F307564

General Info

Members Datasets Scaffolds Average Seq Length
200 111 197 129

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_1762465|Ga0453684_1762465_169_552
Length 127
Sequence MSETRQEINKQIVREFYDCVVNTKDFEAAKKYLAPRYIQHNPNDPDGHDGLRAFITKRKAEHPDQKSEIIRIFADGDYVILHVRSFWPPETYRAIVEIYRLENGLVAEHWDVMQFVPATCANPNGMF

Samples

Sample ID Description Type Environment
1 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
2 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
3 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
92 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
108 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
109 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0
Rhizoplane 1
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10049446 3300005327 Bacteria 3406
2 Ga0070658_10192839 3300005327 Bacteria 1718
3 Ga0070658_10236596 3300005327 Bacteria 1547
4 Ga0070658_10586786 3300005327 Bacteria 965
5 Ga0070683_100023777 3300005329 Bacteria 5484
6 Ga0070683_100494110 3300005329 Bacteria 1169
7 Ga0070680_100031553 3300005336 Bacteria 4261
8 Ga0070680_101741523 3300005336 Bacteria 540
9 Ga0070660_100003507 3300005339 Bacteria 10807
10 Ga0070660_100009932 3300005339 Bacteria 6715
11 Ga0070660_100197129 3300005339 Bacteria 1633
12 Ga0070660_101144360 3300005339 Bacteria 659
13 Ga0070661_100000651 3300005344 Bacteria 25509
14 Ga0070661_100178518 3300005344 Bacteria 1615
15 Ga0070661_100265544 3300005344 Bacteria 1328
16 Ga0070692_10144118 3300005345 Bacteria 1351
17 Ga0070675_100659865 3300005354 Bacteria 951
18 Ga0070674_100824105 3300005356 Bacteria 803
19 Ga0070659_100034960 3300005366 Bacteria 3911
20 Ga0070659_100089279 3300005366 Bacteria 2469
21 Ga0070659_100128719 3300005366 Bacteria 2054
22 Ga0070659_100194835 3300005366 Bacteria 1666
23 Ga0070659_100488956 3300005366 Bacteria 1048
24 Ga0070663_100267531 3300005455 Bacteria 1358
25 Ga0070663_100916096 3300005455 Bacteria 758
26 Ga0070678_101175622 3300005456 Bacteria 710
27 Ga0070662_100001849 3300005457 Bacteria 12980
28 Ga0070662_100003215 3300005457 Bacteria 10159
29 Ga0070662_100650802 3300005457 Bacteria 889
30 Ga0070681_10095788 3300005458 Bacteria 2916
31 Ga0070681_11549254 3300005458 Unclassified 588
32 Ga0070698_100601392 3300005471 Bacteria 1040
33 Ga0070679_100004673 3300005530 Bacteria 12637
34 Ga0070679_100013435 3300005530 Bacteria 7840
35 Ga0070679_100332214 3300005530 Bacteria 1468
36 Ga0070684_100135576 3300005535 Bacteria 2223
37 Ga0070684_100358114 3300005535 Bacteria 1343
38 Ga0070684_101090945 3300005535 Bacteria 750
39 Ga0068853_100020618 3300005539 Bacteria 5482
40 Ga0070672_101136403 3300005543 Bacteria 695
41 Ga0068855_100019679 3300005563 Bacteria 8107
42 Ga0068855_100039471 3300005563 Bacteria 5605
43 Ga0068855_100172608 3300005563 Bacteria 2448
44 Ga0070664_100026082 3300005564 Bacteria 4845
45 Ga0070664_100223722 3300005564 Bacteria 1684
46 Ga0068857_100018075 3300005577 Bacteria 6185
47 Ga0068857_100256899 3300005577 Bacteria 1603
48 Ga0068857_100778062 3300005577 Unclassified 913
49 Ga0068857_102116517 3300005577 Unclassified 552
50 Ga0068854_100006233 3300005578 Bacteria 7571
51 Ga0068856_100188047 3300005614 Bacteria 2079
52 Ga0068851_10031109 3300005834 Bacteria 2650
53 Ga0068870_11267852 3300005840 Bacteria 536
54 Ga0075362_10102723 3300006177 Bacteria 1338
55 Ga0075369_10269378 3300006186 Bacteria 792
56 Ga0075366_10503182 3300006195 Bacteria 749
57 Ga0075370_10004836 3300006353 Bacteria 6603
58 Ga0105241_10530988 3300009174 Unclassified 1053
59 Ga0105249_11342098 3300009553 Bacteria 787
60 Ga0105239_10272208 3300010375 Bacteria 1905
61 Ga0105239_11048015 3300010375 Bacteria 938
62 Ga0105246_10391829 3300011119 Bacteria 1151
63 Ga0157373_10057725 3300013100 Bacteria 2752
64 Ga0157373_10758515 3300013100 Bacteria 714
65 Ga0157373_11040525 3300013100 Bacteria 612
66 Ga0157371_10003225 3300013102 Bacteria 14964
67 Ga0157370_10004981 3300013104 Bacteria 15032
68 Ga0157370_10206967 3300013104 Bacteria 1819
69 Ga0157369_10001524 3300013105 Bacteria 28403
70 Ga0157372_10003518 3300013307 Bacteria 16869
71 Ga0157372_10308471 3300013307 Bacteria 1842
72 Ga0157375_10218560 3300013308 Bacteria 2064
73 Ga0157380_12050669 3300014326 Bacteria 634
74 Ga0157377_10377994 3300014745 Bacteria 958
75 Ga0157376_10221200 3300014969 Bacteria 1753
76 Ga0207682_10094728 3300025893 Bacteria 1299
77 Ga0207647_10214279 3300025904 Unclassified 1111
78 Ga0207705_10003860 3300025909 Bacteria 11397
79 Ga0207705_10021158 3300025909 Bacteria 4640
80 Ga0207705_10121314 3300025909 Bacteria 1940
81 Ga0207705_10189682 3300025909 Bacteria 1554
82 Ga0207705_10236230 3300025909 Bacteria 1391
83 Ga0207705_10515275 3300025909 Bacteria 929
84 Ga0207707_10013370 3300025912 Bacteria 7155
85 Ga0207660_10009687 3300025917 Bacteria 6234
86 Ga0207657_10000083 3300025919 Bacteria 89409
87 Ga0207657_10013325 3300025919 Bacteria 8066
88 Ga0207657_10109358 3300025919 Bacteria 2285
89 Ga0207657_10848659 3300025919 Bacteria 705
90 Ga0207649_10006986 3300025920 Bacteria 6130
91 Ga0207649_10300756 3300025920 Bacteria 1173
92 Ga0207652_10000695 3300025921 Bacteria 32664
93 Ga0207652_10316611 3300025921 Bacteria 1408
94 Ga0207652_10846084 3300025921 Bacteria 810
95 Ga0207659_11225148 3300025926 Bacteria 645
96 Ga0207690_10005552 3300025932 Bacteria 7446
97 Ga0207690_10058914 3300025932 Bacteria 2600
98 Ga0207690_10645800 3300025932 Bacteria 867
99 Ga0207706_10000349 3300025933 Bacteria 49869
100 Ga0207706_10018447 3300025933 Bacteria 6279
101 Ga0207706_10032686 3300025933 Bacteria 4631
102 Ga0207706_10456091 3300025933 Bacteria 1105
103 Ga0207691_10529916 3300025940 Bacteria 999
104 Ga0207661_10048591 3300025944 Bacteria 3373
105 Ga0207661_10239878 3300025944 Bacteria 1608
106 Ga0207661_10410618 3300025944 Bacteria 1229
107 Ga0207661_11008375 3300025944 Bacteria 767
108 Ga0207679_10045024 3300025945 Bacteria 3189
109 Ga0207679_10192757 3300025945 Bacteria 1696
110 Ga0207667_10011099 3300025949 Bacteria 10489
111 Ga0207667_10044681 3300025949 Bacteria 4694
112 Ga0207667_10262651 3300025949 Bacteria 1765
113 Ga0207639_10016416 3300026041 Bacteria 5238
114 Ga0207639_10490445 3300026041 Bacteria 1121
115 Ga0207639_10838978 3300026041 Bacteria 857
116 Ga0207678_10187126 3300026067 Bacteria 1769
117 Ga0207678_11655251 3300026067 Bacteria 563
118 Ga0207708_10726426 3300026075 Bacteria 851
119 Ga0207702_10101238 3300026078 Bacteria 2543
120 Ga0207702_11996334 3300026078 Bacteria 571
121 Ga0207702_12484578 3300026078 Bacteria 505
122 Ga0207674_10036886 3300026116 Bacteria 5088
123 Ga0207674_10084568 3300026116 Bacteria 3170
124 Ga0207674_10569704 3300026116 Bacteria 1094
125 Ga0207674_10992952 3300026116 Bacteria 809
126 Ga0207698_10590578 3300026142 Bacteria 1094
127 Ga0207698_10599758 3300026142 Bacteria 1085
128 Ga0316177_1209732 3300030731 Bacteria 1407
129 Ga0307408_100282678 3300031548 Bacteria 1382
130 Ga0307405_10282492 3300031731 Bacteria 1250
131 Ga0307413_10062585 3300031824 Bacteria 2303
132 Ga0307413_10385957 3300031824 Bacteria 1093
133 Ga0307413_10477161 3300031824 Bacteria 996
134 Ga0307413_11552223 3300031824 Bacteria 587
135 Ga0307413_11805123 3300031824 Bacteria 547
136 Ga0307410_10365288 3300031852 Bacteria 1157
137 Ga0307406_10039813 3300031901 Bacteria 2918
138 Ga0307412_10091105 3300031911 Bacteria 2133
139 Ga0307412_10145805 3300031911 Bacteria 1740
140 Ga0307412_10436574 3300031911 Bacteria 1075
141 Ga0307412_10696700 3300031911 Bacteria 871
142 Ga0307412_11248607 3300031911 Bacteria 667
143 Ga0307409_100390660 3300031995 Bacteria 1326
144 Ga0307416_100034665 3300032002 Bacteria 3844
145 Ga0307414_10010271 3300032004 Bacteria 5423
146 Ga0307414_10048741 3300032004 Bacteria 2924
147 Ga0307414_10111303 3300032004 Bacteria 2085
148 Ga0307414_10230311 3300032004 Bacteria 1527
149 Ga0307414_10327509 3300032004 Bacteria 1306
150 Ga0307414_10769266 3300032004 Bacteria 876
151 Ga0307414_10938024 3300032004 Bacteria 795
152 Ga0307411_10060543 3300032005 Bacteria 2515
153 Ga0307411_10309443 3300032005 Bacteria 1271
154 Ga0307415_100086794 3300032126 Bacteria 2252
155 Ga0307415_100352165 3300032126 Bacteria 1240
156 Ga0307415_100533512 3300032126 Bacteria 1032
157 Ga0307415_100566759 3300032126 Bacteria 1005
158 Ga0307415_102318301 3300032126 Bacteria 527
159 Ga0316583_10000090 3300032133 Bacteria 19711
160 Ga0316582_0001390 3300036647 Bacteria 10548
161 Ga0316582_0499017 3300036647 Bacteria 839
162 Ga0316584_0180460 3300036712 Bacteria 1563
163 Ga0316584_0289244 3300036712 Bacteria 1189
164 Ga0316584_0369124 3300036712 Unclassified 1027
165 Ga0436363_0364569 3300039450 Bacteria 806
166 Ga0451853_1225437 3300041512 Bacteria 589
167 Ga0439445_0162916 3300042004 Bacteria 652
168 Ga0439462_0008962 3300042015 Bacteria 2531
169 Ga0453684_1762465 3300044712 Unclassified 631
170 Ga0495639_0071764 3300046475 Bacteria 1600
171 Ga0495583_0000796 3300046506 Bacteria 39053
172 Ga0495606_0001562 3300046507 Bacteria 30059
173 Ga0495643_0028289 3300046522 Bacteria 3144
174 Ga0495644_0145802 3300046523 Bacteria 905
175 Ga0495621_0022520 3300046539 Bacteria 2089
176 Ga0495661_0112056 3300046665 Bacteria 1519
177 Ga0495670_0058107 3300046691 Bacteria 1942
178 Ga0495686_0000149 3300047472 Bacteria 135332
179 Ga0495686_0001391 3300047472 Bacteria 26822
180 Ga0496105_0148590 3300048908 Bacteria 1927
181 Ga0496114_0016228 3300048917 Bacteria 5997
182 Ga0501033_0134689 3300049570 Bacteria 1788
183 Ga0501034_0686560 3300049571 Bacteria 923
184 Ga0501036_0194393 3300049572 Bacteria 1707
185 Ga0501037_0470377 3300049573 Bacteria 856
186 Ga0501047_0229333 3300049581 Bacteria 1711
187 Ga0501035_0423687 3300049822 Bacteria 1105
188 Ga0501044_0276639 3300049823 Bacteria 1613
189 Ga0501044_0444641 3300049823 Bacteria 1204
190 nmdc:mga03n38_98986_c1 3300050490 Bacteria 1403
191 Ga0500643_000039 3300053087 Bacteria 169629
192 Ga0500641_0176293 3300053096 Bacteria 919
193 Ga0500555_002930 3300053103 Bacteria 4889
194 Ga0500559_0064024 3300053136 Bacteria 1645
195 Ga0500616_0001815 3300053153 Bacteria 19409
196 Ga0500616_0084514 3300053153 Bacteria 1588
197 Ga0500661_082458 3300055283 Bacteria 597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_11552223 Ga0307413_115522231 113
2 3300044712 Ga0453684_1762465 Ga0453684_1762465_169_552 125
3 iso_pu_bacteria 2643221588 2643951658 125
4 iso_pu_bacteria 2896184354 2896185774 125
5 iso_pu_bacteria 3000865235 3000867075 125
6 3300005327 Ga0070658_10049446 Ga0070658_100494465 128
7 3300005327 Ga0070658_10192839 Ga0070658_101928392 128
8 3300005327 Ga0070658_10236596 Ga0070658_102365962 128
9 3300005327 Ga0070658_10586786 Ga0070658_105867861 128
10 3300005329 Ga0070683_100023777 Ga0070683_1000237775 128
11 3300005329 Ga0070683_100494110 Ga0070683_1004941102 128
12 3300005336 Ga0070680_100031553 Ga0070680_1000315535 128
13 3300005336 Ga0070680_101741523 Ga0070680_1017415232 128
14 3300005339 Ga0070660_100003507 Ga0070660_1000035077 128
15 3300005339 Ga0070660_100009932 Ga0070660_1000099325 128
16 3300005339 Ga0070660_100197129 Ga0070660_1001971292 128
17 3300005339 Ga0070660_101144360 Ga0070660_1011443601 128
18 3300005344 Ga0070661_100000651 Ga0070661_1000006514 128
19 3300005344 Ga0070661_100178518 Ga0070661_1001785182 128
20 3300005344 Ga0070661_100265544 Ga0070661_1002655442 128
21 3300005345 Ga0070692_10144118 Ga0070692_101441182 128
22 3300005354 Ga0070675_100659865 Ga0070675_1006598652 128
23 3300005356 Ga0070674_100824105 Ga0070674_1008241052 128
24 3300005366 Ga0070659_100034960 Ga0070659_1000349602 128
25 3300005366 Ga0070659_100089279 Ga0070659_1000892792 128
26 3300005366 Ga0070659_100128719 Ga0070659_1001287191 128
27 3300005366 Ga0070659_100194835 Ga0070659_1001948352 128
28 3300005366 Ga0070659_100488956 Ga0070659_1004889562 128
29 3300005455 Ga0070663_100267531 Ga0070663_1002675312 128
30 3300005455 Ga0070663_100916096 Ga0070663_1009160961 128
31 3300005456 Ga0070678_101175622 Ga0070678_1011756221 128
32 3300005457 Ga0070662_100001849 Ga0070662_10000184911 128
33 3300005457 Ga0070662_100003215 Ga0070662_1000032153 128
34 3300005457 Ga0070662_100650802 Ga0070662_1006508022 128
35 3300005458 Ga0070681_10095788 Ga0070681_100957882 128
36 3300005458 Ga0070681_11549254 Ga0070681_115492542 128
37 3300005471 Ga0070698_100601392 Ga0070698_1006013922 128
38 3300005530 Ga0070679_100004673 Ga0070679_10000467311 128
39 3300005530 Ga0070679_100013435 Ga0070679_1000134354 128
40 3300005530 Ga0070679_100332214 Ga0070679_1003322142 128
41 3300005535 Ga0070684_100135576 Ga0070684_1001355762 128
42 3300005535 Ga0070684_100358114 Ga0070684_1003581142 128
43 3300005535 Ga0070684_101090945 Ga0070684_1010909452 128
44 3300005539 Ga0068853_100020618 Ga0068853_1000206188 128
45 3300005543 Ga0070672_101136403 Ga0070672_1011364032 128
46 3300005563 Ga0068855_100019679 Ga0068855_1000196799 128
47 3300005563 Ga0068855_100039471 Ga0068855_1000394712 128
48 3300005563 Ga0068855_100172608 Ga0068855_1001726082 128
49 3300005564 Ga0070664_100026082 Ga0070664_1000260827 128
50 3300005564 Ga0070664_100223722 Ga0070664_1002237221 128
51 3300005577 Ga0068857_100018075 Ga0068857_1000180753 128
52 3300005577 Ga0068857_100256899 Ga0068857_1002568992 128
53 3300005577 Ga0068857_100778062 Ga0068857_1007780621 128
54 3300005577 Ga0068857_102116517 Ga0068857_1021165171 128
55 3300005578 Ga0068854_100006233 Ga0068854_1000062335 128
56 3300005614 Ga0068856_100188047 Ga0068856_1001880472 128
57 3300005834 Ga0068851_10031109 Ga0068851_100311092 128
58 3300005840 Ga0068870_11267852 Ga0068870_112678521 128
59 3300006177 Ga0075362_10102723 Ga0075362_101027232 128
60 3300006186 Ga0075369_10269378 Ga0075369_102693782 128
61 3300006195 Ga0075366_10503182 Ga0075366_105031821 128
62 3300006353 Ga0075370_10004836 Ga0075370_100048364 128
63 3300009174 Ga0105241_10530988 Ga0105241_105309882 128
64 3300009553 Ga0105249_11342098 Ga0105249_113420982 128
65 3300010375 Ga0105239_10272208 Ga0105239_102722082 128
66 3300010375 Ga0105239_11048015 Ga0105239_110480152 128
67 3300011119 Ga0105246_10391829 Ga0105246_103918292 128
68 3300013100 Ga0157373_10057725 Ga0157373_100577255 128
69 3300013100 Ga0157373_10758515 Ga0157373_107585151 128
70 3300013100 Ga0157373_11040525 Ga0157373_110405251 128
71 3300013102 Ga0157371_10003225 Ga0157371_1000322515 128
72 3300013104 Ga0157370_10004981 Ga0157370_100049812 128
73 3300013104 Ga0157370_10206967 Ga0157370_102069673 128
74 3300013105 Ga0157369_10001524 Ga0157369_100015247 128
75 3300013307 Ga0157372_10003518 Ga0157372_100035189 128
76 3300013307 Ga0157372_10308471 Ga0157372_103084713 128
77 3300013308 Ga0157375_10218560 Ga0157375_102185603 128
78 3300014326 Ga0157380_12050669 Ga0157380_120506691 128
79 3300014745 Ga0157377_10377994 Ga0157377_103779942 128
80 3300014969 Ga0157376_10221200 Ga0157376_102212003 128
81 3300025893 Ga0207682_10094728 Ga0207682_100947282 128
82 3300025904 Ga0207647_10214279 Ga0207647_102142792 128
83 3300025909 Ga0207705_10003860 Ga0207705_100038602 128
84 3300025909 Ga0207705_10021158 Ga0207705_100211586 128
85 3300025909 Ga0207705_10121314 Ga0207705_101213142 128
86 3300025909 Ga0207705_10189682 Ga0207705_101896823 128
87 3300025909 Ga0207705_10236230 Ga0207705_102362302 128
88 3300025909 Ga0207705_10515275 Ga0207705_105152752 128
89 3300025912 Ga0207707_10013370 Ga0207707_100133705 128
90 3300025917 Ga0207660_10009687 Ga0207660_100096872 128
91 3300025919 Ga0207657_10000083 Ga0207657_1000008358 128
92 3300025919 Ga0207657_10013325 Ga0207657_100133255 128
93 3300025919 Ga0207657_10109358 Ga0207657_101093582 128
94 3300025919 Ga0207657_10848659 Ga0207657_108486592 128
95 3300025920 Ga0207649_10006986 Ga0207649_100069862 128
96 3300025920 Ga0207649_10300756 Ga0207649_103007562 128
97 3300025921 Ga0207652_10000695 Ga0207652_1000069519 128
98 3300025921 Ga0207652_10316611 Ga0207652_103166112 128
99 3300025921 Ga0207652_10846084 Ga0207652_108460841 128
100 3300025926 Ga0207659_11225148 Ga0207659_112251482 128
101 3300025932 Ga0207690_10005552 Ga0207690_100055525 128
102 3300025932 Ga0207690_10058914 Ga0207690_100589143 128
103 3300025932 Ga0207690_10645800 Ga0207690_106458002 128
104 3300025933 Ga0207706_10000349 Ga0207706_1000034915 128
105 3300025933 Ga0207706_10018447 Ga0207706_100184472 128
106 3300025933 Ga0207706_10032686 Ga0207706_100326862 128
107 3300025933 Ga0207706_10456091 Ga0207706_104560912 128
108 3300025940 Ga0207691_10529916 Ga0207691_105299162 128
109 3300025944 Ga0207661_10048591 Ga0207661_100485913 128
110 3300025944 Ga0207661_10239878 Ga0207661_102398782 128
111 3300025944 Ga0207661_10410618 Ga0207661_104106182 128
112 3300025944 Ga0207661_11008375 Ga0207661_110083752 128
113 3300025945 Ga0207679_10045024 Ga0207679_100450242 128
114 3300025945 Ga0207679_10192757 Ga0207679_101927572 128
115 3300025949 Ga0207667_10011099 Ga0207667_100110997 128
116 3300025949 Ga0207667_10044681 Ga0207667_100446812 128
117 3300025949 Ga0207667_10262651 Ga0207667_102626512 128
118 3300026041 Ga0207639_10016416 Ga0207639_100164163 128
119 3300026041 Ga0207639_10490445 Ga0207639_104904452 128
120 3300026041 Ga0207639_10838978 Ga0207639_108389781 128
121 3300026067 Ga0207678_10187126 Ga0207678_101871262 128
122 3300026067 Ga0207678_11655251 Ga0207678_116552511 128
123 3300026075 Ga0207708_10726426 Ga0207708_107264262 128
124 3300026078 Ga0207702_10101238 Ga0207702_101012382 128
125 3300026078 Ga0207702_11996334 Ga0207702_119963341 128
126 3300026078 Ga0207702_12484578 Ga0207702_124845781 128
127 3300026116 Ga0207674_10036886 Ga0207674_100368865 128
128 3300026116 Ga0207674_10084568 Ga0207674_100845685 128
129 3300026116 Ga0207674_10569704 Ga0207674_105697042 128
130 3300026116 Ga0207674_10992952 Ga0207674_109929522 128
131 3300026142 Ga0207698_10590578 Ga0207698_105905782 128
132 3300026142 Ga0207698_10599758 Ga0207698_105997582 128
133 3300030731 Ga0316177_1209732 Ga0316177_12097322 128
134 3300031548 Ga0307408_100282678 Ga0307408_1002826782 128
135 3300031731 Ga0307405_10282492 Ga0307405_102824922 128
136 3300031824 Ga0307413_10062585 Ga0307413_100625854 128
137 3300031824 Ga0307413_10385957 Ga0307413_103859572 128
138 3300031824 Ga0307413_10477161 Ga0307413_104771612 128
139 3300031824 Ga0307413_11805123 Ga0307413_118051232 128
140 3300031852 Ga0307410_10365288 Ga0307410_103652882 128
141 3300031901 Ga0307406_10039813 Ga0307406_100398132 128
142 3300031911 Ga0307412_10091105 Ga0307412_100911052 128
143 3300031911 Ga0307412_10145805 Ga0307412_101458052 128
144 3300031911 Ga0307412_10436574 Ga0307412_104365741 128
145 3300031911 Ga0307412_10696700 Ga0307412_106967002 128
146 3300031911 Ga0307412_11248607 Ga0307412_112486071 128
147 3300031995 Ga0307409_100390660 Ga0307409_1003906602 128
148 3300032002 Ga0307416_100034665 Ga0307416_1000346652 128
149 3300032004 Ga0307414_10010271 Ga0307414_100102712 128
150 3300032004 Ga0307414_10048741 Ga0307414_100487414 128
151 3300032004 Ga0307414_10111303 Ga0307414_101113032 128
152 3300032004 Ga0307414_10230311 Ga0307414_102303112 128
153 3300032004 Ga0307414_10327509 Ga0307414_103275091 128
154 3300032004 Ga0307414_10769266 Ga0307414_107692662 128
155 3300032004 Ga0307414_10938024 Ga0307414_109380241 128
156 3300032005 Ga0307411_10060543 Ga0307411_100605432 128
157 3300032005 Ga0307411_10309443 Ga0307411_103094432 128
158 3300032126 Ga0307415_100086794 Ga0307415_1000867944 128
159 3300032126 Ga0307415_100352165 Ga0307415_1003521652 128
160 3300032126 Ga0307415_100533512 Ga0307415_1005335121 128
161 3300032126 Ga0307415_100566759 Ga0307415_1005667592 128
162 3300032126 Ga0307415_102318301 Ga0307415_1023183011 128
163 3300032133 Ga0316583_10000090 Ga0316583_100000902 128
164 3300036647 Ga0316582_0001390 Ga0316582_0001390_2008_2397 128
165 3300036647 Ga0316582_0499017 Ga0316582_0499017_184_573 128
166 3300036712 Ga0316584_0180460 Ga0316584_0180460_414_803 128
167 3300036712 Ga0316584_0289244 Ga0316584_0289244_298_687 128
168 3300036712 Ga0316584_0369124 Ga0316584_0369124_301_690 128
169 3300039450 Ga0436363_0364569 Ga0436363_0364569_139_525 128
170 3300041512 Ga0451853_1225437 Ga0451853_1225437_158_547 128
171 3300042004 Ga0439445_0162916 Ga0439445_0162916_41_430 128
172 3300042015 Ga0439462_0008962 Ga0439462_0008962_388_777 128
173 3300046475 Ga0495639_0071764 Ga0495639_0071764_214_603 128
174 3300046506 Ga0495583_0000796 Ga0495583_0000796_37111_37500 128
175 3300046507 Ga0495606_0001562 Ga0495606_0001562_4342_4731 128
176 3300046522 Ga0495643_0028289 Ga0495643_0028289_1024_1413 128
177 3300046523 Ga0495644_0145802 Ga0495644_0145802_488_877 128
178 3300046539 Ga0495621_0022520 Ga0495621_0022520_1415_1804 128
179 3300046665 Ga0495661_0112056 Ga0495661_0112056_1101_1490 128
180 3300046691 Ga0495670_0058107 Ga0495670_0058107_868_1257 128
181 3300047472 Ga0495686_0000149 Ga0495686_0000149_89036_89425 128
182 3300047472 Ga0495686_0001391 Ga0495686_0001391_22190_22579 128
183 3300048908 Ga0496105_0148590 Ga0496105_0148590_476_865 128
184 3300048917 Ga0496114_0016228 Ga0496114_0016228_5511_5900 128
185 3300049570 Ga0501033_0134689 Ga0501033_0134689_363_752 128
186 3300049571 Ga0501034_0686560 Ga0501034_0686560_17_406 128
187 3300049572 Ga0501036_0194393 Ga0501036_0194393_903_1292 128
188 3300049573 Ga0501037_0470377 Ga0501037_0470377_425_814 128
189 3300049581 Ga0501047_0229333 Ga0501047_0229333_768_1157 128
190 3300049822 Ga0501035_0423687 Ga0501035_0423687_579_968 128
191 3300049823 Ga0501044_0276639 Ga0501044_0276639_549_938 128
192 3300049823 Ga0501044_0444641 Ga0501044_0444641_588_977 128
193 3300050490 nmdc:mga03n38_98986_c1 nmdc:mga03n38_98986_c1_447_836 128
194 3300053087 Ga0500643_000039 Ga0500643_000039_80536_80925 128
195 3300053096 Ga0500641_0176293 Ga0500641_0176293_431_820 128
196 3300053103 Ga0500555_002930 Ga0500555_002930_2950_3339 128
197 3300053136 Ga0500559_0064024 Ga0500559_0064024_789_1286 128
198 3300053153 Ga0500616_0001815 Ga0500616_0001815_3468_3857 128
199 3300053153 Ga0500616_0084514 Ga0500616_0084514_24_413 128
200 3300055283 Ga0500661_082458 Ga0500661_082458_20_409 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07366

SnoaL

SnoaL-like polyketide cyclase

11

86

0.96

PF12680

SnoaL_2

SnoaL-like domain

13

109

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g0k-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution 0.899 2 128
3g0k-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution 0.8859 2 128
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.8784 6 116
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.8641 6 116
3ff2-assembly1.cif.gz_A-2 crystal structure of an uncharacterized cystatin fold protein (saro_2299) from novosphingobium aromaticivorans dsm at 1.90 a resolution 0.8604 9 113
ID Description Score Start End Superfamily
3g0kA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8982 1 124 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8784 6 116 3.10.450.50
3g0kA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8713 1 124 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8641 6 116 3.10.450.50
af_O33273_3_104_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8628 8 111 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1M5SIK0-F1-model_v4 Predicted SnoaL-like aldol condensation-catalyzing enzyme 0.969 6 119 GO:0030638
AF-J2V8V2-F1-model_v4 SnoaL-like domain-containing protein 0.9687 5 122 GO:0030638
AF-A0A2N9BM73-F1-model_v4 Putative ester cyclase 0.9639 6 122 GO:0030638
AF-A0A243E0D1-F1-model_v4 deleted 0.9634 5 95
AF-A0A1Q4WWE3-F1-model_v4 deleted 0.9623 13 122

Feature Viewer

pLDDT pTM Quality
93.4 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map