F307556

General Info

Members Datasets Scaffolds Average Seq Length
200 146 400 98

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0131534|Ga0466966_0131534_39_374
Length 111
Sequence VPTCSHLDTIAVTELPERVAGCEDCLREGGVWLHLRICLACGHVGCCDDSPNRHATAHNRSTGHPLIRSLEPGEEWSWCYEDEVGMVIPEIRGRTRIPPSPMLTRPANRRR

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
35 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
77 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
89 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
90 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16
Rhizosphere 80.5
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0131534 3300044684 Bacteria 1532
2 Ga0070676_10856842 3300005328 Bacteria 674
3 Ga0070683_100199783 3300005329 Bacteria 1898
4 Ga0070683_101066478 3300005329 Bacteria 776
5 Ga0070683_101093605 3300005329 Bacteria 766
6 Ga0070691_10196511 3300005341 Bacteria 1058
7 Ga0070692_10130109 3300005345 Bacteria 1414
8 Ga0070669_100939932 3300005353 Bacteria 740
9 Ga0070675_100470694 3300005354 Bacteria 1129
10 Ga0070671_100854209 3300005355 Bacteria 794
11 Ga0070659_100086977 3300005366 Bacteria 2502
12 Ga0070709_11198106 3300005434 Bacteria 610
13 Ga0070710_11321143 3300005437 Bacteria 537
14 Ga0070711_101810546 3300005439 Bacteria 536
15 Ga0070700_100617326 3300005441 Bacteria 852
16 Ga0070698_100639691 3300005471 Bacteria 1005
17 Ga0070699_101645251 3300005518 Bacteria 588
18 Ga0068856_100433436 3300005614 Bacteria 1335
19 Ga0068852_100903667 3300005616 Bacteria 900
20 Ga0068859_100007503 3300005617 Bacteria 11065
21 Ga0068859_100519657 3300005617 Bacteria 1285
22 Ga0068851_10636397 3300005834 Bacteria 652
23 Ga0068862_101161860 3300005844 Bacteria 769
24 Ga0081538_10002646 3300005981 Bacteria 17288
25 Ga0081538_10133703 3300005981 Bacteria 1160
26 Ga0075432_10154896 3300006058 Bacteria 883
27 Ga0068871_102289616 3300006358 Bacteria 515
28 Ga0075433_10085101 3300006852 Bacteria 2791
29 Ga0075433_10126258 3300006852 Bacteria 2272
30 Ga0075434_100085182 3300006871 Bacteria 3160
31 Ga0075429_101578147 3300006880 Bacteria 571
32 Ga0097620_100007503 3300006931 Bacteria 11065
33 Ga0097620_100519637 3300006931 Bacteria 1285
34 Ga0075435_101299415 3300007076 Bacteria 637
35 Ga0111539_10022197 3300009094 Bacteria 7803
36 Ga0105245_10711790 3300009098 Bacteria 1038
37 Ga0105241_10623867 3300009174 Bacteria 976
38 Ga0105249_12687158 3300009553 Bacteria 570
39 Ga0105239_10088713 3300010375 Bacteria 3410
40 Ga0105239_10980814 3300010375 Bacteria 971
41 Ga0157337_1006981 3300012483 Bacteria 796
42 Ga0157326_1092875 3300012513 Bacteria 510
43 Ga0157369_11356313 3300013105 Bacteria 724
44 Ga0157372_10341600 3300013307 Bacteria 1744
45 Ga0157372_10487653 3300013307 Bacteria 1437
46 Ga0163163_11559335 3300014325 Bacteria 722
47 Ga0163163_12943005 3300014325 Bacteria 531
48 Ga0182008_10543814 3300014497 Bacteria 644
49 Ga0157377_10098808 3300014745 Bacteria 1735
50 Ga0213874_10204975 3300021377 Bacteria 711
51 Ga0207656_10522315 3300025321 Bacteria 603
52 Ga0207688_10020037 3300025901 Bacteria 3649
53 Ga0207699_10676496 3300025906 Bacteria 755
54 Ga0207645_10240246 3300025907 Bacteria 1197
