F307776

General Info

Members Datasets Scaffolds Average Seq Length
200 152 200 73

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0876841|Ga0501073_0876841_291_542
Length 83
Sequence VLRECALWLTVRVAVTIYGVCAVTFMMVMYALESRGPRFVLGFAFGCVLSSIYGFLSGAWPFGVVELIWAGIAVRRYQQVAAA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
65 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
66 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 13.5
Rhizosphere 75.5
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_11546727 3300005328 Unclassified 512
2 Ga0070690_101074030 3300005330 Unclassified 637
3 Ga0070689_101388665 3300005340 Bacteria 634
4 Ga0070689_101977690 3300005340 Bacteria 533
5 Ga0070692_10942047 3300005345 Bacteria 600
6 Ga0070668_100805441 3300005347 Bacteria 835
7 Ga0070675_101303002 3300005354 Unclassified 669
8 Ga0070673_101907757 3300005364 Unclassified 563
9 Ga0070713_101475268 3300005436 Unclassified 660
10 Ga0070710_10476473 3300005437 Bacteria 850
11 Ga0070705_100446960 3300005440 Bacteria 969
12 Ga0070694_101241721 3300005444 Unclassified 625
13 Ga0070708_101741915 3300005445 Unclassified 579
14 Ga0070706_100217899 3300005467 Bacteria 1782
15 Ga0070695_100437889 3300005545 Bacteria 999
16 Ga0070696_100223667 3300005546 Bacteria 1413
17 Ga0070704_100429140 3300005549 Unclassified 1133
18 Ga0070704_101451056 3300005549 Bacteria 630
19 Ga0068856_101360575 3300005614 Bacteria 725
20 Ga0068856_102147112 3300005614 Bacteria 568
21 Ga0068864_102023345 3300005618 Unclassified 582
22 Ga0068862_102278948 3300005844 Bacteria 553
23 Ga0081455_10009282 3300005937 Bacteria 10130
24 Ga0070717_11483257 3300006028 Bacteria 615
25 Ga0075368_10331452 3300006042 Bacteria 660
26 Ga0070716_100339073 3300006173 Bacteria 1060
27 Ga0070712_100012521 3300006175 Bacteria 5392
28 Ga0075367_10338303 3300006178 Bacteria 949
29 Ga0075428_100134444 3300006844 Bacteria 2689
30 Ga0075428_100670212 3300006844 Bacteria 1106
31 Ga0075430_100249502 3300006846 Bacteria 1471
32 Ga0075431_100117417 3300006847 Bacteria 2745
33 Ga0075434_101586787 3300006871 Bacteria 663
34 Ga0075436_100308029 3300006914 Bacteria 1136
35 Ga0075435_100638954 3300007076 Unclassified 924
36 Ga0075435_101039826 3300007076 Bacteria 715
37 Ga0105240_11912214 3300009093 Unclassified 617
38 Ga0105240_11964775 3300009093 Unclassified 608
39 Ga0111539_11362314 3300009094 Bacteria 823
40 Ga0105245_10034199 3300009098 Bacteria 4507
41 Ga0105245_10990861 3300009098 Unclassified 884
42 Ga0105245_12135799 3300009098 Bacteria 614
43 Ga0114129_11256041 3300009147 Bacteria 920
44 Ga0114129_11793823 3300009147 Bacteria 746
45 Ga0105243_11040187 3300009148 Bacteria 824
46 Ga0105242_10082832 3300009176 Bacteria 2685
47 Ga0105248_12614051 3300009177 Unclassified 575
48 Ga0105238_11008149 3300009551 Bacteria 854
