803 | 3300009553 | Unclassified | 1295 |
| 78 | Ga0105239_10448324 | 3300010375 | Unclassified | 1464 |
| 79 | Ga0157373_10061474 | 3300013100 | Bacteria | 2660 |
| 80 | Ga0157369_10021370 | 3300013105 | Bacteria | 7239 |
| 81 | Ga0157369_10053406 | 3300013105 | Unclassified | 4368 |
| 82 | Ga0157374_10226064 | 3300013296 | Unclassified | 1838 |
| 83 | Ga0157374_10602070 | 3300013296 | Bacteria | 1109 |
| 84 | Ga0157378_10083836 | 3300013297 | Unclassified | 2885 |
| 85 | Ga0163162_10183302 | 3300013306 | Bacteria | 2220 |
| 86 | Ga0163162_10220677 | 3300013306 | Bacteria | 2026 |
| 87 | Ga0163162_10248466 | 3300013306 | Unclassified | 1911 |
| 88 | Ga0163162_10265754 | 3300013306 | Bacteria | 1847 |
| 89 | Ga0163162_10604534 | 3300013306 | Bacteria | 1223 |
| 90 | Ga0157372_10145192 | 3300013307 | Bacteria | 2736 |
| 91 | Ga0157372_10198717 | 3300013307 | Bacteria | 2322 |
| 92 | Ga0157375_10103500 | 3300013308 | Unclassified | 2934 |
| 93 | Ga0157375_10492497 | 3300013308 | Unclassified | 1390 |
| 94 | Ga0163163_10027552 | 3300014325 | Bacteria | 5445 |
| 95 | Ga0163163_10457440 | 3300014325 | Unclassified | 1337 |
| 96 | Ga0157380_10044055 | 3300014326 | Unclassified | 3495 |
| 97 | Ga0163161_10005972 | 3300017792 | Bacteria | 8442 |
| 98 | Ga0163161_10103492 | 3300017792 | Bacteria | 2122 |
| 99 | Ga0207682_10016510 | 3300025893 | Bacteria | 2880 |
| 100 | Ga0207647_10081333 | 3300025904 | Bacteria | 1941 |
| 101 | Ga0207645_10167162 | 3300025907 | Bacteria | 1440 |
| 102 | Ga0207643_10041407 | 3300025908 | Bacteria | 2595 |
| 103 | Ga0207705_10032113 | 3300025909 | Unclassified | 3751 |
| 104 | Ga0207654_10004530 | 3300025911 | Bacteria | 7022 |
| 105 | Ga0207707_10003284 | 3300025912 | Bacteria | 14371 |
| 106 | Ga0207695_10144045 | 3300025913 | Unclassified | 2329 |
| 107 | Ga0207649_10113532 | 3300025920 | Bacteria | 1814 |
| 108 | Ga0207650_10084628 | 3300025925 | Bacteria | 2411 |
| 109 | Ga0207659_10166171 | 3300025926 | Bacteria | 1737 |
| 110 | Ga0207687_10019085 | 3300025927 | Bacteria | 4538 |
| 111 | Ga0207644_10104708 | 3300025931 | Unclassified | 2131 |
| 112 | Ga0207706_10043299 | 3300025933 | Bacteria | 3990 |
| 113 | Ga0207686_10031317 | 3300025934 | Bacteria | 3157 |
| 114 | Ga0207670_10018663 | 3300025936 | Unclassified | 4223 |
| 115 | Ga0207661_10101550 | 3300025944 | Bacteria | 2417 |
| 116 | Ga0207679_10072289 | 3300025945 | Bacteria | 2605 |
| 117 | Ga0207679_10138009 | 3300025945 | Bacteria | 1966 |
| 118 | Ga0207679_10438099 | 3300025945 | Unclassified | 1157 |
| 119 | Ga0207667_10100583 | 3300025949 | Bacteria | 2982 |
| 120 | Ga0207712_10029846 | 3300025961 | Bacteria | 3662 |
| 121 | Ga0207712_10180857 | 3300025961 | Bacteria | 1656 |
| 122 | Ga0207658_10029546 | 3300025986 | Unclassified | 3872 |
| 123 | Ga0207677_10436539 | 3300026023 | Unclassified | 1119 |
| 124 | Ga0207703_10190659 | 3300026035 | Bacteria | 1815 |
| 125 | Ga0207702_10329979 | 3300026078 | Unclassified | 1455 |
