F307178
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 200 | 161 | 200 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10018276|Ga0157375_100182766 |
| Length | 205 |
| Sequence | VQRVTSMIFATANKHKLREMRELLPDLELESLPDGVELPPEEGASFAGIALEKARAAHAATGAAAIGDDSGIEAMGLGGRPGIHSARYGGDGATDEENLAKLLREVTAAGDDRRAAYHCALALVEADGSERVFEARCEGRLIEEARGEGGFGYDPAFVPDDTGGDDPRTMSELSQAEKNEISHRGHAARLLAAHLGASEATSRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 83 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 84 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 85 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 86 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 87 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 90 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 93 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 94 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 95 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 96 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 143 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 144 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.5 |
| Rhizosphere | 89.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000283 | 3300001977 | Bacteria | 7228 |
| 2 | Ga0070683_100009930 | 3300005329 | Bacteria | 8160 |
| 3 | Ga0070683_100016897 | 3300005329 | Bacteria | 6439 |
| 4 | Ga0070677_10000028 | 3300005333 | Bacteria | 43011 |
| 5 | Ga0070680_100060544 | 3300005336 | Bacteria | 3098 |
| 6 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 7 | Ga0068868_100001254 | 3300005338 | Bacteria | 17445 |
| 8 | Ga0070661_100349866 | 3300005344 | Bacteria | 1159 |
| 9 | Ga0070674_100000019 | 3300005356 | Bacteria | 89350 |
| 10 | Ga0070674_100000327 | 3300005356 | Bacteria | 23475 |
| 11 | Ga0070673_100349501 | 3300005364 | Bacteria | 1312 |
| 12 | Ga0070703_10123421 | 3300005406 | Bacteria | 942 |
| 13 | Ga0070714_100383704 | 3300005435 | Bacteria | 1325 |
| 14 | Ga0070711_100002037 | 3300005439 | Bacteria | 11394 |
| 15 | Ga0070700_100001694 | 3300005441 | Bacteria | 11065 |
| 16 | Ga0070694_100396804 | 3300005444 | Bacteria | 1079 |
| 17 | Ga0070678_101127177 | 3300005456 | Unclassified | 725 |
| 18 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 19 | Ga0068867_100002663 | 3300005459 | Bacteria | 12598 |
| 20 | Ga0070679_100000088 | 3300005530 | Bacteria | 69314 |
| 21 | Ga0070684_100009796 | 3300005535 | Bacteria | 7567 |
| 22 | Ga0068853_100002786 | 3300005539 | Bacteria | 13216 |
| 23 | Ga0070693_100024038 | 3300005547 | Bacteria | 3264 |
| 24 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 25 | Ga0070664_100011230 | 3300005564 | Bacteria | 7266 |
| 26 | Ga0068854_100001995 | 3300005578 | Bacteria | 12493 |
| 27 | Ga0068856_100010553 | 3300005614 | Bacteria | 8968 |
| 28 | Ga0068856_100255022 | 3300005614 | Bacteria | 1769 |
| 29 | Ga0068852_100123384 | 3300005616 | Bacteria | 2375 |
| 30 | Ga0068866_10000005 | 3300005718 | Bacteria | 196339 |
| 31 | Ga0068866_10001146 | 3300005718 | Bacteria | 11642 |
| 32 | Ga0068863_100002309 | 3300005841 | Bacteria | 18966 |
| 33 | Ga0068858_100004437 | 3300005842 | Bacteria | 13763 |
| 34 | Ga0068860_100011791 | 3300005843 | Bacteria | 8614 |
| 35 | Ga0081539_10019075 | 3300005985 | Bacteria | 4716 |
| 36 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 37 | Ga0070716_100108928 | 3300006173 | Bacteria | 1713 |
| 38 | Ga0070712_100200119 | 3300006175 | Bacteria | 1568 |
| 39 | Ga0068871_100264491 | 3300006358 | Bacteria | 1501 |
| 40 | Ga0068871_100363685 | 3300006358 | Bacteria | 1282 |
| 41 | Ga0075431_100198838 | 3300006847 | Bacteria | 2051 |
| 42 | Ga0075433_10003730 | 3300006852 | Bacteria | 11786 |