49 Ga0105239_10685686 3300010375 Bacteria 1171
50 Ga0105246_12190710 3300011119 Bacteria 538
51 Ga0157374_11557042 3300013296 Bacteria 685
52 Ga0157375_13575403 3300013308 Unclassified 517
53 Ga0157379_10644977 3300014968 Bacteria 991
54 Ga0157379_10974201 3300014968 Bacteria 807
55 Ga0213876_10019831 3300021384 Bacteria 3552
56 Ga0213876_10395000 3300021384 Unclassified 735
57 Ga0207692_10367985 3300025898 Bacteria 890
58 Ga0207684_10219766 3300025910 Bacteria 1640
59 Ga0207663_11466033 3300025916 Bacteria 550
60 Ga0207649_11479762 3300025920 Bacteria 537
61 Ga0207694_10925970 3300025924 Bacteria 737
62 Ga0207687_10134920 3300025927 Bacteria 1866
63 Ga0207686_10412324 3300025934 Bacteria 1032
64 Ga0207686_11770572 3300025934 Unclassified 511
65 Ga0207709_11138058 3300025935 Bacteria 642
66 Ga0207670_11718700 3300025936 Bacteria 534
67 Ga0207665_10385227 3300025939 Bacteria 1065
68 Ga0207661_10989739 3300025944 Unclassified 775
69 Ga0207661_11728794 3300025944 Bacteria 571
70 Ga0207658_10198887 3300025986 Bacteria 1672
71 Ga0207677_11397102 3300026023 Bacteria 645
72 Ga0207677_11953920 3300026023 Bacteria 545
73 Ga0207703_10090190 3300026035 Bacteria 2576
74 Ga0207648_11455407 3300026089 Bacteria 644
75 Ga0207698_11117428 3300026142 Bacteria 801
76 Ga0268266_11263415 3300028379 Bacteria 714
77 Ga0265327_10016272 3300031251 Bacteria 4735
78 Ga0373930_0150524 3300034816 Unclassified 583
79 Ga0373928_0013520 3300035084 Bacteria 1640
80 Ga0373932_0011742 3300035112 Bacteria 2146
81 Ga0373931_0000019 3300035691 Bacteria 186534
82 Ga0373937_0352268 3300036401 Bacteria 1395
83 Ga0373937_0923942 3300036401 Bacteria 821
84 Ga0436364_0962083 3300037853 Bacteria 1357
85 Ga0436364_1497096 3300037853 Bacteria 1208
86 Ga0436365_0536083 3300039437 Bacteria 5587
87 Ga0436365_1496473 3300039437 Bacteria 1120
88 Ga0436365_1839289 3300039437 Bacteria 761
89 Ga0436363_0026671 3300039450 Bacteria 728
90 Ga0436363_1031858 3300039450 Bacteria 607
91 Ga0436362_0810176 3300039453 Bacteria 629
92 Ga0453683_0489143 3300044673 Unclassified 798
93 Ga0466971_0123332 3300044719 Bacteria 1200
94 Ga0466958_0347898 3300045836 Unclassified 954
95 Ga0495592_0956409 3300046454 Unclassified 501
96 Ga0495629_0182159 3300046459 Bacteria 1456
97 Ga0495629_1123204 3300046459 Unclassified 507
98 Ga0495641_0261227 3300046461 Unclassified 779
99 Ga0495639_0592202 3300046475 Unclassified 570
100 Ga0495662_0327647 3300046476 Bacteria 753
101 Ga0495608_0301576 3300046511 Archaea 992
102 Ga0495618_0479351 3300046514 Unclassified 752
103 Ga0495628_0192736 3300046516 Bacteria 1538
104 Ga0495630_0004600 3300046517 Bacteria 9672
105 Ga0495640_0169367 3300046533 Bacteria 1396
106 Ga0495640_0337651 3300046533 Bacteria 931
107 Ga0495640_0492873 3300046533 Bacteria 746
108 Ga0495586_0834033 3300046535 Unclassified 532
109 Ga0495645_0235095 3300046543 Bacteria 1226
110 Ga0495657_0282837 3300046675 Bacteria 992
111 Ga0495599_0606600 3300046678 Bacteria 637
112 Ga0495646_0259900 3300046680 Bacteria 928
113 Ga0495658_0390287 3300046683 Bacteria 887
114 Ga0495613_0698730 3300046689 Unclassified 668
115 Ga0495624_0912451 3300046690 Unclassified 517
116 Ga0495600_0598685 3300046809 Bacteria 670
117 Ga0495604_0209367 3300047317 Bacteria 1348
118 Ga0495636_0609984 3300047318 Unclassified 534
119 Ga0495674_0685858 3300047319 Bacteria 805
120 Ga0495680_0068193 3300047322 Bacteria 2718
121 Ga0495684_0500371 3300047471 Bacteria 836
122 Ga0495684_0997446 3300047471 Bacteria 532
123 Ga0496100_0025287 3300048903 Bacteria 3631
124 Ga0496100_1216324 3300048903 Unclassified 594
125 Ga0496101_0268924 3300048904 Bacteria 1330
126 Ga0496102_1351289 3300048905 Unclassified 632
127 Ga0496103_0043309 3300048906 Bacteria 2771
128 Ga0496104_0018747 3300048907 Bacteria 6319
129 Ga0496104_0022101 3300048907 Bacteria 5846
130 Ga0496104_0469520 3300048907 Bacteria 1170
131 Ga0496105_0081354 3300048908 Bacteria 2675
132 Ga0496105_0103298 3300048908 Bacteria 2353
133 Ga0496105_0140903 3300048908 Bacteria 1985
134 Ga0496105_0932818 3300048908 Unclassified 653
135 Ga0496105_1320986 3300048908 Bacteria 526
136 Ga0496107_0173216 3300048910 Bacteria 1602
137 Ga0496108_0564317 3300048911 Bacteria 993
138 Ga0496109_0011430 3300048912 Bacteria 7632
139 Ga0496109_0417401 3300048912 Bacteria 1268
140 Ga0496110_0163847 3300048913 Bacteria 2016
141 Ga0496110_0286565 3300048913 Bacteria 1500
142 Ga0496111_0805005 3300048914 Bacteria 680
143 Ga0496111_1208997 3300048914 Unclassified 535
144 Ga0496112_0108296 3300048915 Bacteria 2749
145 Ga0496113_0107103 3300048916 Bacteria 2172
146 Ga0496113_0784864 3300048916 Bacteria 757
147 Ga0496114_0013407 3300048917 Bacteria 6572
148 Ga0496115_0004103 3300048918 Bacteria 10510
149 Ga0496115_1035014 3300048918 Bacteria 626
150 Ga0496116_0000740 3300048919 Bacteria 41619
151 Ga0496117_0006929 3300048920 Bacteria 11233
152 Ga0496118_0002323 3300048921 Bacteria 25815
153 Ga0496118_0056747 3300048921 Bacteria 2941
154 Ga0496119_0009002 3300048922 Bacteria 8664
155 Ga0496119_0057518 3300048922 Bacteria 2349
156 Ga0496120_0002441 3300048923 Bacteria 18813
157 Ga0496121_0896843 3300048924 Bacteria 510
158 Ga0501034_0527235 3300049571 Bacteria 1092
159 Ga0501034_1398833 3300049571 Unclassified 575
160 Ga0501036_0295659 3300049572 Bacteria 1355
161 Ga0501037_0153445 3300049573 Bacteria 1645
162 Ga0501040_0106107 3300049576 Bacteria 1963
163 Ga0501042_0288300 3300049578 Unclassified 1186
164 Ga0501046_0145732 3300049580 Bacteria 1789
165 Ga0501047_0340549 3300049581 Bacteria 1337
166 Ga0501048_0403812 3300049582 Bacteria 977