| 126 | Ga0207641_10143032 | 3300026088 | Bacteria | 2160 |
| 127 | Ga0207648_10073504 | 3300026089 | Unclassified | 2979 |
| 128 | Ga0207648_10306286 | 3300026089 | Unclassified | 1426 |
| 129 | Ga0207648_10384959 | 3300026089 | Unclassified | 1269 |
| 130 | Ga0207676_10052192 | 3300026095 | Unclassified | 3195 |
| 131 | Ga0207676_10372803 | 3300026095 | Bacteria | 1326 |
| 132 | Ga0207674_10008290 | 3300026116 | Bacteria | 12034 |
| 133 | Ga0207674_10103485 | 3300026116 | Unclassified | 2826 |
| 134 | Ga0207683_10029624 | 3300026121 | Bacteria | 4739 |
| 135 | Ga0207698_10081006 | 3300026142 | Bacteria | 2618 |
| 136 | Ga0207428_10467083 | 3300027907 | Unclassified | 919 |
| 137 | Ga0268264_10020991 | 3300028381 | Bacteria | 5336 |
| 138 | Ga0268264_10392177 | 3300028381 | Unclassified | 1332 |
| 139 | Ga0265320_10105876 | 3300031240 | Unclassified | 1292 |
| 140 | Ga0307408_100018360 | 3300031548 | Bacteria | 4694 |
| 141 | Ga0307408_100050873 | 3300031548 | Bacteria | 2981 |
| 142 | Ga0307408_100324513 | 3300031548 | Bacteria | 1298 |
| 143 | Ga0307405_10004995 | 3300031731 | Bacteria | 6340 |
| 144 | Ga0307405_10023800 | 3300031731 | Bacteria | 3487 |
| 145 | Ga0307405_10209554 | 3300031731 | Bacteria | 1422 |
| 146 | Ga0307413_10006571 | 3300031824 | Bacteria | 5325 |
| 147 | Ga0307413_10020665 | 3300031824 | Bacteria | 3507 |
| 148 | Ga0307413_10029329 | 3300031824 | Bacteria | 3076 |
| 149 | Ga0307410_10002723 | 3300031852 | Bacteria | 8630 |
| 150 | Ga0307410_10003387 | 3300031852 | Bacteria | 7992 |
| 151 | Ga0307410_10016372 | 3300031852 | Bacteria | 4421 |
| 152 | Ga0307410_10240643 | 3300031852 | Bacteria | 1402 |
| 153 | Ga0307406_10006994 | 3300031901 | Bacteria | 6245 |
| 154 | Ga0307406_10026155 | 3300031901 | Bacteria | 3501 |
| 155 | Ga0307406_10037694 | 3300031901 | Bacteria | 2988 |
| 156 | Ga0307406_10209700 | 3300031901 | Bacteria | 1440 |
| 157 | Ga0307407_10000650 | 3300031903 | Bacteria | 11130 |
| 158 | Ga0307407_10000706 | 3300031903 | Bacteria | 10877 |
| 159 | Ga0307407_10057834 | 3300031903 | Bacteria | 2251 |
| 160 | Ga0307407_10081175 | 3300031903 | Bacteria | 1962 |
| 161 | Ga0307407_10195331 | 3300031903 | Bacteria | 1352 |
| 162 | Ga0307412_10004497 | 3300031911 | Bacteria | 7771 |
| 163 | Ga0307412_10004612 | 3300031911 | Bacteria | 7682 |
| 164 | Ga0307412_10036980 | 3300031911 | Bacteria | 3133 |
| 165 | Ga0307409_100004012 | 3300031995 | Bacteria | 8170 |
| 166 | Ga0307409_100014696 | 3300031995 | Bacteria | 5104 |
| 167 | Ga0307409_100121668 | 3300031995 | Bacteria | 2211 |
| 168 | Ga0307409_100537638 | 3300031995 | Bacteria | 1145 |
| 169 | Ga0307416_100013600 | 3300032002 | Bacteria | 5539 |
| 170 | Ga0307416_100018189 | 3300032002 | Bacteria | 4944 |
| 171 | Ga0307416_100106029 | 3300032002 | Bacteria | 2462 |
| 172 | Ga0307416_100126904 | 3300032002 | Bacteria | 2287 |
| 173 | Ga0307416_100149620 | 3300032002 | Unclassified | 2139 |
| 174 | Ga0307416_100480148 | 3300032002 | Bacteria | 1303 |