| 43 | Ga0075435_100335273 | 3300007076 | Bacteria | 1296 |
| 44 | Ga0105245_10001424 | 3300009098 | Bacteria | 21694 |
| 45 | Ga0105245_10017829 | 3300009098 | Bacteria | 6199 |
| 46 | Ga0105238_10000033 | 3300009551 | Bacteria | 172981 |
| 47 | Ga0105249_10000368 | 3300009553 | Bacteria | 44712 |
| 48 | Ga0105239_11135473 | 3300010375 | Bacteria | 900 |
| 49 | Ga0105246_10540164 | 3300011119 | Bacteria | 997 |
| 50 | Ga0157374_10000785 | 3300013296 | Bacteria | 27837 |
| 51 | Ga0157374_10976079 | 3300013296 | Bacteria | 866 |
| 52 | Ga0157375_10018276 | 3300013308 | Bacteria | 6355 |
| 53 | Ga0163163_10202140 | 3300014325 | Bacteria | 2035 |
| 54 | Ga0157380_10068512 | 3300014326 | Bacteria | 2860 |
| 55 | Ga0157380_10248843 | 3300014326 | Bacteria | 1607 |
| 56 | Ga0157379_10009082 | 3300014968 | Bacteria | 8664 |
| 57 | Ga0163161_10000064 | 3300017792 | Bacteria | 108508 |
| 58 | Ga0163161_10119303 | 3300017792 | Bacteria | 1980 |
| 59 | Ga0207653_10115712 | 3300025885 | Bacteria | 961 |
| 60 | Ga0207682_10000041 | 3300025893 | Bacteria | 52338 |
| 61 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 62 | Ga0207642_10000221 | 3300025899 | Bacteria | 16812 |
| 63 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 64 | Ga0207707_10226135 | 3300025912 | Bacteria | 1628 |
| 65 | Ga0207693_10061084 | 3300025915 | Bacteria | 2952 |
| 66 | Ga0207663_10000399 | 3300025916 | Bacteria | 18806 |
| 67 | Ga0207660_10226298 | 3300025917 | Bacteria | 1469 |
| 68 | Ga0207652_10000232 | 3300025921 | Bacteria | 58473 |
| 69 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 70 | Ga0207687_10000128 | 3300025927 | Bacteria | 50603 |
| 71 | Ga0207687_10009959 | 3300025927 | Bacteria | 6220 |
| 72 | Ga0207664_10015228 | 3300025929 | Bacteria | 5577 |
| 73 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 74 | Ga0207709_10012427 | 3300025935 | Bacteria | 4690 |
| 75 | Ga0207670_10120254 | 3300025936 | Bacteria | 1908 |
| 76 | Ga0207669_10000029 | 3300025937 | Bacteria | 88351 |
| 77 | Ga0207669_10000140 | 3300025937 | Bacteria | 34667 |
| 78 | Ga0207665_10146252 | 3300025939 | Bacteria | 1689 |
| 79 | Ga0207661_10005065 | 3300025944 | Bacteria | 9252 |
| 80 | Ga0207661_10006598 | 3300025944 | Bacteria | 8205 |
| 81 | Ga0207651_10000840 | 3300025960 | Bacteria | 13360 |
| 82 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 83 | Ga0207640_10004505 | 3300025981 | Bacteria | 7558 |
| 84 | Ga0207677_10001420 | 3300026023 | Bacteria | 12761 |
| 85 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 86 | Ga0207639_10003217 | 3300026041 | Bacteria | 10984 |
| 87 | Ga0207708_10003318 | 3300026075 | Bacteria | 11848 |
| 88 | Ga0207702_10003502 | 3300026078 | Bacteria | 14309 |
| 89 | Ga0207702_10392931 | 3300026078 | Bacteria | 1336 |
| 90 | Ga0207641_10000062 | 3300026088 | Bacteria | 159982 |
| 91 | Ga0207648_10005599 | 3300026089 | Bacteria | 12631 |
| 92 | Ga0207683_10015234 | 3300026121 | Bacteria | 6543 |
| 93 | Ga0207698_10060810 | 3300026142 | Bacteria | 2939 |
| 94 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 95 | Ga0268264_10000725 | 3300028381 | Bacteria | 37821 |
| 96 | Ga0265326_10000179 | 3300028558 | Bacteria | 32210 |
| 97 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 98 | Ga0265336_10030488 | 3300028666 | Bacteria | 1679 |
| 99 | Ga0265328_10000563 | 3300031239 | Bacteria | 17200 |
| 100 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 101 | Ga0265331_10005825 | 3300031250 | Bacteria | 7384 |
| 102 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 103 | Ga0265316_10057449 | 3300031344 | Bacteria | 3034 |
| 104 | Ga0373937_0022529 | 3300036401 | Bacteria | 5665 |
| 105 | Ga0373937_1613089 | 3300036401 | Unclassified | 596 |
| 106 | Ga0395901_1173017 | 3300038443 | Bacteria | 735 |
| 107 | Ga0451833_1411990 | 3300041491 | Bacteria | 1674 |
| 108 | Ga0451853_1174682 | 3300041512 | Bacteria | 5305 |
| 109 | Ga0466963_0001315 | 3300044694 | Bacteria | 13214 |
| 110 | Ga0466967_0022277 | 3300045976 | Bacteria | 5166 |
| 111 | Ga0495592_0000423 | 3300046454 | Bacteria | 32094 |
| 112 | Ga0495603_0000194 | 3300046455 | Bacteria | 31819 |
| 113 | Ga0495603_0010008 | 3300046455 | Bacteria | 5737 |
| 114 | Ga0495629_0163408 | 3300046459 | Bacteria | 1546 |
| 115 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 116 | Ga0495653_0230478 | 3300046463 | Bacteria | 1240 |
| 117 | Ga0495582_0000002 | 3300046473 | Bacteria | 219909 |
| 118 | Ga0495639_0003343 | 3300046475 | Bacteria | 6954 |
| 119 | Ga0495662_0000681 | 3300046476 | Bacteria | 16074 |
| 120 | Ga0495608_0000092 | 3300046511 | Bacteria | 64795 |
| 121 | Ga0495608_0020753 | 3300046511 | Bacteria | 4513 |
| 122 | Ga0495618_0000094 | 3300046514 | Bacteria | 64293 |
| 123 | Ga0495620_0001737 | 3300046515 | Bacteria | 12862 |
| 124 | Ga0495628_0014113 | 3300046516 | Bacteria | 6706 |
| 125 | Ga0495628_0038288 | 3300046516 | Bacteria | 3839 |
| 126 | Ga0495628_0239185 | 3300046516 | Unclassified | 1359 |
| 127 | Ga0495630_0000519 | 3300046517 | Bacteria | 28420 |
| 128 | Ga0495644_0005806 | 3300046523 | Bacteria | 4822 |
| 129 | Ga0495652_0370888 | 3300046529 | Bacteria | 1020 |
| 130 | Ga0495586_0001540 | 3300046535 | Bacteria | 12722 |
| 131 | Ga0495586_0092506 | 3300046535 | Bacteria | 1672 |
| 132 | Ga0495587_0094397 | 3300046536 | Bacteria | 1727 |
| 133 | Ga0495621_0001277 | 3300046539 | Bacteria | 6503 |
| 134 | Ga0495645_0031021 | 3300046543 | Bacteria | 3893 |
| 135 | Ga0495645_0049365 | 3300046543 | Bacteria | 3065 |
| 136 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 137 | Ga0495634_0043852 | 3300046642 | Bacteria | 3030 |
| 138 | Ga0495635_0000182 | 3300046663 | Bacteria | 39469 |
| 139 | Ga0495657_0038722 | 3300046675 | Bacteria | 3279 |
| 140 | Ga0495599_0058373 | 3300046678 | Bacteria | 2414 |
| 141 | Ga0495599_0123708 | 3300046678 | Bacteria | 1608 |
| 142 | Ga0495623_0163919 | 3300046679 | Bacteria | 1304 |
| 143 | Ga0495647_0000005 | 3300046681 | Bacteria | 125996 |
| 144 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 145 | Ga0495669_0000248 | 3300046684 | Bacteria | 31659 |
| 146 | Ga0495613_0000173 | 3300046689 | Bacteria | 62463 |
| 147 | Ga0495624_0000600 | 3300046690 | Bacteria | 28092 |
| 148 | Ga0495624_0202568 | 3300046690 | Bacteria | 1205 |
| 149 | Ga0495649_0003329 | 3300046694 | Bacteria | 10917 |
| 150 | Ga0495600_0007928 | 3300046809 | Bacteria | 6509 |
| 151 | Ga0495600_0200146 | 3300046809 | Bacteria | 1283 |
| 152 | Ga0495604_0000437 | 3300047317 | Bacteria | 37081 |
| 153 | Ga0495604_0040502 | 3300047317 | Bacteria | 3658 |
| 154 | Ga0495672_0234618 | 3300047320 | Bacteria | 899 |
| 155 | Ga0495676_0000320 | 3300047321 | Bacteria | 38969 |
| 156 | Ga0495676_0279816 | 3300047321 | Bacteria | 1130 |
| 157 | Ga0495680_0000113 | 3300047322 | Bacteria | 76525 |
| 158 | Ga0495680_0005581 | 3300047322 | Bacteria | 11797 |
| 159 | Ga0495680_0259548 | 3300047322 | Bacteria | 1229 |
| 160 | Ga0495679_004087 | 3300047446 | Bacteria | 6832 |
| 161 | Ga0495593_0129876 | 3300047673 | Bacteria | 1279 |
| 162 | Ga0495602_0038771 | 3300048088 | Bacteria | 4399 |
| 163 | Ga0496100_0000234 | 3300048903 | Bacteria | 29327 |
| 164 | Ga0496100_0904505 | 3300048903 | Bacteria | 693 |
| 165 | Ga0496101_0000382 | 3300048904 | Bacteria | 29327 |
| 166 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 167 | Ga0496104_0007004 | 3300048907 | Bacteria | 9942 |