55 Ga0207654_10876617 3300025911 Bacteria 650
56 Ga0207649_10434480 3300025920 Bacteria 988
57 Ga0207681_10251594 3300025923 Bacteria 1380
58 Ga0207659_10313301 3300025926 Bacteria 1293
59 Ga0207687_10660118 3300025927 Bacteria 885
60 Ga0207687_10720954 3300025927 Bacteria 847
61 Ga0207664_10004970 3300025929 Bacteria 9047
62 Ga0207664_11021627 3300025929 Bacteria 741
63 Ga0207644_10293681 3300025931 Bacteria 1308
64 Ga0207690_10205012 3300025932 Bacteria 1500
65 Ga0207706_10080556 3300025933 Bacteria 2863
66 Ga0207661_10036402 3300025944 Bacteria 3842
67 Ga0207679_10882925 3300025945 Bacteria 817
68 Ga0207640_11775942 3300025981 Bacteria 557
69 Ga0207708_10856133 3300026075 Bacteria 785
70 Ga0207641_10674315 3300026088 Bacteria 1017
71 Ga0207428_10282088 3300027907 Bacteria 1233
72 Ga0268265_11101861 3300028380 Bacteria 788
73 Ga0307413_10918200 3300031824 Bacteria 745
74 Ga0307416_101315518 3300032002 Bacteria 829
75 Ga0307415_101140643 3300032126 Bacteria 732
76 Ga0373931_0945716 3300035691 Bacteria 581
77 Ga0373927_0174910 3300035695 Bacteria 1408
78 Ga0395900_0081657 3300037418 Bacteria 3321
79 Ga0395898_0263284 3300037466 Bacteria 1645
80 Ga0436364_0384683 3300037853 Bacteria 1131
81 Ga0395901_0518092 3300038443 Bacteria 1212
82 Ga0436365_0029262 3300039437 Bacteria 2101
83 Ga0436360_0982658 3300039438 Unclassified 646
84 Ga0436363_0926679 3300039450 Bacteria 1013
85 Ga0436363_0944993 3300039450 Bacteria 838
86 Ga0436363_1559044 3300039450 Bacteria 849
87 Ga0451791_1400957 3300041451 Bacteria 557
88 Ga0451853_0905238 3300041512 Bacteria 910
89 Ga0450905_083668 3300042142 Bacteria 557
90 Ga0439458_0096129 3300042157 Bacteria 766
91 Ga0466969_0365370 3300044656 Bacteria 654
92 Ga0466966_0054824 3300044684 Bacteria 2525
93 Ga0466966_0055724 3300044684 Bacteria 2502
94 Ga0466961_0006132 3300044693 Bacteria 7629
95 Ga0466963_0109052 3300044694 Bacteria 1899
96 Ga0466968_0692040 3300044735 Unclassified 520
97 Ga0466957_0181058 3300044842 Bacteria 1376
98 Ga0466959_0113894 3300045049 Bacteria 1928
99 Ga0466959_0173781 3300045049 Bacteria 1510
100 Ga0466959_0392375 3300045049 Bacteria 944
101 Ga0466958_0032288 3300045836 Bacteria 3115
102 Ga0466958_0510522 3300045836 Bacteria 780
103 Ga0466967_1754709 3300045976 Bacteria 618
104 Ga0495603_0731058 3300046455 Bacteria 566
105 Ga0495641_0081108 3300046461 Bacteria 1453
106 Ga0495584_0059951 3300046491 Bacteria 1914
107 Ga0495637_0096501 3300046520 Bacteria 1160
108 Ga0495663_0043735 3300046525 Bacteria 1369
109 Ga0495609_0274777 3300046538 Bacteria 690
110 Ga0495656_0031277 3300046615 Bacteria 2158
111 Ga0495668_0303984 3300046616 Bacteria 875
112 Ga0495670_0830913 3300046691 Bacteria 504
113 Ga0495589_0167849 3300046794 Bacteria 1044
114 Ga0495581_0159604 3300047315 Bacteria 1318
115 Ga0495676_0251744 3300047321 Bacteria 1205
116 Ga0496100_1120836 3300048903 Bacteria 620
117 Ga0496101_0063202 3300048904 Bacteria 2694
118 Ga0496101_0492876 3300048904 Bacteria 968
119 Ga0496102_0021561 3300048905 Bacteria 5698
120 Ga0496102_0957378 3300048905 Bacteria 777
121 Ga0496102_1810307 3300048905 Bacteria 528
122 Ga0496103_0050290 3300048906 Bacteria 2578