167 Ga0501068_0666721 3300049584 Bacteria 679
168 Ga0501070_0003804 3300049586 Bacteria 13028
169 Ga0501070_0433761 3300049586 Bacteria 1060
170 Ga0501072_0225079 3300049588 Bacteria 1495
171 Ga0501073_0416198 3300049589 Bacteria 929
172 Ga0501073_0760793 3300049589 Unclassified 668
173 Ga0501073_0876841 3300049589 Bacteria 618
174 Ga0501077_0546688 3300049593 Unclassified 743
175 Ga0501079_0578608 3300049741 Unclassified 883
176 Ga0501079_1388728 3300049741 Unclassified 553
177 Ga0501083_0224650 3300049744 Bacteria 1223
178 Ga0501035_0185814 3300049822 Bacteria 1789
179 Ga0501044_0187216 3300049823 Bacteria 2034
180 Ga0501044_0685352 3300049823 Unclassified 911
181 Ga0501045_0284730 3300049824 Bacteria 1230
182 nmdc:mga06z11_356553_c1 3300050494 Bacteria 876
183 nmdc:mga0qj67_376902_c1 3300050509 Bacteria 1146
184 nmdc:mga06r32_368085_c1 3300050510 Bacteria 1421
185 nmdc:mga08y16_1094781_c1 3300050511 Bacteria 772
186 nmdc:mga0n895_2203945_c1 3300050512 Bacteria 506
187 nmdc:mga0rr50_1207864_c1 3300050513 Bacteria 642
188 nmdc:mga08x19_178807_c1 3300050514 Bacteria 1447
189 nmdc:mga08x19_617584_c1 3300050514 Bacteria 768
190 Ga0495601_0131071 3300053077 Bacteria 1633
191 Ga0495601_0162256 3300053077 Bacteria 1461
192 Ga0495601_0212362 3300053077 Bacteria 1264
193 Ga0495595_0304905 3300053084 Bacteria 801
194 Ga0495595_0658377 3300053084 Unclassified 536
195 Ga0495619_0075542 3300053085 Bacteria 2261
196 Ga0495619_0114131 3300053085 Bacteria 1848
197 Ga0500595_020462 3300053119 Bacteria 2381
198 Ga0500579_271357 3300053143 Unclassified 528
199 Ga0501084_0411260 3300054114 Bacteria 1143
200 Ga0530510_0190489 3300061734 Bacteria 1522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_11964775 Ga0105240_119647751 67
2 3300006871 Ga0075434_101586787 Ga0075434_1015867872 68
3 3300049573 Ga0501037_0153445 Ga0501037_0153445_88_303 68
4 3300049584 Ga0501068_0666721 Ga0501068_0666721_221_436 68
5 3300049586 Ga0501070_0433761 Ga0501070_0433761_636_851 68
6 3300049589 Ga0501073_0416198 Ga0501073_0416198_145_360 68
7 3300049823 Ga0501044_0187216 Ga0501044_0187216_412_627 68
8 3300050512 nmdc:mga0n895_2203945_c1 nmdc:mga0n895_2203945_c1_97_303 68
9 3300005614 Ga0068856_101360575 Ga0068856_1013605752 69
10 3300006914 Ga0075436_100308029 Ga0075436_1003080292 69
11 3300007076 Ga0075435_100638954 Ga0075435_1006389542 69
12 3300009147 Ga0114129_11793823 Ga0114129_117938231 69
13 3300025920 Ga0207649_11479762 Ga0207649_114797621 69
14 3300025944 Ga0207661_10989739 Ga0207661_109897392 69
15 3300031251 Ga0265327_10016272 Ga0265327_100162722 69
16 3300037853 Ga0436364_0962083 Ga0436364_0962083_942_1151 69
17 3300039450 Ga0436363_0026671 Ga0436363_0026671_71_280 69
18 3300050514 nmdc:mga08x19_178807_c1 nmdc:mga08x19_178807_c1_100_309 69
19 3300005937 Ga0081455_10009282 Ga0081455_100092828 70
20 3300009093 Ga0105240_11912214 Ga0105240_119122142 70
21 3300034816 Ga0373930_0150524 Ga0373930_0150524_96_308 70
22 3300035084 Ga0373928_0013520 Ga0373928_0013520_58_270 70
23 3300035112 Ga0373932_0011742 Ga0373932_0011742_260_472 70
24 3300035691 Ga0373931_0000019 Ga0373931_0000019_30119_30331 70
25 3300044719 Ga0466971_0123332 Ga0466971_0123332_213_425 70
26 3300045836 Ga0466958_0347898 Ga0466958_0347898_379_591 70
27 3300005345 Ga0070692_10942047 Ga0070692_109420472 71
28 3300005347 Ga0070668_100805441 Ga0070668_1008054412 71
29 3300005364 Ga0070673_101907757 Ga0070673_1019077572 71
30 3300005436 Ga0070713_101475268 Ga0070713_1014752681 71
31 3300005618 Ga0068864_102023345 Ga0068864_1020233452 71
32 3300006844 Ga0075428_100134444 Ga0075428_1001344444 71
33 3300006844 Ga0075428_100670212 Ga0075428_1006702125 71
34 3300006846 Ga0075430_100249502 Ga0075430_1002495023 71
35 3300006847 Ga0075431_100117417 Ga0075431_1001174174 71
36 3300009094 Ga0111539_11362314 Ga0111539_113623142 71
37 3300009098 Ga0105245_10990861 Ga0105245_109908612 71
38 3300009147 Ga0114129_11256041 Ga0114129_112560412 71
39 3300009148 Ga0105243_11040187 Ga0105243_110401872 71
40 3300010375 Ga0105239_10685686 Ga0105239_106856862 71
41 3300011119 Ga0105246_12190710 Ga0105246_121907102 71
42 3300013296 Ga0157374_11557042 Ga0157374_115570422 71
43 3300013308 Ga0157375_13575403 Ga0157375_135754031 71
44 3300025935 Ga0207709_11138058 Ga0207709_111380582 71
45 3300026142 Ga0207698_11117428 Ga0207698_111174282 71
46 3300036401 Ga0373937_0923942 Ga0373937_0923942_545_760 71
47 3300039450 Ga0436363_1031858 Ga0436363_1031858_342_557 71
48 3300039453 Ga0436362_0810176 Ga0436362_0810176_19_234 71
49 3300046459 Ga0495629_0182159 Ga0495629_0182159_348_563 71
50 3300046459 Ga0495629_1123204 Ga0495629_1123204_162_377 71
51 3300046461 Ga0495641_0261227 Ga0495641_0261227_542_757 71
52 3300046475 Ga0495639_0592202 Ga0495639_0592202_259_474 71
53 3300046476 Ga0495662_0327647 Ga0495662_0327647_479_694 71
54 3300046511 Ga0495608_0301576 Ga0495608_0301576_176_391 71
55 3300046514 Ga0495618_0479351 Ga0495618_0479351_200_415 71
56 3300046516 Ga0495628_0192736 Ga0495628_0192736_363_578 71
57 3300046517 Ga0495630_0004600 Ga0495630_0004600_9282_9497 71
58 3300046533 Ga0495640_0337651 Ga0495640_0337651_675_890 71
59 3300046535 Ga0495586_0834033 Ga0495586_0834033_220_435 71
60 3300046543 Ga0495645_0235095 Ga0495645_0235095_243_458 71
61 3300046680 Ga0495646_0259900 Ga0495646_0259900_614_829 71
62 3300046683 Ga0495658_0390287 Ga0495658_0390287_583_798 71
63 3300046689 Ga0495613_0698730 Ga0495613_0698730_153_368 71
64 3300046690 Ga0495624_0912451 Ga0495624_0912451_206_421 71
65 3300046809 Ga0495600_0598685 Ga0495600_0598685_73_288 71
66 3300047317 Ga0495604_0209367 Ga0495604_0209367_133_348 71
67 3300047318 Ga0495636_0609984 Ga0495636_0609984_247_462 71
68 3300047319 Ga0495674_0685858 Ga0495674_0685858_345_560 71
69 3300047322 Ga0495680_0068193 Ga0495680_0068193_198_413 71
70 3300047471 Ga0495684_0500371 Ga0495684_0500371_406_621 71
71 3300047471 Ga0495684_0997446 Ga0495684_0997446_289_504 71
72 3300048911 Ga0496108_0564317 Ga0496108_0564317_336_551 71
73 3300048918 Ga0496115_1035014 Ga0496115_1035014_60_275 71
74 3300049576 Ga0501040_0106107 Ga0501040_0106107_875_1090 71
75 3300049578 Ga0501042_0288300 Ga0501042_0288300_361_576 71
76 3300049580 Ga0501046_0145732 Ga0501046_0145732_659_874 71
77 3300049582 Ga0501048_0403812 Ga0501048_0403812_734_949 71
78 3300049588 Ga0501072_0225079 Ga0501072_0225079_879_1094 71
79 3300049589 Ga0501073_0760793 Ga0501073_0760793_155_370 71
80 3300049589 Ga0501073_0876841 Ga0501073_0876841_291_542 71
81 3300049593 Ga0501077_0546688 Ga0501077_0546688_105_356 71
82 3300049741 Ga0501079_0578608 Ga0501079_0578608_295_510 71
83 3300049741 Ga0501079_1388728 Ga0501079_1388728_199_414 71
84 3300049824 Ga0501045_0284730 Ga0501045_0284730_734_949 71
85 3300050509 nmdc:mga0qj67_376902_c1 nmdc:mga0qj67_376902_c1_545_760 71
86 3300050510 nmdc:mga06r32_368085_c1 nmdc:mga06r32_368085_c1_859_1074 71
87 3300050511 nmdc:mga08y16_1094781_c1 nmdc:mga08y16_1094781_c1_319_534 71
88 3300053077 Ga0495601_0212362 Ga0495601_0212362_902_1117 71
89 3300053085 Ga0495619_0114131 Ga0495619_0114131_1162_1377 71
90 3300053143 Ga0500579_271357 Ga0500579_271357_57_272 71
91 3300054114 Ga0501084_0411260 Ga0501084_0411260_23_238 71
92 3300061734 Ga0530510_0190489 Ga0530510_0190489_476_691 71
93 3300005330 Ga0070690_101074030 Ga0070690_1010740302 72
94 3300005340 Ga0070689_101388665 Ga0070689_1013886651 72
95 3300005437 Ga0070710_10476473 Ga0070710_104764732 72
96 3300005549 Ga0070704_101451056 Ga0070704_1014510562 72
97 3300006028 Ga0070717_11483257 Ga0070717_114832572 72
98 3300006042 Ga0075368_10331452 Ga0075368_103314522 72
99 3300006173 Ga0070716_100339073 Ga0070716_1003390732 72
100 3300006175 Ga0070712_100012521 Ga0070712_1000125212 72
101 3300006178 Ga0075367_10338303 Ga0075367_103383032 72
102 3300009098 Ga0105245_12135799 Ga0105245_121357992 72
103 3300025898 Ga0207692_10367985 Ga0207692_103679852 72
104 3300025916 Ga0207663_11466033 Ga0207663_114660331 72
105 3300025934 Ga0207686_11770572 Ga0207686_117705721 72
106 3300025939 Ga0207665_10385227 Ga0207665_103852272 72
107 3300025944 Ga0207661_11728794 Ga0207661_117287942 72
108 3300026023 Ga0207677_11953920 Ga0207677_119539201 72
109 3300026035 Ga0207703_10090190 Ga0207703_100901903 72
110 3300028379 Ga0268266_11263415 Ga0268266_112634152 72
111 3300036401 Ga0373937_0352268 Ga0373937_0352268_1103_1321 72
112 3300046454 Ga0495592_0956409 Ga0495592_0956409_74_292 72
113 3300046533 Ga0495640_0169367 Ga0495640_0169367_85_303 72
114 3300046675 Ga0495657_0282837 Ga0495657_0282837_623_841 72
115 3300046678 Ga0495599_0606600 Ga0495599_0606600_211_429 72
116 3300048903 Ga0496100_0025287 Ga0496100_0025287_1970_2188 72
117 3300048903 Ga0496100_1216324 Ga0496100_1216324_190_426 72
118 3300048907 Ga0496104_0022101 Ga0496104_0022101_436_654 72
119 3300048907 Ga0496104_0469520 Ga0496104_0469520_603_839 72
120 3300048908 Ga0496105_0081354 Ga0496105_0081354_2430_2648 72
121 3300048908 Ga0496105_0932818 Ga0496105_0932818_244_462 72
122 3300048910 Ga0496107_0173216 Ga0496107_0173216_662_880 72
123 3300048913 Ga0496110_0286565 Ga0496110_0286565_1109_1345 72
124 3300048914 Ga0496111_1208997 Ga0496111_1208997_122_358 72
125 3300048917 Ga0496114_0013407 Ga0496114_0013407_2045_2263 72
126 3300048918 Ga0496115_0004103 Ga0496115_0004103_8065_8283 72
127 3300048919 Ga0496116_0000740 Ga0496116_0000740_28903_29130 72
128 3300048921 Ga0496118_0056747 Ga0496118_0056747_980_1207 72
129 3300048922 Ga0496119_0009002 Ga0496119_0009002_2872_3099 72
130 3300049571 Ga0501034_0527235 Ga0501034_0527235_719_946 72
131 3300049572 Ga0501036_0295659 Ga0501036_0295659_545_772 72
132 3300049581 Ga0501047_0340549 Ga0501047_0340549_71_298 72
133 3300049744 Ga0501083_0224650 Ga0501083_0224650_757_984 72
134 3300049822 Ga0501035_0185814 Ga0501035_0185814_238_465 72
135 3300050494 nmdc:mga06z11_356553_c1 nmdc:mga06z11_356553_c1_237_455 72
136 3300053077 Ga0495601_0131071 Ga0495601_0131071_826_1044 72
137 3300053084 Ga0495595_0304905 Ga0495595_0304905_408_644 72
138 3300053084 Ga0495595_0658377 Ga0495595_0658377_297_515 72
139 3300053119 Ga0500595_020462 Ga0500595_020462_554_781 72
140 3300039437 Ga0436365_1839289 Ga0436365_1839289_316_537 73
141 3300048908 Ga0496105_0140903 Ga0496105_0140903_516_746 73
142 3300048924 Ga0496121_0896843 Ga0496121_0896843_153_383 73
143 3300005340 Ga0070689_101977690 Ga0070689_1019776902 74
144 3300005354 Ga0070675_101303002 Ga0070675_1013030022 74
145 3300005614 Ga0068856_102147112 Ga0068856_1021471122 74
146 3300005844 Ga0068862_102278948 Ga0068862_1022789482 74
147 3300014968 Ga0157379_10644977 Ga0157379_106449772 74
148 3300014968 Ga0157379_10974201 Ga0157379_109742011 74
149 3300021384 Ga0213876_10019831 Ga0213876_100198316 74
150 3300021384 Ga0213876_10395000 Ga0213876_103950002 74
151 3300025936 Ga0207670_11718700 Ga0207670_117187001 74
152 3300025986 Ga0207658_10198887 Ga0207658_101988872 74
153 3300026023 Ga0207677_11397102 Ga0207677_113971022 74
154 3300039437 Ga0436365_0536083 Ga0436365_0536083_2620_2844 74
155 3300039437 Ga0436365_1496473 Ga0436365_1496473_199_426 74
156 3300048904 Ga0496101_0268924 Ga0496101_0268924_976_1200 74
157 3300048907 Ga0496104_0018747 Ga0496104_0018747_4653_4877 74
158 3300048908 Ga0496105_0103298 Ga0496105_0103298_92_316 74
159 3300048912 Ga0496109_0417401 Ga0496109_0417401_381_608 74
160 3300048922 Ga0496119_0057518 Ga0496119_0057518_1485_1718 74
161 3300048923 Ga0496120_0002441 Ga0496120_0002441_8564_8797 74
162 3300049571 Ga0501034_1398833 Ga0501034_1398833_26_259 74
163 3300049586 Ga0501070_0003804 Ga0501070_0003804_7581_7814 74
164 3300049823 Ga0501044_0685352 Ga0501044_0685352_308_541 74
165 3300005467 Ga0070706_100217899 Ga0070706_1002178992 75
166 3300025910 Ga0207684_10219766 Ga0207684_102197662 75
167 3300037853 Ga0436364_1497096 Ga0436364_1497096_191_418 75
168 3300044673 Ga0453683_0489143 Ga0453683_0489143_24_263 75
169 3300046533 Ga0495640_0492873 Ga0495640_0492873_387_614 75
170 3300048906 Ga0496103_0043309 Ga0496103_0043309_370_612 75
171 3300048908 Ga0496105_1320986 Ga0496105_1320986_246_473 75
172 3300048912 Ga0496109_0011430 Ga0496109_0011430_7036_7263 75
173 3300048913 Ga0496110_0163847 Ga0496110_0163847_240_467 75
174 3300048914 Ga0496111_0805005 Ga0496111_0805005_70_297 75
175 3300048915 Ga0496112_0108296 Ga0496112_0108296_1436_1663 75
176 3300048916 Ga0496113_0107103 Ga0496113_0107103_1023_1250 75
177 3300048916 Ga0496113_0784864 Ga0496113_0784864_284_511 75
178 3300048920 Ga0496117_0006929 Ga0496117_0006929_1338_1580 75
179 3300048921 Ga0496118_0002323 Ga0496118_0002323_9765_10007 75
180 3300053077 Ga0495601_0162256 Ga0495601_0162256_647_874 75
181 3300053085 Ga0495619_0075542 Ga0495619_0075542_1020_1247 75
182 3300009551 Ga0105238_11008149 Ga0105238_110081492 77
183 3300025924 Ga0207694_10925970 Ga0207694_109259701 77
184 3300005445 Ga0070708_101741915 Ga0070708_1017419152 78
185 3300005328 Ga0070676_11546727 Ga0070676_115467272 81
186 3300005440 Ga0070705_100446960 Ga0070705_1004469602 81
187 3300005444 Ga0070694_101241721 Ga0070694_1012417212 81
188 3300005545 Ga0070695_100437889 Ga0070695_1004378892 81
189 3300005546 Ga0070696_100223667 Ga0070696_1002236672 81
190 3300005549 Ga0070704_100429140 Ga0070704_1004291402 81
191 3300007076 Ga0075435_101039826 Ga0075435_1010398262 81
192 3300009098 Ga0105245_10034199 Ga0105245_100341995 81
193 3300009176 Ga0105242_10082832 Ga0105242_100828323 81
194 3300009177 Ga0105248_12614051 Ga0105248_126140512 81
195 3300025927 Ga0207687_10134920 Ga0207687_101349203 81
196 3300025934 Ga0207686_10412324 Ga0207686_104123243 81
197 3300026089 Ga0207648_11455407 Ga0207648_114554072 81
198 3300048905 Ga0496102_1351289 Ga0496102_1351289_307_552 81
199 3300050513 nmdc:mga0rr50_1207864_c1 nmdc:mga0rr50_1207864_c1_115_360 81
200 3300050514 nmdc:mga08x19_617584_c1 nmdc:mga08x19_617584_c1_442_687 81

Feature Viewer

pLDDT pTM Quality
62.92 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map