| 168 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 169 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 170 | Ga0496106_0000042 | 3300048909 | Bacteria | 106662 |
| 171 | Ga0496106_0000455 | 3300048909 | Bacteria | 29281 |
| 172 | Ga0496107_0000234 | 3300048910 | Bacteria | 29310 |
| 173 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 174 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 175 | Ga0496109_0416545 | 3300048912 | Bacteria | 1269 |
| 176 | Ga0496110_0044686 | 3300048913 | Bacteria | 3869 |
| 177 | Ga0496111_0120044 | 3300048914 | Bacteria | 1942 |
| 178 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 179 | Ga0496113_0020261 | 3300048916 | Bacteria | 4673 |
| 180 | Ga0496113_0253626 | 3300048916 | Bacteria | 1405 |
| 181 | Ga0496114_0007563 | 3300048917 | Bacteria | 8594 |
| 182 | Ga0501031_0075272 | 3300049568 | Bacteria | 2198 |
| 183 | Ga0501031_0613467 | 3300049568 | Bacteria | 700 |
| 184 | Ga0501039_0098496 | 3300049575 | Bacteria | 2281 |
| 185 | Ga0501040_0032011 | 3300049576 | Bacteria | 3557 |
| 186 | Ga0501041_0357152 | 3300049577 | Archaea | 924 |
| 187 | Ga0501072_0301192 | 3300049588 | Bacteria | 1274 |
| 188 | Ga0501075_0068788 | 3300049591 | Bacteria | 2675 |
| 189 | Ga0501045_0348855 | 3300049824 | Bacteria | 1102 |
| 190 | nmdc:mga06r32_105878_c1 | 3300050510 | Bacteria | 2763 |
| 191 | nmdc:mga0n895_883285_c1 | 3300050512 | Bacteria | 880 |
| 192 | nmdc:mga0a205_4_c1 | 3300050515 | Bacteria | 168154 |
| 193 | Ga0495601_0000444 | 3300053077 | Bacteria | 21636 |
| 194 | Ga0495601_0135839 | 3300053077 | Bacteria | 1603 |
| 195 | Ga0495601_0372845 | 3300053077 | Bacteria | 927 |
| 196 | Ga0495612_0002922 | 3300053078 | Bacteria | 7083 |
| 197 | Ga0495612_0041298 | 3300053078 | Bacteria | 1881 |
| 198 | Ga0495595_0004468 | 3300053084 | Bacteria | 5631 |
| 199 | Ga0495619_0014404 | 3300053085 | Bacteria | 4994 |
| 200 | Ga0501082_0558252 | 3300060353 | Bacteria | 1002 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10001424 | Ga0105245_100014246 | 153 |
| 2 | 3300025927 | Ga0207687_10000128 | Ga0207687_100001287 | 155 |
| 3 | 3300036401 | Ga0373937_0022529 | Ga0373937_0022529_769_1365 | 157 |
| 4 | 3300036401 | Ga0373937_1613089 | Ga0373937_1613089_21_569 | 163 |
| 5 | 3300005356 | Ga0070674_100000019 | Ga0070674_10000001913 | 165 |
| 6 | 3300060353 | Ga0501082_0558252 | Ga0501082_0558252_10_564 | 165 |
| 7 | 3300049568 | Ga0501031_0613467 | Ga0501031_0613467_18_617 | 166 |
| 8 | 3300005337 | Ga0070682_100000023 | Ga0070682_100000023208 | 167 |
| 9 | 3300005441 | Ga0070700_100001694 | Ga0070700_1000016944 | 167 |
| 10 | 3300005530 | Ga0070679_100000088 | Ga0070679_10000008831 | 167 |
| 11 | 3300005539 | Ga0068853_100002786 | Ga0068853_10000278613 | 167 |
| 12 | 3300005614 | Ga0068856_100010553 | Ga0068856_1000105533 | 167 |
| 13 | 3300050512 | nmdc:mga0n895_883285_c1 | nmdc:mga0n895_883285_c1_299_859 | 167 |
| 14 | 3300026075 | Ga0207708_10003318 | Ga0207708_100033186 | 168 |
| 15 | 3300049591 | Ga0501075_0068788 | Ga0501075_0068788_1811_2410 | 168 |
| 16 | 3300005364 | Ga0070673_100349501 | Ga0070673_1003495012 | 169 |
| 17 | 3300025960 | Ga0207651_10000840 | Ga0207651_100008402 | 169 |
| 18 | 3300038443 | Ga0395901_1173017 | Ga0395901_1173017_115_693 | 169 |
| 19 | 3300005985 | Ga0081539_10019075 | Ga0081539_100190752 | 170 |
| 20 | 3300017792 | Ga0163161_10119303 | Ga0163161_101193032 | 171 |
| 21 | 3300006847 | Ga0075431_100198838 | Ga0075431_1001988382 | 173 |
| 22 | 3300049568 | Ga0501031_0075272 | Ga0501031_0075272_1258_1848 | 173 |
| 23 | 3300049575 | Ga0501039_0098496 | Ga0501039_0098496_1166_1756 | 173 |
| 24 | 3300049576 | Ga0501040_0032011 | Ga0501040_0032011_542_1132 | 173 |
| 25 | 3300049588 | Ga0501072_0301192 | Ga0501072_0301192_148_738 | 173 |
| 26 | 3300050510 | nmdc:mga06r32_105878_c1 | nmdc:mga06r32_105878_c1_416_997 | 173 |
| 27 | 3300005344 | Ga0070661_100349866 | Ga0070661_1003498662 | 178 |
| 28 | 3300005456 | Ga0070678_101127177 | Ga0070678_1011271771 | 178 |
| 29 | 3300005564 | Ga0070664_100011230 | Ga0070664_1000112306 | 178 |
| 30 | 3300005718 | Ga0068866_10000005 | Ga0068866_1000000542 | 178 |
| 31 | 3300005843 | Ga0068860_100011791 | Ga0068860_10001179112 | 178 |
| 32 | 3300006163 | Ga0070715_10000008 | Ga0070715_1000000886 | 178 |
| 33 | 3300006358 | Ga0068871_100264491 | Ga0068871_1002644912 | 178 |
| 34 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005246 | 178 |
| 35 | 3300025905 | Ga0207685_10000012 | Ga0207685_1000001286 | 178 |
| 36 | 3300025937 | Ga0207669_10000140 | Ga0207669_1000014037 | 178 |
| 37 | 3300026121 | Ga0207683_10015234 | Ga0207683_100152342 | 178 |
| 38 | 3300028381 | Ga0268264_10000725 | Ga0268264_1000072530 | 178 |
| 39 | 3300046642 | Ga0495634_0043852 | Ga0495634_0043852_670_1263 | 178 |
| 40 | 3300048912 | Ga0496109_0416545 | Ga0496109_0416545_392_985 | 178 |
| 41 | 3300049824 | Ga0501045_0348855 | Ga0501045_0348855_214_807 | 178 |
| 42 | 3300005329 | Ga0070683_100016897 | Ga0070683_1000168974 | 179 |
| 43 | 3300005439 | Ga0070711_100002037 | Ga0070711_10000203715 | 179 |
| 44 | 3300005841 | Ga0068863_100002309 | Ga0068863_1000023099 | 179 |
| 45 | 3300007076 | Ga0075435_100335273 | Ga0075435_1003352732 | 179 |
| 46 | 3300009551 | Ga0105238_10000033 | Ga0105238_10000033174 | 179 |
| 47 | 3300025916 | Ga0207663_10000399 | Ga0207663_1000039924 | 179 |
| 48 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012175 | 179 |
| 49 | 3300025944 | Ga0207661_10005065 | Ga0207661_100050654 | 179 |
| 50 | 3300026088 | Ga0207641_10000062 | Ga0207641_10000062185 | 179 |
| 51 | 3300041491 | Ga0451833_1411990 | Ga0451833_1411990_627_1220 | 179 |
| 52 | 3300044694 | Ga0466963_0001315 | Ga0466963_0001315_3810_4406 | 179 |
| 53 | 3300046455 | Ga0495603_0010008 | Ga0495603_0010008_772_1368 | 179 |
| 54 | 3300046463 | Ga0495653_0230478 | Ga0495653_0230478_570_1169 | 179 |
| 55 | 3300046473 | Ga0495582_0000002 | Ga0495582_0000002_207099_207695 | 179 |
| 56 | 3300046476 | Ga0495662_0000681 | Ga0495662_0000681_4954_5550 | 179 |
| 57 | 3300046529 | Ga0495652_0370888 | Ga0495652_0370888_238_834 | 179 |
| 58 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_184573_185169 | 179 |
| 59 | 3300047317 | Ga0495604_0040502 | Ga0495604_0040502_585_1178 | 179 |
| 60 | 3300048909 | Ga0496106_0000042 | Ga0496106_0000042_101896_102492 | 179 |
| 61 | 3300001977 | JGI24746J21847_1000283 | JGI24746J21847_10002838 | 180 |
| 62 | 3300005329 | Ga0070683_100009930 | Ga0070683_1000099308 | 180 |
| 63 | 3300005333 | Ga0070677_10000028 | Ga0070677_100000288 | 180 |
| 64 | 3300005336 | Ga0070680_100060544 | Ga0070680_1000605445 | 180 |
| 65 | 3300005338 | Ga0068868_100001254 | Ga0068868_1000012549 | 180 |
| 66 | 3300005356 | Ga0070674_100000327 | Ga0070674_10000032725 | 180 |
| 67 | 3300005406 | Ga0070703_10123421 | Ga0070703_101234212 | 180 |
| 68 | 3300005435 | Ga0070714_100383704 | Ga0070714_1003837041 | 180 |
| 69 | 3300005444 | Ga0070694_100396804 | Ga0070694_1003968042 | 180 |
| 70 | 3300005457 | Ga0070662_100000001 | Ga0070662_100000001129 | 180 |
| 71 | 3300005459 | Ga0068867_100002663 | Ga0068867_1000026639 | 180 |
| 72 | 3300005535 | Ga0070684_100009796 | Ga0070684_1000097968 | 180 |
| 73 | 3300005547 | Ga0070693_100024038 | Ga0070693_1000240382 | 180 |
| 74 | 3300005548 | Ga0070665_100000022 | Ga0070665_10000002264 | 180 |
| 75 | 3300005578 | Ga0068854_100001995 | Ga0068854_1000019952 | 180 |
| 76 | 3300005614 | Ga0068856_100255022 | Ga0068856_1002550222 | 180 |
| 77 | 3300005616 | Ga0068852_100123384 | Ga0068852_1001233841 | 180 |
| 78 | 3300005718 | Ga0068866_10001146 | Ga0068866_100011468 | 180 |
| 79 | 3300005842 | Ga0068858_100004437 | Ga0068858_10000443710 | 180 |
| 80 | 3300006173 | Ga0070716_100108928 | Ga0070716_1001089281 | 180 |
| 81 | 3300006175 | Ga0070712_100200119 | Ga0070712_1002001192 | 180 |
| 82 | 3300006358 | Ga0068871_100363685 | Ga0068871_1003636852 | 180 |
| 83 | 3300006852 | Ga0075433_10003730 | Ga0075433_1000373013 | 180 |
| 84 | 3300009098 | Ga0105245_10017829 | Ga0105245_100178297 | 180 |
| 85 | 3300009553 | Ga0105249_10000368 | Ga0105249_1000036828 | 180 |
| 86 | 3300010375 | Ga0105239_11135473 | Ga0105239_111354732 | 180 |
| 87 | 3300011119 | Ga0105246_10540164 | Ga0105246_105401642 | 180 |
| 88 | 3300013296 | Ga0157374_10000785 | Ga0157374_1000078523 | 180 |
| 89 | 3300013296 | Ga0157374_10976079 | Ga0157374_109760792 | 180 |
| 90 | 3300013308 | Ga0157375_10018276 | Ga0157375_100182766 | 180 |
| 91 | 3300014325 | Ga0163163_10202140 | Ga0163163_102021402 | 180 |
| 92 | 3300014326 | Ga0157380_10068512 | Ga0157380_100685123 | 180 |
| 93 | 3300014326 | Ga0157380_10248843 | Ga0157380_102488432 | 180 |
| 94 | 3300014968 | Ga0157379_10009082 | Ga0157379_100090827 | 180 |
| 95 | 3300017792 | Ga0163161_10000064 | Ga0163161_1000006473 | 180 |
| 96 | 3300025885 | Ga0207653_10115712 | Ga0207653_101157122 | 180 |
| 97 | 3300025893 | Ga0207682_10000041 | Ga0207682_1000004119 | 180 |
| 98 | 3300025899 | Ga0207642_10000221 | Ga0207642_100002217 | 180 |
| 99 | 3300025912 | Ga0207707_10226135 | Ga0207707_102261352 | 180 |
| 100 | 3300025915 | Ga0207693_10061084 | Ga0207693_100610842 | 180 |
| 101 | 3300025917 | Ga0207660_10226298 | Ga0207660_102262982 | 180 |
| 102 | 3300025921 | Ga0207652_10000232 | Ga0207652_1000023253 | 180 |
| 103 | 3300025927 | Ga0207687_10009959 | Ga0207687_100099597 | 180 |
| 104 | 3300025929 | Ga0207664_10015228 | Ga0207664_100152288 | 180 |
| 105 | 3300025933 | Ga0207706_10000003 | Ga0207706_10000003199 | 180 |
| 106 | 3300025935 | Ga0207709_10012427 | Ga0207709_100124273 | 180 |
| 107 | 3300025936 | Ga0207670_10120254 | Ga0207670_101202543 | 180 |
| 108 | 3300025937 | Ga0207669_10000029 | Ga0207669_1000002971 | 180 |
| 109 | 3300025939 | Ga0207665_10146252 | Ga0207665_101462523 | 180 |
| 110 | 3300025944 | Ga0207661_10006598 | Ga0207661_100065989 | 180 |
| 111 | 3300025961 | Ga0207712_10000027 | Ga0207712_10000027281 | 180 |
| 112 | 3300025981 | Ga0207640_10004505 | Ga0207640_100045052 | 180 |
| 113 | 3300026023 | Ga0207677_10001420 | Ga0207677_1000142015 | 180 |
| 114 | 3300026035 | Ga0207703_10000020 | Ga0207703_10000020117 | 180 |
| 115 | 3300026041 | Ga0207639_10003217 | Ga0207639_1000321710 | 180 |
| 116 | 3300026078 | Ga0207702_10003502 | Ga0207702_100035022 | 180 |
| 117 | 3300026078 | Ga0207702_10392931 | Ga0207702_103929312 | 180 |
| 118 | 3300026089 | Ga0207648_10005599 | Ga0207648_100055999 | 180 |
| 119 | 3300026142 | Ga0207698_10060810 | Ga0207698_100608102 | 180 |
| 120 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029386 | 180 |
| 121 | 3300028558 | Ga0265326_10000179 | Ga0265326_100001792 | 180 |
| 122 | 3300028654 | Ga0265322_10000005 | Ga0265322_10000005109 | 180 |
| 123 | 3300028666 | Ga0265336_10030488 | Ga0265336_100304882 | 180 |
| 124 | 3300031239 | Ga0265328_10000563 | Ga0265328_1000056322 | 180 |
| 125 | 3300031240 | Ga0265320_10000010 | Ga0265320_10000010155 | 180 |
| 126 | 3300031250 | Ga0265331_10005825 | Ga0265331_100058252 | 180 |
| 127 | 3300031251 | Ga0265327_10000040 | Ga0265327_10000040151 | 180 |
| 128 | 3300031344 | Ga0265316_10057449 | Ga0265316_100574492 | 180 |
| 129 | 3300041512 | Ga0451853_1174682 | Ga0451853_1174682_1850_2449 | 180 |
| 130 | 3300045976 | Ga0466967_0022277 | Ga0466967_0022277_958_1560 | 180 |
| 131 | 3300046454 | Ga0495592_0000423 | Ga0495592_0000423_11151_11750 | 180 |
| 132 | 3300046455 | Ga0495603_0000194 | Ga0495603_0000194_30041_30643 | 180 |
| 133 | 3300046459 | Ga0495629_0163408 | Ga0495629_0163408_35_634 | 180 |
| 134 | 3300046461 | Ga0495641_0000004 | Ga0495641_0000004_124094_124693 | 180 |
| 135 | 3300046475 | Ga0495639_0003343 | Ga0495639_0003343_425_1024 | 180 |
| 136 | 3300046511 | Ga0495608_0000092 | Ga0495608_0000092_1053_1655 | 180 |
| 137 | 3300046511 | Ga0495608_0020753 | Ga0495608_0020753_1506_2105 | 180 |
| 138 | 3300046514 | Ga0495618_0000094 | Ga0495618_0000094_62689_63288 | 180 |
| 139 | 3300046515 | Ga0495620_0001737 | Ga0495620_0001737_10988_11587 | 180 |
| 140 | 3300046516 | Ga0495628_0014113 | Ga0495628_0014113_1240_1839 | 180 |
| 141 | 3300046516 | Ga0495628_0038288 | Ga0495628_0038288_2278_2880 | 180 |
| 142 | 3300046516 | Ga0495628_0239185 | Ga0495628_0239185_737_1336 | 180 |
| 143 | 3300046517 | Ga0495630_0000519 | Ga0495630_0000519_14226_14825 | 180 |
| 144 | 3300046523 | Ga0495644_0005806 | Ga0495644_0005806_820_1419 | 180 |
| 145 | 3300046535 | Ga0495586_0001540 | Ga0495586_0001540_7379_7978 | 180 |
| 146 | 3300046535 | Ga0495586_0092506 | Ga0495586_0092506_900_1499 | 180 |
| 147 | 3300046536 | Ga0495587_0094397 | Ga0495587_0094397_160_759 | 180 |
| 148 | 3300046539 | Ga0495621_0001277 | Ga0495621_0001277_2458_3057 | 180 |
| 149 | 3300046543 | Ga0495645_0031021 | Ga0495645_0031021_1088_1687 | 180 |
| 150 | 3300046543 | Ga0495645_0049365 | Ga0495645_0049365_1591_2190 | 180 |
| 151 | 3300046642 | Ga0495634_0000002 | Ga0495634_0000002_78934_79533 | 180 |
| 152 | 3300046663 | Ga0495635_0000182 | Ga0495635_0000182_19430_20029 | 180 |
| 153 | 3300046675 | Ga0495657_0038722 | Ga0495657_0038722_988_1587 | 180 |
| 154 | 3300046678 | Ga0495599_0058373 | Ga0495599_0058373_971_1570 | 180 |
| 155 | 3300046678 | Ga0495599_0123708 | Ga0495599_0123708_720_1322 | 180 |
| 156 | 3300046679 | Ga0495623_0163919 | Ga0495623_0163919_230_829 | 180 |
| 157 | 3300046681 | Ga0495647_0000005 | Ga0495647_0000005_48897_49496 | 180 |
| 158 | 3300046684 | Ga0495669_0000248 | Ga0495669_0000248_11603_12202 | 180 |
| 159 | 3300046689 | Ga0495613_0000173 | Ga0495613_0000173_60801_61400 | 180 |
| 160 | 3300046690 | Ga0495624_0000600 | Ga0495624_0000600_962_1561 | 180 |
| 161 | 3300046690 | Ga0495624_0202568 | Ga0495624_0202568_393_992 | 180 |
| 162 | 3300046694 | Ga0495649_0003329 | Ga0495649_0003329_4310_4909 | 180 |
| 163 | 3300046809 | Ga0495600_0007928 | Ga0495600_0007928_1016_1615 | 180 |
| 164 | 3300046809 | Ga0495600_0200146 | Ga0495600_0200146_57_656 | 180 |
| 165 | 3300047317 | Ga0495604_0000437 | Ga0495604_0000437_16976_17575 | 180 |
| 166 | 3300047320 | Ga0495672_0234618 | Ga0495672_0234618_265_864 | 180 |
| 167 | 3300047321 | Ga0495676_0000320 | Ga0495676_0000320_9458_10057 | 180 |
| 168 | 3300047321 | Ga0495676_0279816 | Ga0495676_0279816_181_780 | 180 |
| 169 | 3300047322 | Ga0495680_0000113 | Ga0495680_0000113_63800_64402 | 180 |
| 170 | 3300047322 | Ga0495680_0005581 | Ga0495680_0005581_5135_5734 | 180 |
| 171 | 3300047322 | Ga0495680_0259548 | Ga0495680_0259548_195_794 | 180 |
| 172 | 3300047446 | Ga0495679_004087 | Ga0495679_004087_5955_6554 | 180 |
| 173 | 3300047673 | Ga0495593_0129876 | Ga0495593_0129876_622_1221 | 180 |
| 174 | 3300048088 | Ga0495602_0038771 | Ga0495602_0038771_838_1437 | 180 |
| 175 | 3300048903 | Ga0496100_0000234 | Ga0496100_0000234_16751_17350 | 180 |
| 176 | 3300048903 | Ga0496100_0904505 | Ga0496100_0904505_19_618 | 180 |
| 177 | 3300048904 | Ga0496101_0000382 | Ga0496101_0000382_16751_17350 | 180 |
| 178 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_173551_174150 | 180 |
| 179 | 3300048907 | Ga0496104_0007004 | Ga0496104_0007004_590_1192 | 180 |
| 180 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_173551_174150 | 180 |
| 181 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_22665_23267 | 180 |
| 182 | 3300048909 | Ga0496106_0000455 | Ga0496106_0000455_11959_12558 | 180 |
| 183 | 3300048910 | Ga0496107_0000234 | Ga0496107_0000234_16739_17338 | 180 |
| 184 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_423152_423751 | 180 |
| 185 | 3300048912 | Ga0496109_0000013 | Ga0496109_0000013_105593_106192 | 180 |
| 186 | 3300048913 | Ga0496110_0044686 | Ga0496110_0044686_923_1522 | 180 |
| 187 | 3300048914 | Ga0496111_0120044 | Ga0496111_0120044_224_823 | 180 |
| 188 | 3300048915 | Ga0496112_0000026 | Ga0496112_0000026_74255_74854 | 180 |
| 189 | 3300048916 | Ga0496113_0020261 | Ga0496113_0020261_1107_1706 | 180 |
| 190 | 3300048916 | Ga0496113_0253626 | Ga0496113_0253626_506_1105 | 180 |
| 191 | 3300048917 | Ga0496114_0007563 | Ga0496114_0007563_7013_7612 | 180 |
| 192 | 3300049577 | Ga0501041_0357152 | Ga0501041_0357152_169_765 | 180 |
| 193 | 3300050515 | nmdc:mga0a205_4_c1 | nmdc:mga0a205_4_c1_86371_86970 | 180 |
| 194 | 3300053077 | Ga0495601_0000444 | Ga0495601_0000444_5052_5651 | 180 |
| 195 | 3300053077 | Ga0495601_0135839 | Ga0495601_0135839_335_937 | 180 |
| 196 | 3300053077 | Ga0495601_0372845 | Ga0495601_0372845_63_662 | 180 |
| 197 | 3300053078 | Ga0495612_0002922 | Ga0495612_0002922_2804_3403 | 180 |
| 198 | 3300053078 | Ga0495612_0041298 | Ga0495612_0041298_166_768 | 180 |
| 199 | 3300053084 | Ga0495595_0004468 | Ga0495595_0004468_1077_1679 | 180 |
| 200 | 3300053085 | Ga0495619_0014404 | Ga0495619_0014404_1748_2347 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.8741 | 2 | 171 |
| 3s86-assembly1.cif.gz_D | crystal structure of tm0159 with bound imp | 0.8632 | 1 | 173 |
| 2e5x-assembly1.cif.gz_A-2 | structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3 | 0.8502 | 2 | 173 |
| 2mjp-assembly1.cif.gz_B | structure-based identification of the biochemical function of a hypothetical protein from methanococcus jannaschii:mj0226 | 0.8415 | 2 | 171 |
| 3tqu-assembly2.cif.gz_D | structure of a ham1 protein from coxiella burnetii | 0.8385 | 2 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8868 | 2 | 173 | 3.90.950.10 |
| 3s86D00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8632 | 1 | 173 | 3.90.950.10 |
| af_P47119_1_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.859 | 2 | 173 | 3.90.950.10 |
| af_Q2FZC5_1_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8578 | 2 | 172 | 3.90.950.10 |
| af_Q4DRX4_9_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8554 | 1 | 170 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838V3Y1-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9169 | 15 | 176 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0046872 GO:0047429 |
| AF-A0A1M3B816-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.916 | 15 | 171 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A7W0U9L5-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9146 | 1 | 174 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0046872 GO:0047429 |
| AF-A0A6I3FT66-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9133 | 2 | 171 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A6J6Q8A2-F1-model_v4 | Unannotated protein | 0.9129 | 1 | 173 |
GO:0000166
GO:0005829 GO:0009117 GO:0009143 GO:0017111 GO:0046872 GO:0047429 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar