F308567

General Info

Members Datasets Scaffolds Average Seq Length
201 132 402 231

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1010574|Ga0209025_10105744
Length 261
Sequence MSNLFVLYKLDRLVYNRSYKKGMRNRGSKMKRISILIADDEAEIADLIEIHLEKEGYHVVKAADGEEAIHVIETQPIDLVVLDIMMPKMDGYEVTRQIRAKHHMPIIFLSAKTSDFDKVTGLVLGADDYMTKPFTPIELVARVNAQLRRFLTLNQPKVAESKSALAVGGVVIDPERRTVNVYGEQVELTPKEFDILYLLASHPKKVYNVENIFQHVWADDYFEGGNTVMVHIRTLRKKLGEDKRKNKLIKTVWGVGYTFNG

Samples

Sample ID Description Type Environment
1 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
19 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
21 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
28 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
29 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
30 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
31 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
32 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
33 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
34 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
35 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
36 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
37 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
38 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
39 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
40 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
41 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
42 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
43 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
44 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
45 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
46 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
47 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
48 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
49 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
50 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
51 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
52 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
53 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
54 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
55 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
56 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
57 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
58 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
59 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
60 2643221729 Bacillus sp. Root11 Isolate Unclassified
61 2643221730 Bacillus sp. Root131 Isolate Unclassified
62 2671180694 Paenibacillus sp. A3 Isolate Unclassified
63 2684622632 Bacillus cereus 905 Isolate Unclassified
64 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
65 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
66 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
67 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
68 2738541358 Bacillus sp. OV752 Isolate Unclassified
69 2738543006 Bacillus sp. OK077 Isolate Unclassified
70 2738543017 Bacillus sp. OV186 Isolate Unclassified
71 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
72 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
73 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
74 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
75 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
76 2818991441 Niallia circulans 3243 Isolate Rhizosphere
77 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
78 2818991459 Paenibacillus sp. 597 Isolate Unclassified
79 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
80 2842682962 Bacillus sp. R-72492 Isolate Unclassified
81 2849139964 Bacillus sp. R-71875 Isolate Unclassified
82 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
83 2857581216 Bacillus sp. R-71922 Isolate Unclassified
84 2857586860 Bacillus sp. R-71935 Isolate Unclassified
85 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
86 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
87 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
88 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
89 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
90 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
91 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
92 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
93 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
94 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
95 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
96 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
97 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
98 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
99 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
100 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
101 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
102 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
103 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
104 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
105 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
106 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
107 2938917290 Bacillus sp. CR71 Isolate Unclassified
108 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
109 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
110 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
111 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
112 2965761152 Bacillus sp. COPE52 Isolate Unclassified
113 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
114 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
115 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
116 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
117 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
118 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
119 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
120 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
121 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
122 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
123 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
124 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
125 8023438354 Bacillus sp. BH2 Isolate Unclassified
126 8023444577 Bacillus sp. BH32 Isolate Unclassified
127 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
128 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
129 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
130 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
131 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
132 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 53.23
Metatranscriptomes 0
Isolates 46.77

Biome Distribution

Category Percentage (%)
Aerial Root 1
Bulb 0
Endosphere 24.38
Nodule 0.5
Rhizoplane 1.99
Rhizosphere 32.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209025_1010574 3300025294 Bacteria 6235
2 JGI25159J45721_1002527 3300002987 Bacteria 6884
3 JGI25159J45721_1021555 3300002987 Bacteria 1212
4 JGI25151J46595_10002165 3300003187 Bacteria 12176
5 JGI25151J46595_10002827 3300003187 Bacteria 10024
6 JGI25151J46595_10010097 3300003187 Bacteria 4417
7 JGI25151J46595_10015582 3300003187 Bacteria 3345
8 JGI25151J46595_10015857 3300003187 Bacteria 3308
9 JGI25151J46595_10020313 3300003187 Bacteria 2803
10 JGI25151J46595_10021966 3300003187 Bacteria 2658
11 JGI25151J46595_10038685 3300003187 Bacteria 1771
12 JGI25151J46595_10057728 3300003187 Bacteria 1263
13 JGI25151J46595_10057931 3300003187 Bacteria 1259
14 Ga0055532_1000061 3300003758 Bacteria 149797
15 Ga0055535_1003822 3300003761 Bacteria 3993
16 Ga0055536_1017449 3300003781 Bacteria 2350
17 Ga0055541_1001229 3300003841 Bacteria 5671
18 Ga0055541_1008809 3300003841 Bacteria 1592
19 Ga0065715_10169537 3300005293 Bacteria 1558
20 Ga0070674_100173235 3300005356 Bacteria 1647
21 Ga0068862_100129755 3300005844 Bacteria 2229
22 Ga0105251_10012383 3300009011 Bacteria 4826
23 Ga0105244_10007460 3300009036 Bacteria 6953
24 Ga0105244_10013302 3300009036 Bacteria 4816
25 Ga0105244_10024579 3300009036 Bacteria 3286
26 Ga0105244_10071202 3300009036 Bacteria 1734
27 Ga0105244_10133632 3300009036 Bacteria 1196
28 Ga0105244_10184964 3300009036 Bacteria 987
29 Ga0105250_10005652 3300009092 Bacteria 5584
30 Ga0105250_10007970 3300009092 Bacteria 4522
31 Ga0105250_10009336 3300009092 Bacteria 4135
32 Ga0105250_10020967 3300009092 Bacteria 2639
33 Ga0111539_10279479 3300009094 Bacteria 1943
34 Ga0111539_10456152 3300009094 Bacteria 1489
35 Ga0105246_10001680 3300011119 Bacteria 13179
36 Ga0209566_100022 3300025225 Bacteria 403259
37 Ga0209566_100052 3300025225 Bacteria 231848
38 Ga0209566_100461 3300025225 Bacteria 29354
39 Ga0209147_100020 3300025229 Bacteria 474055
40 Ga0209147_108901 3300025229 Bacteria 1219
41 Ga0209437_100875 3300025233 Bacteria 12280
42 Ga0209258_103778 3300025242 Bacteria 3115
43 Ga0209130_1000908 3300025284 Bacteria 23899
44 Ga0209130_1003217 3300025284 Bacteria 7185
45 Ga0209130_1006565 3300025284 Bacteria 3757
46 Ga0209130_1020145 3300025284 Bacteria 1532
47 Ga0209676_1000274 3300025292 Bacteria 107505
48 Ga0209676_1045976 3300025292 Bacteria 1184
49 Ga0209025_1000156 3300025294 Bacteria 168932
50 Ga0209025_1000465 3300025294 Bacteria 79330
51 Ga0209025_1000851 3300025294 Bacteria 48307
52 Ga0209025_1001029 3300025294 Bacteria 40908
53 Ga0209025_1002412 3300025294 Bacteria 19909
54 Ga0209025_1004945 3300025294 Bacteria 11185
55 Ga0209025_1008830 3300025294 Bacteria 7158
56 Ga0209025_1009022 3300025294 Bacteria 7038
57 Ga0209025_1010524 3300025294 Bacteria 6255
58 Ga0209025_1010864 3300025294 Bacteria 6102
59 Ga0209025_1012438 3300025294 Bacteria 5452
60 Ga0209025_1012894 3300025294 Bacteria 5313
61 Ga0209025_1017543 3300025294 Bacteria 4122
62 Ga0209025_1021454 3300025294 Bacteria 3477
63 Ga0209025_1027549 3300025294 Bacteria 2815
64 Ga0209025_1029578 3300025294 Bacteria 2645
65 Ga0209025_1035449 3300025294 Bacteria 2254
66 Ga0209025_1049165 3300025294 Bacteria 1701
67 Ga0207696_1000583 3300025711 Bacteria 28351
68 Ga0207696_1003331 3300025711 Bacteria 7389
69 Ga0207696_1008140 3300025711 Bacteria 4042
70 Ga0207655_1001501 3300025728 Bacteria 21321
71 Ga0207655_1018368 3300025728 Bacteria 3713
72 Ga0207655_1018683 3300025728 Bacteria 3662
73 Ga0207713_1007927 3300025735 Bacteria 6189
74 Ga0207669_10467221 3300025937 Bacteria 1003
75 Ga0268265_10177751 3300028380 Bacteria 1826
76 Ga0237817_10320 3300030083 Bacteria 9632
77 Ga0237817_10610 3300030083 Bacteria 3612
78 Ga0237819_00060 3300038705 Bacteria 38240
79 Ga0237819_00422 3300038705 Bacteria 14548
80 Ga0466967_0012491 3300045976 Bacteria 6500
81 Ga0495590_0060607 3300046457 Bacteria 1325
82 Ga0495590_0061022 3300046457 Bacteria 1320
83 Ga0495637_0011692 3300046520 Bacteria 4213
84 Ga0496102_0040942 3300048905 Bacteria 4194
85 Ga0496109_0661972 3300048912 Bacteria 981
86 Ga0496116_0007582 3300048919 Bacteria 9590
87 Ga0496116_0058234 3300048919 Bacteria 2521
88 Ga0496116_0080266 3300048919 Bacteria 2027
89 Ga0496117_0031889 3300048920 Bacteria 4016
90 Ga0496118_0219042 3300048921 Bacteria 1110
91 Ga0496119_0003466 3300048922 Bacteria 16361
92 Ga0496120_0001944 3300048923 Bacteria 22639
93 Ga0496121_0320739 3300048924 Bacteria 1043
94 Ga0496122_0010491 3300048925 Bacteria 9537
95 Ga0496122_0025730 3300048925 Bacteria 5099
96 Ga0496122_0035185 3300048925 Bacteria 4082
97 Ga0496123_0065541 3300048926 Bacteria 2308
98 Ga0496123_0113598 3300048926 Bacteria 1542
99 Ga0496123_0181445 3300048926 Bacteria 1099
100 Ga0496124_0000522 3300048927 Bacteria 65274
101 Ga0496124_0074058 3300048927 Bacteria 2816
102 Ga0496125_0006400 3300048928 Bacteria 12755
103 Ga0496126_0000444 3300048929 Bacteria 82666
104 Ga0496126_0000643 3300048929 Bacteria 65011
105 Ga0501208_016378 3300049655 Bacteria 1152
106 Ga0501217_002389 3300049661 Bacteria 3692
107 nmdc:mga08y16_519389_c1 3300050511 Bacteria 1208
108 2512637412 2512564013 Bacteria 6286191
109 2524187417 2524023129 Bacteria 6762600
110 2550902644 2548877040 Bacteria 7507281
111 2553397115 2551306519 Bacteria 5465154
112 2571533455 2571042143 Bacteria 6986194
113 2578334787 2576861424 Bacteria 5270569
114 2587741618 2585428059 Bacteria 8696589
115 2595090228 2593339131 Bacteria 5116855
116 2595315717 2593339198 Bacteria 7267884
117 2601639515 2600255286 Bacteria 5390125
118 2643738560 2643221543 Bacteria 6628015
119 2644424130 2643221676 Bacteria 8119172
120 2644706156 2643221729 Bacteria 6621700
121 2644712838 2643221730 Bacteria 6523787
122 2673820261 2671180694 Bacteria 7506943
123 2685152834 2684622632 Bacteria 5380049
124 2698320340 2695420987 Bacteria 6152737
125 2698324423 2695420987 Bacteria 6152737
126 2705996745 2703719227 Bacteria 5631989
127 2721507984 2718218445 Bacteria 5113413
128 2728535127 2728368933 Bacteria 7044283
129 2739155583 2738541358 Bacteria 5932299
130 2739157388 2738541358 Bacteria 5932299
131 2739208362 2738543006 Bacteria 5904091
132 2739209481 2738543006 Bacteria 5904091
133 2739270486 2738543017 Bacteria 4271950
134 2745167666 2744054657 Bacteria 5016802
135 2757567456 2757320391 Bacteria 4746095
136 2777761239 2775507177 Bacteria 4384303
137 2816864832 2816332186 Bacteria 5331395
138 2817618964 2816332336 Bacteria 5207640
139 2819569232 2818991441 Bacteria 5062707
140 2819581746 2818991443 Bacteria 6598732
141 2819668530 2818991459 Bacteria 8736032
142 2819673858 2818991459 Bacteria 8736032
143 2821118105 2821111986 Bacteria 6894338
144 2842683683 2842682962 Bacteria 5589973
145 2849142249 2849139964 Bacteria 5613304
146 2857454329 2857453340 Bacteria 8090534
147 2857585802 2857581216 Bacteria 5522813
148 2857590705 2857586860 Bacteria 4354574
149 2857593827 2857591370 Bacteria 6569758
150 2864738512 2864733723 Bacteria 6770668
151 2865002974 2865002811 Bacteria 6333767
152 2885528503 2885526491 Bacteria 7164189
153 2888584805 2888578766 Bacteria 6743310
154 2889043202 2889042446 Bacteria 7618936
155 2889052729 2889049205 Bacteria 7524325
156 2904114372 2904113452 Bacteria 7796941
157 2904168420 2904162308 Bacteria 7086713
158 2904496789 2904490793 Bacteria 7046938
159 2904757507 2904755435 Bacteria 7986759
160 2907204007 2907202186 Bacteria 6632024
161 2915598178 2915597211 Bacteria 6475886
162 2919166075 2919160200 Bacteria 6929020
163 2919430382 2919425241 Bacteria 8055701
164 2929189721 2929183550 Bacteria 6377511
165 2929211698 2929206907 Bacteria 5918291
166 2929238539 2929233124 Bacteria 5948380
167 2931386662 2931384279 Bacteria 7299545
168 2936342462 2936340661 Bacteria 5139038
169 2936366372 2936361878 Bacteria 5632809
170 2938649287 2938649242 Bacteria 7118381
171 2938920908 2938917290 Bacteria 5914775
172 2938922737 2938917290 Bacteria 5914775
173 2939684917 2939679117 Bacteria 6921672
174 2945994728 2945991243 Bacteria 7008369
175 2946057523 2946053406 Bacteria 6978655
176 2947431611 2947426588 Bacteria 5357194
177 2965761657 2965761152 Bacteria 5806513
178 2965766033 2965761152 Bacteria 5806513
179 2968564274 2968558590 Bacteria 6956864
180 2971405665 2971403814 Bacteria 7370929
181 2971409619 2971403814 Bacteria 7370929
182 2971415280 2971410472 Bacteria 8311090
183 2979088526 2979083700 Bacteria 5894929
184 2980183814 2980182181 Bacteria 9454109
185 2980188332 2980182181 Bacteria 9454109
186 2984528054 2984527788 Bacteria 5288478
187 2984534164 2984532647 Bacteria 5288506
188 2988231560 2988225383 Bacteria 7221625
189 2996633528 2996632988 Bacteria 6921523
190 3006827836 3006826541 Bacteria 4678913
191 8002324305 8002317523 Bacteria 8051857
192 8022624795 8022621104 Bacteria 5241040
193 8023439256 8023438354 Bacteria 5779374
194 8023445744 8023444577 Bacteria 5661597
195 8046999205 8046991243 Bacteria 8497463
196 8054468450 8054465665 Bacteria 7323556
197 8055635266 8055632911 Bacteria 5283357
198 8055636273 8055632911 Bacteria 5283357
199 8056540658 8056533031 Bacteria 8964429
200 8057477570 8057473075 Bacteria 5892720
201 8057636844 8057632132 Bacteria 4726859
202 Ga0209025_1010574
203 JGI25159J45721_1002527
204 JGI25159J45721_1021555
205 JGI25151J46595_10002165
206 JGI25151J46595_10002827
207 JGI25151J46595_10010097
208 JGI25151J46595_10015582
209 JGI25151J46595_10015857
210 JGI25151J46595_10020313
211 JGI25151J46595_10021966
212 JGI25151J46595_10038685
213 JGI25151J46595_10057728
214 JGI25151J46595_10057931
215 Ga0055532_1000061
216 Ga0055535_1003822
217 Ga0055536_1017449
218 Ga0055541_1001229
219 Ga0055541_1008809
220 Ga0065715_10169537
221 Ga0070674_100173235
222 Ga0068862_100129755
223 Ga0105251_10012383
224 Ga0105244_10007460
225 Ga0105244_10013302
226 Ga0105244_10024579
227 Ga0105244_10071202
228 Ga0105244_10133632
229 Ga0105244_10184964
230 Ga0105250_10005652
231 Ga0105250_10007970
232 Ga0105250_10009336
233 Ga0105250_10020967
234 Ga0111539_10279479
235 Ga0111539_10456152
236 Ga0105246_10001680
237 Ga0209566_100022
238 Ga0209566_100052
239 Ga0209566_100461
240 Ga0209147_100020
241 Ga0209147_108901
242 Ga0209437_100875
243 Ga0209258_103778
244 Ga0209130_1000908
245 Ga0209130_1003217
246 Ga0209130_1006565
247 Ga0209130_1020145
248 Ga0209676_1000274
249 Ga0209676_1045976
250 Ga0209025_1000156
251 Ga0209025_1000465
252 Ga0209025_1000851
253 Ga0209025_1001029
254 Ga0209025_1002412
255 Ga0209025_1004945
256 Ga0209025_1008830
257 Ga0209025_1009022
258 Ga0209025_1010524
259 Ga0209025_1010864
260 Ga0209025_1012438
261 Ga0209025_1012894
262 Ga0209025_1017543
263 Ga0209025_1021454
264 Ga0209025_1027549
265 Ga0209025_1029578
266 Ga0209025_1035449
267 Ga0209025_1049165
268 Ga0207696_1000583
269 Ga0207696_1003331
270 Ga0207696_1008140
271 Ga0207655_1001501
272 Ga0207655_1018368
273 Ga0207655_1018683
274 Ga0207713_1007927
275 Ga0207669_10467221
276 Ga0268265_10177751
277 Ga0237817_10320
278 Ga0237817_10610
279 Ga0237819_00060
280 Ga0237819_00422
281 Ga0466967_0012491
282 Ga0495590_0060607
283 Ga0495590_0061022
284 Ga0495637_0011692
285 Ga0496102_0040942
286 Ga0496109_0661972
287 Ga0496116_0007582
288 Ga0496116_0058234
289 Ga0496116_0080266
290 Ga0496117_0031889
291 Ga0496118_0219042
292 Ga0496119_0003466
293 Ga0496120_0001944
294 Ga0496121_0320739
295 Ga0496122_0010491
296 Ga0496122_0025730
297 Ga0496122_0035185
298 Ga0496123_0065541
299 Ga0496123_0113598
300 Ga0496123_0181445
301 Ga0496124_0000522
302 Ga0496124_0074058
303 Ga0496125_0006400
304 Ga0496126_0000444
305 Ga0496126_0000643
306 Ga0501208_016378
307 Ga0501217_002389
308 nmdc:mga08y16_519389_c1
309 2512637412
310 2524187417
311 2550902644
312 2553397115
313 2571533455
314 2578334787
315 2587741618
316 2595090228
317 2595315717
318 2601639515
319 2643738560
320 2644424130
321 2644706156
322 2644712838
323 2673820261
324 2685152834
325 2698320340
326 2698324423
327 2705996745
328 2721507984
329 2728535127
330 2739155583
331 2739157388
332 2739208362
333 2739209481
334 2739270486
335 2745167666
336 2757567456
337 2777761239
338 2816864832
339 2817618964
340 2819569232
341 2819581746
342 2819668530
343 2819673858
344 2821118105
345 2842683683
346 2849142249
347 2857454329
348 2857585802
349 2857590705
350 2857593827
351 2864738512
352 2865002974
353 2885528503
354 2888584805
355 2889043202
356 2889052729
357 2904114372
358 2904168420
359 2904496789
360 2904757507
361 2907204007
362 2915598178
363 2919166075
364 2919430382
365 2929189721
366 2929211698
367 2929238539
368 2931386662
369 2936342462
370 2936366372
371 2938649287
372 2938920908
373 2938922737
374 2939684917
375 2945994728
376 2946057523
377 2947431611
378 2965761657
379 2965766033
380 2968564274
381 2971405665
382 2971409619
383 2971415280
384 2979088526
385 2980183814
386 2980188332
387 2984528054
388 2984534164
389 2988231560
390 2996633528
391 3006827836
392 8002324305
393 8022624795
394 8023439256
395 8023445744
396 8046999205
397 8054468450
398 8055635266
399 8055636273
400 8056540658
401 8057477570
402 8057636844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

35

144

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

183

259

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9894 5 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9859 5 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9856 5 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9855 5 120
1nxo-assembly1.cif.gz_A-2 micarec ph7.0 0.9736 5 121
ID Description Score Start End Superfamily
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9864 5 82 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.983 4 82 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9787 5 82 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9771 4 82 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.977 4 82 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2A5G3C3-F1-model_v4 Two-component system response regulator 0.9796 4 118 GO:0000160
AF-A0A7W0UFG7-F1-model_v4 Response regulator 0.9751 1 119 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7Y1XLC9-F1-model_v4 Response regulator 0.9743 2 101 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A534PI46-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9738 4 119 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A3N5E267-F1-model_v4 Response regulator 0.9732 1 119 GO:0000160

Map