123 Ga0496103_1038824 3300048906 Bacteria 509
124 Ga0496104_0044436 3300048907 Bacteria 4174
125 Ga0496104_0080026 3300048907 Bacteria 3115
126 Ga0496105_0136554 3300048908 Bacteria 2020
127 Ga0496105_0232447 3300048908 Bacteria 1498
128 Ga0496106_0008939 3300048909 Bacteria 7405
129 Ga0496106_0667547 3300048909 Bacteria 830
130 Ga0496107_0096089 3300048910 Bacteria 2168
131 Ga0496108_0037244 3300048911 Bacteria 4050
132 Ga0496108_0355921 3300048911 Bacteria 1277
133 Ga0496108_0952598 3300048911 Bacteria 735
134 Ga0496109_0011583 3300048912 Bacteria 7588
135 Ga0496109_0097919 3300048912 Bacteria 2719
136 Ga0496110_0003495 3300048913 Bacteria 12055
137 Ga0496110_0032468 3300048913 Bacteria 4509
138 Ga0496111_0005939 3300048914 Bacteria 7878
139 Ga0496111_0027874 3300048914 Bacteria 4000
140 Ga0496111_0115691 3300048914 Bacteria 1977
141 Ga0496111_0919897 3300048914 Bacteria 629
142 Ga0496112_0029639 3300048915 Bacteria 5293
143 Ga0496112_0184456 3300048915 Bacteria 2050
144 Ga0496113_0009239 3300048916 Bacteria 6468
145 Ga0496113_0373577 3300048916 Bacteria 1144
146 Ga0496114_0191427 3300048917 Bacteria 1790
147 Ga0501031_0030362 3300049568 Bacteria 3525
148 Ga0501031_0174789 3300049568 Bacteria 1403
149 Ga0501032_0126875 3300049569 Bacteria 1685
150 Ga0501034_0645119 3300049571 Bacteria 961
151 Ga0501036_0074927 3300049572 Bacteria 2862
152 Ga0501036_0102666 3300049572 Bacteria 2419
153 Ga0501037_0207690 3300049573 Bacteria 1382
154 Ga0501039_0027734 3300049575 Bacteria 4355
155 Ga0501039_0105647 3300049575 Bacteria 2199
156 Ga0501040_0143185 3300049576 Bacteria 1684
157 Ga0501040_0396090 3300049576 Bacteria 991
158 Ga0501041_0030118 3300049577 Bacteria 3276
159 Ga0501041_0080264 3300049577 Bacteria 2009
160 Ga0501042_0022763 3300049578 Bacteria 4379
161 Ga0501042_0043463 3300049578 Bacteria 3200
162 Ga0501043_0126011 3300049579 Bacteria 2008
163 Ga0501046_0070516 3300049580 Bacteria 2717
164 Ga0501048_0127653 3300049582 Bacteria 1798
165 Ga0501048_0327687 3300049582 Bacteria 1091
166 Ga0501068_0043630 3300049584 Bacteria 2698
167 Ga0501068_0481765 3300049584 Bacteria 804
168 Ga0501069_0184781 3300049585 Bacteria 1205
169 Ga0501070_0022841 3300049586 Bacteria 5236
170 Ga0501071_0001126 3300049587 Bacteria 14927
171 Ga0501071_0019970 3300049587 Bacteria 4654
172 Ga0501071_0944280 3300049587 Bacteria 666
173 Ga0501072_0045084 3300049588 Bacteria 3466
174 Ga0501072_0455412 3300049588 Bacteria 1013
175 Ga0501073_0211889 3300049589 Bacteria 1339
176 Ga0501074_0059549 3300049590 Bacteria 2751
177 Ga0501074_0220251 3300049590 Bacteria 1351
178 Ga0501075_0013036 3300049591 Bacteria 5924
179 Ga0501076_0003955 3300049592 Bacteria 10461
180 Ga0501076_1536326 3300049592 Bacteria 546
181 Ga0501077_0032247 3300049593 Bacteria 3335
182 Ga0501079_0016572 3300049741 Bacteria 5628
183 Ga0501079_0090742 3300049741 Bacteria 2367
184 Ga0501080_0139356 3300049742 Bacteria 2243
185 Ga0501081_0131791 3300049743 Bacteria 1786
186 Ga0501081_0212663 3300049743 Bacteria 1405
187 Ga0501083_0084865 3300049744 Bacteria 2096
188 Ga0501083_0091826 3300049744 Bacteria 2004
189 Ga0501035_0312852 3300049822 Bacteria 1321
190 Ga0501045_0084603 3300049824 Bacteria 2340
191 Ga0501045_0529624 3300049824 Bacteria 874
192 nmdc:mga08y16_33252_c1 3300050511 Bacteria 5416
193 nmdc:mga0rr50_1223024_c1 3300050513 Bacteria 638
194 nmdc:mga0a205_22354_c1 3300050515 Bacteria 3651
195 nmdc:mga0a205_543212_c1 3300050515 Bacteria 1018
196 Ga0501084_0093498 3300054114 Bacteria 2524
197 Ga0501082_0326694 3300060353 Bacteria 1336
198 Ga0501082_0719861 3300060353 Bacteria 873
199 Ga0530510_0008744 3300061734 Bacteria 7082
200 Ga0530510_0884492 3300061734 Bacteria 682
201 Ga0466966_0131534
202 Ga0070676_10856842
203 Ga0070683_100199783
204 Ga0070683_101066478
205 Ga0070683_101093605
206 Ga0070691_10196511
207 Ga0070692_10130109
208 Ga0070669_100939932
209 Ga0070675_100470694
210 Ga0070671_100854209
211 Ga0070659_100086977
212 Ga0070709_11198106
213 Ga0070710_11321143
214 Ga0070711_101810546
215 Ga0070700_100617326
216 Ga0070698_100639691
217 Ga0070699_101645251
218 Ga0068856_100433436
219 Ga0068852_100903667
220 Ga0068859_100007503
221 Ga0068859_100519657
222 Ga0068851_10636397
223 Ga0068862_101161860
224 Ga0081538_10002646
225 Ga0081538_10133703
226 Ga0075432_10154896
227 Ga0068871_102289616
228 Ga0075433_10085101
229 Ga0075433_10126258
230 Ga0075434_100085182
231 Ga0075429_101578147
232 Ga0097620_100007503
233 Ga0097620_100519637
234 Ga0075435_101299415
235 Ga0111539_10022197
236 Ga0105245_10711790
237 Ga0105241_10623867
238 Ga0105249_12687158
239 Ga0105239_10088713
240 Ga0105239_10980814
241 Ga0157337_1006981
242 Ga0157326_1092875
243 Ga0157369_11356313
244 Ga0157372_10341600
245 Ga0157372_10487653
246 Ga0163163_11559335
247 Ga0163163_12943005
248 Ga0182008_10543814
249 Ga0157377_10098808
250 Ga0213874_10204975
251 Ga0207656_10522315
252 Ga0207688_10020037
253 Ga0207699_10676496
254 Ga0207645_10240246
255 Ga0207654_10876617
256 Ga0207649_10434480
257 Ga0207681_10251594
258 Ga0207659_10313301
259 Ga0207687_10660118
260 Ga0207687_10720954
261 Ga0207664_10004970
262 Ga0207664_11021627
263 Ga0207644_10293681
264 Ga0207690_10205012
265 Ga0207706_10080556
266 Ga0207661_10036402
267 Ga0207679_10882925
268 Ga0207640_11775942
269 Ga0207708_10856133
270 Ga0207641_10674315
271 Ga0207428_10282088
272 Ga0268265_11101861
273 Ga0307413_10918200
274 Ga0307416_101315518
275 Ga0307415_101140643
276 Ga0373931_0945716
277 Ga0373927_0174910
278 Ga0395900_0081657
279 Ga0395898_0263284
280 Ga0436364_0384683
281 Ga0395901_0518092
282 Ga0436365_0029262
283 Ga0436360_0982658
284 Ga0436363_0926679
285 Ga0436363_0944993
286 Ga0436363_1559044
287 Ga0451791_1400957
288 Ga0451853_0905238
289 Ga0450905_083668
290 Ga0439458_0096129
291 Ga0466969_0365370
292 Ga0466966_0054824
293 Ga0466966_0055724
294 Ga0466961_0006132
295 Ga0466963_0109052
296 Ga0466968_0692040
297 Ga0466957_0181058
298 Ga0466959_0113894
299 Ga0466959_0173781
300 Ga0466959_0392375
301 Ga0466958_0032288
302 Ga0466958_0510522
303 Ga0466967_1754709
304 Ga0495603_0731058
305 Ga0495641_0081108
306 Ga0495584_0059951
307 Ga0495637_0096501
308 Ga0495663_0043735
309 Ga0495609_0274777
310 Ga0495656_0031277
311 Ga0495668_0303984
312 Ga0495670_0830913
313 Ga0495589_0167849
314 Ga0495581_0159604
315 Ga0495676_0251744
316 Ga0496100_1120836
317 Ga0496101_0063202
318 Ga0496101_0492876
319 Ga0496102_0021561
320 Ga0496102_0957378
321 Ga0496102_1810307
322 Ga0496103_0050290
323 Ga0496103_1038824
324 Ga0496104_0044436
325 Ga0496104_0080026
326 Ga0496105_0136554
327 Ga0496105_0232447
328 Ga0496106_0008939
329 Ga0496106_0667547
330 Ga0496107_0096089
331 Ga0496108_0037244
332 Ga0496108_0355921
333 Ga0496108_0952598
334 Ga0496109_0011583
335 Ga0496109_0097919
336 Ga0496110_0003495
337 Ga0496110_0032468
338 Ga0496111_0005939
339 Ga0496111_0027874
340 Ga0496111_0115691
341 Ga0496111_0919897
342 Ga0496112_0029639
343 Ga0496112_0184456
344 Ga0496113_0009239
345 Ga0496113_0373577
346 Ga0496114_0191427
347 Ga0501031_0030362
348 Ga0501031_0174789
349 Ga0501032_0126875
350 Ga0501034_0645119
351 Ga0501036_0074927
352 Ga0501036_0102666
353 Ga0501037_0207690
354 Ga0501039_0027734
355 Ga0501039_0105647
356 Ga0501040_0143185
357 Ga0501040_0396090
358 Ga0501041_0030118
359 Ga0501041_0080264
360 Ga0501042_0022763
361 Ga0501042_0043463
362 Ga0501043_0126011
363 Ga0501046_0070516
364 Ga0501048_0127653
365 Ga0501048_0327687
366 Ga0501068_0043630
367 Ga0501068_0481765
368 Ga0501069_0184781
369 Ga0501070_0022841
370 Ga0501071_0001126
371 Ga0501071_0019970
372 Ga0501071_0944280
373 Ga0501072_0045084
374 Ga0501072_0455412
375 Ga0501073_0211889
376 Ga0501074_0059549
377 Ga0501074_0220251
378 Ga0501075_0013036
379 Ga0501076_0003955
380 Ga0501076_1536326
381 Ga0501077_0032247
382 Ga0501079_0016572
383 Ga0501079_0090742
384 Ga0501080_0139356
385 Ga0501081_0131791
386 Ga0501081_0212663
387 Ga0501083_0084865
388 Ga0501083_0091826
389 Ga0501035_0312852
390 Ga0501045_0084603
391 Ga0501045_0529624
392 nmdc:mga08y16_33252_c1
393 nmdc:mga0rr50_1223024_c1
394 nmdc:mga0a205_22354_c1
395 nmdc:mga0a205_543212_c1
396 Ga0501084_0093498
397 Ga0501082_0326694
398 Ga0501082_0719861
399 Ga0530510_0008744
400 Ga0530510_0884492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

22

90

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8427 8 98
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.8126 10 95
4fip-assembly1.cif.gz_A structure of the saga ubp8(s144n)/sgf11(1-72, delta-znf)/sus1/sgf73 dub module 0.8125 43 96
4fjc-assembly1.cif.gz_A structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module 0.8105 43 96
3mhh-assembly1.cif.gz_A structure of the saga ubp8/sgf11/sus1/sgf73 dub module 0.8081 43 96
ID Description Score Start End Superfamily
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8904 30 95 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8605 28 95 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8427 8 98 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8168 8 98 3.30.40.10
4fk5A01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8143 43 96 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A538H4T4-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9986 47 102 GO:0008270
AF-A0A841NYZ2-F1-model_v4 deleted 0.9782 46 95
AF-A0A7W1B4V7-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9738 31 92 GO:0008270
AF-A0A3N5REA5-F1-model_v4 UBP-type domain-containing protein 0.9722 30 96 GO:0008270
AF-A0A3N5V2X7-F1-model_v4 UBP-type domain-containing protein 0.9693 30 96 GO:0008270

Map