| 175 | Ga0307414_10013104 | 3300032004 | Unclassified | 4927 |
| 176 | Ga0307414_10027596 | 3300032004 | Bacteria | 3671 |
| 177 | Ga0307411_10002312 | 3300032005 | Bacteria | 8368 |
| 178 | Ga0307411_10024951 | 3300032005 | Bacteria | 3572 |
| 179 | Ga0307415_100014341 | 3300032126 | Bacteria | 4656 |
| 180 | Ga0307415_100033125 | 3300032126 | Bacteria | 3351 |
| 181 | Ga0373955_0119619 | 3300035172 | Bacteria | 1530 |
| 182 | Ga0373937_0008314 | 3300036401 | Bacteria | 9011 |
| 183 | Ga0395905_0011158 | 3300037471 | Bacteria | 8689 |
| 184 | Ga0436360_1023729 | 3300039438 | Bacteria | 1403 |
| 185 | Ga0436362_0874482 | 3300039453 | Unclassified | 1631 |
| 186 | Ga0453683_0091122 | 3300044673 | Bacteria | 1911 |
| 187 | Ga0466967_0225856 | 3300045976 | Unclassified | 1781 |
| 188 | Ga0495628_0323169 | 3300046516 | Unclassified | 1138 |
| 189 | Ga0495668_0001373 | 3300046616 | Bacteria | 23852 |
| 190 | Ga0496110_0364608 | 3300048913 | Unclassified | 1316 |
| 191 | Ga0496114_0271985 | 3300048917 | Bacteria | 1493 |
| 192 | Ga0501072_0043780 | 3300049588 | Unclassified | 3519 |
| 193 | Ga0501235_033708 | 3300049669 | Bacteria | 1161 |
| 194 | Ga0501247_002898 | 3300049677 | Bacteria | 1812 |
| 195 | Ga0501249_036780 | 3300049679 | Unclassified | 1104 |
| 196 | Ga0501252_001140 | 3300049682 | Bacteria | 2365 |
| 197 | Ga0501268_000850 | 3300049765 | Bacteria | 3551 |
| 198 | Ga0501273_004311 | 3300049770 | Bacteria | 1557 |
| 199 | nmdc:mga08y16_52697_c1 | 3300050511 | Unclassified | 4256 |
| 200 | Ga0500577_0000536 | 3300053142 | Bacteria | 9827 |
| 201 | Ga0500616_0002862 | 3300053153 | Bacteria | 13848 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10044055 | Ga0157380_100440553 | 248 |
| 2 | 3300005617 | Ga0068859_100337128 | Ga0068859_1003371283 | 252 |
| 3 | 3300006931 | Ga0097620_100337128 | Ga0097620_1003371283 | 252 |
| 4 | 3300005347 | Ga0070668_100172784 | Ga0070668_1001727843 | 253 |
| 5 | 3300005458 | Ga0070681_10028440 | Ga0070681_100284402 | 253 |
| 6 | 3300005530 | Ga0070679_100124574 | Ga0070679_1001245742 | 253 |
| 7 | 3300005719 | Ga0068861_100075076 | Ga0068861_1000750763 | 253 |
| 8 | 3300017792 | Ga0163161_10005972 | Ga0163161_100059725 | 253 |
| 9 | 3300025912 | Ga0207707_10003284 | Ga0207707_1000328414 | 253 |
| 10 | 3300031240 | Ga0265320_10105876 | Ga0265320_101058762 | 253 |
| 11 | 3300031731 | Ga0307405_10209554 | Ga0307405_102095542 | 253 |
| 12 | 3300031901 | Ga0307406_10209700 | Ga0307406_102097002 | 253 |
| 13 | 3300032002 | Ga0307416_100126904 | Ga0307416_1001269042 | 253 |
| 14 | 3300035172 | Ga0373955_0119619 | Ga0373955_0119619_536_1393 | 253 |
| 15 | 3300036401 | Ga0373937_0008314 | Ga0373937_0008314_2969_3826 | 253 |
| 16 | 3300048917 | Ga0496114_0271985 | Ga0496114_0271985_668_1432 | 253 |
| 17 | 3300005617 | Ga0068859_100546054 | Ga0068859_1005460542 | 254 |
| 18 | 3300006931 | Ga0097620_100546052 | Ga0097620_1005460522 | 254 |
| 19 | 3300009098 | Ga0105245_10000607 | Ga0105245_1000060712 | 254 |
| 20 | 3300009174 | Ga0105241_10026386 | Ga0105241_100263863 | 254 |
| 21 | 3300009176 | Ga0105242_10139506 | Ga0105242_101395062 | 254 |
| 22 | 3300009553 | Ga0105249_10142802 | Ga0105249_101428023 | 254 |
| 23 | 3300013307 | Ga0157372_10145192 | Ga0157372_101451924 | 254 |
| 24 | 3300025911 | Ga0207654_10004530 | Ga0207654_100045304 | 254 |
| 25 | 3300025927 | Ga0207687_10019085 | Ga0207687_100190853 | 254 |
| 26 | 3300025961 | Ga0207712_10180857 | Ga0207712_101808572 | 254 |
| 27 | 3300025986 | Ga0207658_10029546 | Ga0207658_100295462 | 254 |
| 28 | 3300026089 | Ga0207648_10073504 | Ga0207648_100735042 | 254 |
| 29 | 3300045976 | Ga0466967_0225856 | Ga0466967_0225856_367_1158 | 254 |
| 30 | 3300025936 | Ga0207670_10018663 | Ga0207670_100186634 | 256 |
| 31 | 3300032002 | Ga0307416_100106029 | Ga0307416_1001060292 | 256 |
| 32 | 3300032002 | Ga0307416_100149620 | Ga0307416_1001496202 | 256 |
| 33 | 3300039438 | Ga0436360_1023729 | Ga0436360_1023729_158_940 | 257 |
| 34 | 3300005331 | Ga0070670_100073627 | Ga0070670_1000736274 | 258 |
| 35 | 3300005459 | Ga0068867_100269550 | Ga0068867_1002695502 | 258 |
| 36 | 3300014325 | Ga0163163_10027552 | Ga0163163_100275524 | 258 |
| 37 | 3300025945 | Ga0207679_10072289 | Ga0207679_100722893 | 258 |
| 38 | 3300025944 | Ga0207661_10101550 | Ga0207661_101015502 | 259 |
| 39 | 3300031901 | Ga0307406_10026155 | Ga0307406_100261553 | 265 |
| 40 | 3300005334 | Ga0068869_100153424 | Ga0068869_1001534241 | 269 |
| 41 | 3300005335 | Ga0070666_10249030 | Ga0070666_102490302 | 269 |
| 42 | 3300005340 | Ga0070689_100170219 | Ga0070689_1001702191 | 269 |
| 43 | 3300005367 | Ga0070667_100094848 | Ga0070667_1000948482 | 269 |
| 44 | 3300005544 | Ga0070686_100186820 | Ga0070686_1001868202 | 269 |
| 45 | 3300005618 | Ga0068864_100169391 | Ga0068864_1001693912 | 269 |
| 46 | 3300005842 | Ga0068858_100254196 | Ga0068858_1002541963 | 269 |
| 47 | 3300005843 | Ga0068860_100077340 | Ga0068860_1000773404 | 269 |
| 48 | 3300006237 | Ga0097621_100086003 | Ga0097621_1000860033 | 269 |
| 49 | 3300006358 | Ga0068871_100001876 | Ga0068871_1000018762 | 269 |
| 50 | 3300017792 | Ga0163161_10103492 | Ga0163161_101034923 | 269 |
| 51 | 3300025934 | Ga0207686_10031317 | Ga0207686_100313173 | 269 |
| 52 | 3300026035 | Ga0207703_10190659 | Ga0207703_101906593 | 269 |
| 53 | 3300026088 | Ga0207641_10143032 | Ga0207641_101430323 | 269 |
| 54 | 3300026142 | Ga0207698_10081006 | Ga0207698_100810063 | 269 |
| 55 | 3300028381 | Ga0268264_10392177 | Ga0268264_103921772 | 269 |
| 56 | 3300005843 | Ga0068860_100043539 | Ga0068860_1000435395 | 270 |
| 57 | 3300025904 | Ga0207647_10081333 | Ga0207647_100813333 | 270 |
| 58 | 3300025961 | Ga0207712_10029846 | Ga0207712_100298462 | 270 |
| 59 | 3300028381 | Ga0268264_10020991 | Ga0268264_100209912 | 270 |
| 60 | 3300031852 | Ga0307410_10240643 | Ga0307410_102406432 | 270 |
| 61 | 3300032004 | Ga0307414_10013104 | Ga0307414_100131045 | 270 |
| 62 | 3300005330 | Ga0070690_100356906 | Ga0070690_1003569062 | 272 |
| 63 | 3300005535 | Ga0070684_100533489 | Ga0070684_1005334891 | 272 |
| 64 | 3300005578 | Ga0068854_100275446 | Ga0068854_1002754462 | 272 |
| 65 | 3300009098 | Ga0105245_10296010 | Ga0105245_102960102 | 272 |
| 66 | 3300013297 | Ga0157378_10083836 | Ga0157378_100838363 | 272 |
| 67 | 3300013306 | Ga0163162_10220677 | Ga0163162_102206773 | 272 |
| 68 | 3300025909 | Ga0207705_10032113 | Ga0207705_100321132 | 272 |
| 69 | 3300005340 | Ga0070689_100097151 | Ga0070689_1000971512 | 273 |
| 70 | 3300005617 | Ga0068859_100066000 | Ga0068859_1000660003 | 273 |
| 71 | 3300005841 | Ga0068863_100245230 | Ga0068863_1002452302 | 273 |
| 72 | 3300006931 | Ga0097620_100066002 | Ga0097620_1000660023 | 273 |
| 73 | 3300009553 | Ga0105249_10472803 | Ga0105249_104728032 | 273 |
| 74 | 3300013306 | Ga0163162_10265754 | Ga0163162_102657543 | 273 |
| 75 | 3300014325 | Ga0163163_10457440 | Ga0163163_104574402 | 273 |
| 76 | 3300025925 | Ga0207650_10084628 | Ga0207650_100846284 | 273 |
| 77 | 3300005365 | Ga0070688_100261919 | Ga0070688_1002619191 | 274 |
| 78 | 3300005458 | Ga0070681_10279118 | Ga0070681_102791182 | 274 |
| 79 | 3300005466 | Ga0070685_10117753 | Ga0070685_101177532 | 274 |
| 80 | 3300005530 | Ga0070679_100252689 | Ga0070679_1002526893 | 274 |
| 81 | 3300005539 | Ga0068853_100052633 | Ga0068853_1000526332 | 274 |
| 82 | 3300005564 | Ga0070664_100107467 | Ga0070664_1001074672 | 274 |
| 83 | 3300025893 | Ga0207682_10016510 | Ga0207682_100165102 | 274 |
| 84 | 3300025920 | Ga0207649_10113532 | Ga0207649_101135322 | 274 |
| 85 | 3300025926 | Ga0207659_10166171 | Ga0207659_101661713 | 274 |
| 86 | 3300025945 | Ga0207679_10138009 | Ga0207679_101380092 | 274 |
| 87 | 3300049588 | Ga0501072_0043780 | Ga0501072_0043780_252_1097 | 274 |
| 88 | 3300049679 | Ga0501249_036780 | Ga0501249_036780_47_940 | 274 |
| 89 | 3300005549 | Ga0070704_100022424 | Ga0070704_1000224241 | 275 |
| 90 | 3300031824 | Ga0307413_10029329 | Ga0307413_100293292 | 275 |
| 91 | 3300031852 | Ga0307410_10002723 | Ga0307410_100027237 | 275 |
| 92 | 3300031903 | Ga0307407_10000650 | Ga0307407_1000065011 | 275 |
| 93 | 3300031911 | Ga0307412_10004612 | Ga0307412_100046123 | 275 |
| 94 | 3300031995 | Ga0307409_100004012 | Ga0307409_1000040126 | 275 |
| 95 | 3300032005 | Ga0307411_10002312 | Ga0307411_100023127 | 275 |
| 96 | 3300005539 | Ga0068853_100095630 | Ga0068853_1000956301 | 276 |
| 97 | 3300005578 | Ga0068854_100290665 | Ga0068854_1002906652 | 276 |
| 98 | 3300005617 | Ga0068859_100647875 | Ga0068859_1006478752 | 276 |
| 99 | 3300005719 | Ga0068861_100276534 | Ga0068861_1002765342 | 276 |
| 100 | 3300006931 | Ga0097620_100647865 | Ga0097620_1006478652 | 276 |
| 101 | 3300009093 | Ga0105240_10166490 | Ga0105240_101664902 | 276 |
| 102 | 3300009101 | Ga0105247_10007604 | Ga0105247_100076047 | 276 |
| 103 | 3300009174 | Ga0105241_10081769 | Ga0105241_100817692 | 276 |
| 104 | 3300009177 | Ga0105248_10081212 | Ga0105248_100812122 | 276 |
| 105 | 3300013105 | Ga0157369_10053406 | Ga0157369_100534062 | 276 |
| 106 | 3300013296 | Ga0157374_10226064 | Ga0157374_102260641 | 276 |
| 107 | 3300013306 | Ga0163162_10248466 | Ga0163162_102484662 | 276 |
| 108 | 3300013307 | Ga0157372_10198717 | Ga0157372_101987172 | 276 |
| 109 | 3300013308 | Ga0157375_10103500 | Ga0157375_101035001 | 276 |
| 110 | 3300026023 | Ga0207677_10436539 | Ga0207677_104365392 | 276 |
| 111 | 3300026089 | Ga0207648_10384959 | Ga0207648_103849592 | 276 |
| 112 | 3300032002 | Ga0307416_100480148 | Ga0307416_1004801482 | 276 |
| 113 | 3300044673 | Ga0453683_0091122 | Ga0453683_0091122_481_1347 | 276 |
| 114 | 3300046516 | Ga0495628_0323169 | Ga0495628_0323169_23_934 | 276 |
| 115 | 3300048913 | Ga0496110_0364608 | Ga0496110_0364608_172_1038 | 276 |
| 116 | 3300005328 | Ga0070676_10156879 | Ga0070676_101568792 | 277 |
| 117 | 3300005459 | Ga0068867_100332086 | Ga0068867_1003320862 | 277 |
| 118 | 3300005617 | Ga0068859_100066833 | Ga0068859_1000668335 | 277 |
| 119 | 3300006931 | Ga0097620_100066832 | Ga0097620_1000668325 | 277 |
| 120 | 3300009101 | Ga0105247_10093515 | Ga0105247_100935153 | 277 |
| 121 | 3300009174 | Ga0105241_10023114 | Ga0105241_100231145 | 277 |
| 122 | 3300009545 | Ga0105237_10286451 | Ga0105237_102864512 | 277 |
| 123 | 3300046616 | Ga0495668_0001373 | Ga0495668_0001373_4583_5473 | 277 |
| 124 | 3300053153 | Ga0500616_0002862 | Ga0500616_0002862_2419_3258 | 277 |
| 125 | 3300005289 | Ga0065704_10113348 | Ga0065704_101133482 | 278 |
| 126 | 3300005539 | Ga0068853_100163063 | Ga0068853_1001630633 | 278 |
| 127 | 3300005578 | Ga0068854_100018471 | Ga0068854_1000184713 | 278 |
| 128 | 3300005616 | Ga0068852_100205495 | Ga0068852_1002054953 | 278 |
| 129 | 3300009545 | Ga0105237_10074142 | Ga0105237_100741423 | 278 |
| 130 | 3300013100 | Ga0157373_10061474 | Ga0157373_100614742 | 278 |
| 131 | 3300013105 | Ga0157369_10021370 | Ga0157369_100213702 | 278 |
| 132 | 3300013308 | Ga0157375_10492497 | Ga0157375_104924972 | 278 |
| 133 | 3300025913 | Ga0207695_10144045 | Ga0207695_101440452 | 278 |
| 134 | 3300025931 | Ga0207644_10104708 | Ga0207644_101047082 | 278 |
| 135 | 3300026078 | Ga0207702_10329979 | Ga0207702_103299792 | 278 |
| 136 | 3300031548 | Ga0307408_100018360 | Ga0307408_1000183603 | 278 |
| 137 | 3300031548 | Ga0307408_100050873 | Ga0307408_1000508733 | 278 |
| 138 | 3300031731 | Ga0307405_10004995 | Ga0307405_100049954 | 278 |
| 139 | 3300031731 | Ga0307405_10023800 | Ga0307405_100238003 | 278 |
| 140 | 3300031824 | Ga0307413_10006571 | Ga0307413_100065713 | 278 |
| 141 | 3300031824 | Ga0307413_10020665 | Ga0307413_100206652 | 278 |
| 142 | 3300031852 | Ga0307410_10003387 | Ga0307410_100033875 | 278 |
| 143 | 3300031852 | Ga0307410_10016372 | Ga0307410_100163725 | 278 |
| 144 | 3300031901 | Ga0307406_10006994 | Ga0307406_100069942 | 278 |
| 145 | 3300031903 | Ga0307407_10000706 | Ga0307407_100007066 | 278 |
| 146 | 3300031903 | Ga0307407_10057834 | Ga0307407_100578343 | 278 |
| 147 | 3300031903 | Ga0307407_10081175 | Ga0307407_100811751 | 278 |
| 148 | 3300031911 | Ga0307412_10004497 | Ga0307412_100044975 | 278 |
| 149 | 3300031911 | Ga0307412_10036980 | Ga0307412_100369801 | 278 |
| 150 | 3300031995 | Ga0307409_100014696 | Ga0307409_1000146963 | 278 |
| 151 | 3300031995 | Ga0307409_100121668 | Ga0307409_1001216682 | 278 |
| 152 | 3300031995 | Ga0307409_100537638 | Ga0307409_1005376382 | 278 |
| 153 | 3300032002 | Ga0307416_100013600 | Ga0307416_1000136003 | 278 |
| 154 | 3300032002 | Ga0307416_100018189 | Ga0307416_1000181893 | 278 |
| 155 | 3300032004 | Ga0307414_10027596 | Ga0307414_100275963 | 278 |
| 156 | 3300032005 | Ga0307411_10024951 | Ga0307411_100249514 | 278 |
| 157 | 3300032126 | Ga0307415_100014341 | Ga0307415_1000143413 | 278 |
| 158 | 3300032126 | Ga0307415_100033125 | Ga0307415_1000331252 | 278 |
| 159 | 3300037471 | Ga0395905_0011158 | Ga0395905_0011158_5189_6034 | 278 |
| 160 | 3300039453 | Ga0436362_0874482 | Ga0436362_0874482_462_1310 | 278 |
| 161 | 3300049677 | Ga0501247_002898 | Ga0501247_002898_349_1230 | 278 |
| 162 | 3300049682 | Ga0501252_001140 | Ga0501252_001140_542_1423 | 278 |
| 163 | 3300049770 | Ga0501273_004311 | Ga0501273_004311_65_946 | 278 |
| 164 | 3300005295 | Ga0065707_10114447 | Ga0065707_101144473 | 279 |
| 165 | 3300005355 | Ga0070671_100405493 | Ga0070671_1004054932 | 279 |
| 166 | 3300005456 | Ga0070678_100027162 | Ga0070678_1000271623 | 279 |
| 167 | 3300005618 | Ga0068864_100679407 | Ga0068864_1006794071 | 279 |
| 168 | 3300005840 | Ga0068870_10034366 | Ga0068870_100343663 | 279 |
| 169 | 3300009094 | Ga0111539_10027398 | Ga0111539_100273986 | 279 |
| 170 | 3300025907 | Ga0207645_10167162 | Ga0207645_101671622 | 279 |
| 171 | 3300025908 | Ga0207643_10041407 | Ga0207643_100414073 | 279 |
| 172 | 3300026089 | Ga0207648_10306286 | Ga0207648_103062862 | 279 |
| 173 | 3300026095 | Ga0207676_10052192 | Ga0207676_100521922 | 279 |
| 174 | 3300026095 | Ga0207676_10372803 | Ga0207676_103728031 | 279 |
| 175 | 3300026121 | Ga0207683_10029624 | Ga0207683_100296242 | 279 |
| 176 | 3300031901 | Ga0307406_10037694 | Ga0307406_100376942 | 279 |
| 177 | 3300050511 | nmdc:mga08y16_52697_c1 | nmdc:mga08y16_52697_c1_2655_3515 | 279 |
| 178 | 3300005344 | Ga0070661_100006709 | Ga0070661_1000067092 | 280 |
| 179 | 3300005564 | Ga0070664_100116037 | Ga0070664_1001160371 | 280 |
| 180 | 3300005577 | Ga0068857_100085829 | Ga0068857_1000858292 | 280 |
| 181 | 3300005577 | Ga0068857_100087994 | Ga0068857_1000879942 | 280 |
| 182 | 3300005578 | Ga0068854_100046291 | Ga0068854_1000462913 | 280 |
| 183 | 3300006237 | Ga0097621_100332013 | Ga0097621_1003320132 | 280 |
| 184 | 3300010375 | Ga0105239_10448324 | Ga0105239_104483241 | 280 |
| 185 | 3300013296 | Ga0157374_10602070 | Ga0157374_106020701 | 280 |
| 186 | 3300025933 | Ga0207706_10043299 | Ga0207706_100432993 | 280 |
| 187 | 3300025945 | Ga0207679_10438099 | Ga0207679_104380992 | 280 |
| 188 | 3300025949 | Ga0207667_10100583 | Ga0207667_101005832 | 280 |
| 189 | 3300026116 | Ga0207674_10008290 | Ga0207674_1000829011 | 280 |
| 190 | 3300026116 | Ga0207674_10103485 | Ga0207674_101034851 | 280 |
| 191 | 3300031548 | Ga0307408_100324513 | Ga0307408_1003245132 | 280 |
| 192 | 3300031903 | Ga0307407_10195331 | Ga0307407_101953312 | 280 |
| 193 | 3300049669 | Ga0501235_033708 | Ga0501235_033708_108_995 | 280 |
| 194 | 3300049765 | Ga0501268_000850 | Ga0501268_000850_2638_3525 | 280 |
| 195 | 3300005844 | Ga0068862_100661452 | Ga0068862_1006614521 | 281 |
| 196 | 3300013306 | Ga0163162_10183302 | Ga0163162_101833024 | 281 |
| 197 | 3300013306 | Ga0163162_10604534 | Ga0163162_106045342 | 281 |
| 198 | 3300027907 | Ga0207428_10467083 | Ga0207428_104670831 | 281 |
| 199 | 3300053142 | Ga0500577_0000536 | Ga0500577_0000536_613_1464 | 281 |
| 200 | 3300003203 | JGI25406J46586_10001491 | JGI25406J46586_100014916 | 283 |
| 201 | 3300005985 | Ga0081539_10000049 | Ga0081539_10000049141 | 283 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f3v-assembly4.cif.gz_D | crystal structure of yfih with c107a mutation in complex with endogenous udp-murnac | 0.9381 | 39 | 282 |
| 1rw0-assembly1.cif.gz_B | crystal structure of protein yfih from salmonella enterica serovar typhi, pfam duf152 | 0.935 | 39 | 282 |
| 1xaf-assembly1.cif.gz_B | crystal structure of protein of unknown function yfih from shigella flexneri 2a str. 2457t | 0.9277 | 39 | 282 |
| 7f3v-assembly3.cif.gz_C | crystal structure of yfih with c107a mutation in complex with endogenous udp-murnac | 0.9233 | 39 | 282 |
| 1z9t-assembly1.cif.gz_A | crystal structure of a putative laccase (yfih) from escherichia coli at 1.54 a resolution | 0.9195 | 39 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xfjA00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.9157 | 34 | 282 | 3.60.140.10 |
| af_Q9UAG7_265_396_3.40.50.80 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module | 0.9041 | 227 | 247 | 3.40.50.80 |
| 1t8hA00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.8979 | 18 | 281 | 3.60.140.10 |
| af_Q8IV20_177_430_3.60.140.10 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.8961 | 27 | 282 | 3.60.140.10 |
| af_P9WKD5_9_250_3.60.140.10 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.8877 | 22 | 280 | 3.60.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9C2Z1-F1-model_v4 | Laccase domain-containing protein | 0.9891 | 184 | 282 |
GO:0005507
GO:0016740 GO:0016787 |
| AF-A0A1Q7Y840-F1-model_v4 | Purine nucleoside phosphorylase | 0.9875 | 29 | 282 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A353C9T3-F1-model_v4 | Multicopper polyphenol oxidase | 0.9749 | 99 | 281 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A7C2JHY9-F1-model_v4 | Purine nucleoside phosphorylase | 0.9715 | 117 | 280 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A7C6ZP03-F1-model_v4 | Laccase domain-containing protein | 0.966 | 114 | 280 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar