F307178

General Info

Members Datasets Scaffolds Average Seq Length
200 161 200 195

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10018276|Ga0157375_100182766
Length 205
Sequence VQRVTSMIFATANKHKLREMRELLPDLELESLPDGVELPPEEGASFAGIALEKARAAHAATGAAAIGDDSGIEAMGLGGRPGIHSARYGGDGATDEENLAKLLREVTAAGDDRRAAYHCALALVEADGSERVFEARCEGRLIEEARGEGGFGYDPAFVPDDTGGDDPRTMSELSQAEKNEISHRGHAARLLAAHLGASEATSRAR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
84 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.5
Rhizosphere 89.5
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000283 3300001977 Bacteria 7228
2 Ga0070683_100009930 3300005329 Bacteria 8160
3 Ga0070683_100016897 3300005329 Bacteria 6439
4 Ga0070677_10000028 3300005333 Bacteria 43011
5 Ga0070680_100060544 3300005336 Bacteria 3098
6 Ga0070682_100000023 3300005337 Bacteria 206016
7 Ga0068868_100001254 3300005338 Bacteria 17445
8 Ga0070661_100349866 3300005344 Bacteria 1159
9 Ga0070674_100000019 3300005356 Bacteria 89350
10 Ga0070674_100000327 3300005356 Bacteria 23475
11 Ga0070673_100349501 3300005364 Bacteria 1312
12 Ga0070703_10123421 3300005406 Bacteria 942
13 Ga0070714_100383704 3300005435 Bacteria 1325
14 Ga0070711_100002037 3300005439 Bacteria 11394
15 Ga0070700_100001694 3300005441 Bacteria 11065
16 Ga0070694_100396804 3300005444 Bacteria 1079
17 Ga0070678_101127177 3300005456 Unclassified 725
18 Ga0070662_100000001 3300005457 Bacteria 317995
19 Ga0068867_100002663 3300005459 Bacteria 12598
20 Ga0070679_100000088 3300005530 Bacteria 69314
21 Ga0070684_100009796 3300005535 Bacteria 7567
22 Ga0068853_100002786 3300005539 Bacteria 13216
23 Ga0070693_100024038 3300005547 Bacteria 3264
24 Ga0070665_100000022 3300005548 Bacteria 379286
25 Ga0070664_100011230 3300005564 Bacteria 7266
26 Ga0068854_100001995 3300005578 Bacteria 12493
27 Ga0068856_100010553 3300005614 Bacteria 8968
28 Ga0068856_100255022 3300005614 Bacteria 1769
29 Ga0068852_100123384 3300005616 Bacteria 2375
30 Ga0068866_10000005 3300005718 Bacteria 196339
31 Ga0068866_10001146 3300005718 Bacteria 11642
32 Ga0068863_100002309 3300005841 Bacteria 18966
33 Ga0068858_100004437 3300005842 Bacteria 13763
34 Ga0068860_100011791 3300005843 Bacteria 8614
35 Ga0081539_10019075 3300005985 Bacteria 4716
36 Ga0070715_10000008 3300006163 Bacteria 189899
37 Ga0070716_100108928 3300006173 Bacteria 1713
38 Ga0070712_100200119 3300006175 Bacteria 1568
39 Ga0068871_100264491 3300006358 Bacteria 1501
40 Ga0068871_100363685 3300006358 Bacteria 1282
41 Ga0075431_100198838 3300006847 Bacteria 2051
42 Ga0075433_10003730 3300006852 Bacteria 11786
43 Ga0075435_100335273 3300007076 Bacteria 1296
44 Ga0105245_10001424 3300009098 Bacteria 21694
45 Ga0105245_10017829 3300009098 Bacteria 6199
46 Ga0105238_10000033 3300009551 Bacteria 172981
47 Ga0105249_10000368 3300009553 Bacteria 44712
48 Ga0105239_11135473 3300010375 Bacteria 900
49 Ga0105246_10540164 3300011119 Bacteria 997
50 Ga0157374_10000785 3300013296 Bacteria 27837
51 Ga0157374_10976079 3300013296 Bacteria 866
52 Ga0157375_10018276 3300013308 Bacteria 6355
53 Ga0163163_10202140 3300014325 Bacteria 2035
54 Ga0157380_10068512 3300014326 Bacteria 2860
55 Ga0157380_10248843 3300014326 Bacteria 1607
56 Ga0157379_10009082 3300014968 Bacteria 8664
57 Ga0163161_10000064 3300017792 Bacteria 108508
58 Ga0163161_10119303 3300017792 Bacteria 1980
59 Ga0207653_10115712 3300025885 Bacteria 961
60 Ga0207682_10000041 3300025893 Bacteria 52338
61 Ga0207642_10000005 3300025899 Bacteria 401934
62 Ga0207642_10000221 3300025899 Bacteria 16812
63 Ga0207685_10000012 3300025905 Bacteria 189900
64 Ga0207707_10226135 3300025912 Bacteria 1628
65 Ga0207693_10061084 3300025915 Bacteria 2952
66 Ga0207663_10000399 3300025916 Bacteria 18806
67 Ga0207660_10226298 3300025917 Bacteria 1469
68 Ga0207652_10000232 3300025921 Bacteria 58473
69 Ga0207694_10000012 3300025924 Bacteria 411218
70 Ga0207687_10000128 3300025927 Bacteria 50603
71 Ga0207687_10009959 3300025927 Bacteria 6220
72 Ga0207664_10015228 3300025929 Bacteria 5577
73 Ga0207706_10000003 3300025933 Bacteria 345011
74 Ga0207709_10012427 3300025935 Bacteria 4690
75 Ga0207670_10120254 3300025936 Bacteria 1908
76 Ga0207669_10000029 3300025937 Bacteria 88351
77 Ga0207669_10000140 3300025937 Bacteria 34667
78 Ga0207665_10146252 3300025939 Bacteria 1689
79 Ga0207661_10005065 3300025944 Bacteria 9252
80 Ga0207661_10006598 3300025944 Bacteria 8205
81 Ga0207651_10000840 3300025960 Bacteria 13360
82 Ga0207712_10000027 3300025961 Bacteria 263739
83 Ga0207640_10004505 3300025981 Bacteria 7558
84 Ga0207677_10001420 3300026023 Bacteria 12761
85 Ga0207703_10000020 3300026035 Bacteria 251603
86 Ga0207639_10003217 3300026041 Bacteria 10984
87 Ga0207708_10003318 3300026075 Bacteria 11848
88 Ga0207702_10003502 3300026078 Bacteria 14309
89 Ga0207702_10392931 3300026078 Bacteria 1336
90 Ga0207641_10000062 3300026088 Bacteria 159982
91 Ga0207648_10005599 3300026089 Bacteria 12631
92 Ga0207683_10015234 3300026121 Bacteria 6543
93 Ga0207698_10060810 3300026142 Bacteria 2939
94 Ga0268266_10000029 3300028379 Bacteria 424015
95 Ga0268264_10000725 3300028381 Bacteria 37821
96 Ga0265326_10000179 3300028558 Bacteria 32210
97 Ga0265322_10000005 3300028654 Bacteria 246112
98 Ga0265336_10030488 3300028666 Bacteria 1679
99 Ga0265328_10000563 3300031239 Bacteria 17200
100 Ga0265320_10000010 3300031240 Bacteria 250501
101 Ga0265331_10005825 3300031250 Bacteria 7384
102 Ga0265327_10000040 3300031251 Bacteria 291052
103 Ga0265316_10057449 3300031344 Bacteria 3034
104 Ga0373937_0022529 3300036401 Bacteria 5665
105 Ga0373937_1613089 3300036401 Unclassified 596
106 Ga0395901_1173017 3300038443 Bacteria 735
107 Ga0451833_1411990 3300041491 Bacteria 1674
108 Ga0451853_1174682 3300041512 Bacteria 5305
109 Ga0466963_0001315 3300044694 Bacteria 13214
110 Ga0466967_0022277 3300045976 Bacteria 5166
111 Ga0495592_0000423 3300046454 Bacteria 32094
112 Ga0495603_0000194 3300046455 Bacteria 31819
113 Ga0495603_0010008 3300046455 Bacteria 5737
114 Ga0495629_0163408 3300046459 Bacteria 1546
115 Ga0495641_0000004 3300046461 Bacteria 210501
116 Ga0495653_0230478 3300046463 Bacteria 1240
117 Ga0495582_0000002 3300046473 Bacteria 219909
118 Ga0495639_0003343 3300046475 Bacteria 6954
119 Ga0495662_0000681 3300046476 Bacteria 16074
120 Ga0495608_0000092 3300046511 Bacteria 64795
121 Ga0495608_0020753 3300046511 Bacteria 4513
122 Ga0495618_0000094 3300046514 Bacteria 64293
123 Ga0495620_0001737 3300046515 Bacteria 12862
124 Ga0495628_0014113 3300046516 Bacteria 6706
125 Ga0495628_0038288 3300046516 Bacteria 3839
126 Ga0495628_0239185 3300046516 Unclassified 1359
127 Ga0495630_0000519 3300046517 Bacteria 28420
128 Ga0495644_0005806 3300046523 Bacteria 4822
129 Ga0495652_0370888 3300046529 Bacteria 1020
130 Ga0495586_0001540 3300046535 Bacteria 12722
131 Ga0495586_0092506 3300046535 Bacteria 1672
132 Ga0495587_0094397 3300046536 Bacteria 1727
133 Ga0495621_0001277 3300046539 Bacteria 6503
134 Ga0495645_0031021 3300046543 Bacteria 3893
135 Ga0495645_0049365 3300046543 Bacteria 3065
136 Ga0495634_0000002 3300046642 Bacteria 247842
137 Ga0495634_0043852 3300046642 Bacteria 3030
138 Ga0495635_0000182 3300046663 Bacteria 39469
139 Ga0495657_0038722 3300046675 Bacteria 3279
140 Ga0495599_0058373 3300046678 Bacteria 2414
141 Ga0495599_0123708 3300046678 Bacteria 1608
142 Ga0495623_0163919 3300046679 Bacteria 1304
143 Ga0495647_0000005 3300046681 Bacteria 125996
144 Ga0495658_0000001 3300046683 Bacteria 385362
145 Ga0495669_0000248 3300046684 Bacteria 31659
146 Ga0495613_0000173 3300046689 Bacteria 62463
147 Ga0495624_0000600 3300046690 Bacteria 28092
148 Ga0495624_0202568 3300046690 Bacteria 1205
149 Ga0495649_0003329 3300046694 Bacteria 10917
150 Ga0495600_0007928 3300046809 Bacteria 6509
151 Ga0495600_0200146 3300046809 Bacteria 1283
152 Ga0495604_0000437 3300047317 Bacteria 37081
153 Ga0495604_0040502 3300047317 Bacteria 3658
154 Ga0495672_0234618 3300047320 Bacteria 899
155 Ga0495676_0000320 3300047321 Bacteria 38969
156 Ga0495676_0279816 3300047321 Bacteria 1130
157 Ga0495680_0000113 3300047322 Bacteria 76525
158 Ga0495680_0005581 3300047322 Bacteria 11797
159 Ga0495680_0259548 3300047322 Bacteria 1229
160 Ga0495679_004087 3300047446 Bacteria 6832
161 Ga0495593_0129876 3300047673 Bacteria 1279
162 Ga0495602_0038771 3300048088 Bacteria 4399
163 Ga0496100_0000234 3300048903 Bacteria 29327
164 Ga0496100_0904505 3300048903 Bacteria 693
165 Ga0496101_0000382 3300048904 Bacteria 29327
166 Ga0496104_0000008 3300048907 Bacteria 516976
167 Ga0496104_0007004 3300048907 Bacteria 9942
168 Ga0496105_0000003 3300048908 Bacteria 713251
169 Ga0496105_0000051 3300048908 Bacteria 90365
170 Ga0496106_0000042 3300048909 Bacteria 106662
171 Ga0496106_0000455 3300048909 Bacteria 29281
172 Ga0496107_0000234 3300048910 Bacteria 29310
173 Ga0496108_0000004 3300048911 Bacteria 545055
174 Ga0496109_0000013 3300048912 Bacteria 227469
175 Ga0496109_0416545 3300048912 Bacteria 1269
176 Ga0496110_0044686 3300048913 Bacteria 3869
177 Ga0496111_0120044 3300048914 Bacteria 1942
178 Ga0496112_0000026 3300048915 Bacteria 144758
179 Ga0496113_0020261 3300048916 Bacteria 4673
180 Ga0496113_0253626 3300048916 Bacteria 1405
181 Ga0496114_0007563 3300048917 Bacteria 8594
182 Ga0501031_0075272 3300049568 Bacteria 2198
183 Ga0501031_0613467 3300049568 Bacteria 700
184 Ga0501039_0098496 3300049575 Bacteria 2281
185 Ga0501040_0032011 3300049576 Bacteria 3557
186 Ga0501041_0357152 3300049577 Archaea 924
187 Ga0501072_0301192 3300049588 Bacteria 1274
188 Ga0501075_0068788 3300049591 Bacteria 2675
189 Ga0501045_0348855 3300049824 Bacteria 1102
190 nmdc:mga06r32_105878_c1 3300050510 Bacteria 2763
191 nmdc:mga0n895_883285_c1 3300050512 Bacteria 880
192 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
193 Ga0495601_0000444 3300053077 Bacteria 21636
194 Ga0495601_0135839 3300053077 Bacteria 1603
195 Ga0495601_0372845 3300053077 Bacteria 927
196 Ga0495612_0002922 3300053078 Bacteria 7083
197 Ga0495612_0041298 3300053078 Bacteria 1881
198 Ga0495595_0004468 3300053084 Bacteria 5631
199 Ga0495619_0014404 3300053085 Bacteria 4994
200 Ga0501082_0558252 3300060353 Bacteria 1002

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10001424 Ga0105245_100014246 153
2 3300025927 Ga0207687_10000128 Ga0207687_100001287 155
3 3300036401 Ga0373937_0022529 Ga0373937_0022529_769_1365 157
4 3300036401 Ga0373937_1613089 Ga0373937_1613089_21_569 163
5 3300005356 Ga0070674_100000019 Ga0070674_10000001913 165
6 3300060353 Ga0501082_0558252 Ga0501082_0558252_10_564 165
7 3300049568 Ga0501031_0613467 Ga0501031_0613467_18_617 166
8 3300005337 Ga0070682_100000023 Ga0070682_100000023208 167
9 3300005441 Ga0070700_100001694 Ga0070700_1000016944 167
10 3300005530 Ga0070679_100000088 Ga0070679_10000008831 167
11 3300005539 Ga0068853_100002786 Ga0068853_10000278613 167
12 3300005614 Ga0068856_100010553 Ga0068856_1000105533 167
13 3300050512 nmdc:mga0n895_883285_c1 nmdc:mga0n895_883285_c1_299_859 167
14 3300026075 Ga0207708_10003318 Ga0207708_100033186 168
15 3300049591 Ga0501075_0068788 Ga0501075_0068788_1811_2410 168
16 3300005364 Ga0070673_100349501 Ga0070673_1003495012 169
17 3300025960 Ga0207651_10000840 Ga0207651_100008402 169
18 3300038443 Ga0395901_1173017 Ga0395901_1173017_115_693 169
19 3300005985 Ga0081539_10019075 Ga0081539_100190752 170
20 3300017792 Ga0163161_10119303 Ga0163161_101193032 171
21 3300006847 Ga0075431_100198838 Ga0075431_1001988382 173
22 3300049568 Ga0501031_0075272 Ga0501031_0075272_1258_1848 173
23 3300049575 Ga0501039_0098496 Ga0501039_0098496_1166_1756 173
24 3300049576 Ga0501040_0032011 Ga0501040_0032011_542_1132 173
25 3300049588 Ga0501072_0301192 Ga0501072_0301192_148_738 173
26 3300050510 nmdc:mga06r32_105878_c1 nmdc:mga06r32_105878_c1_416_997 173
27 3300005344 Ga0070661_100349866 Ga0070661_1003498662 178
28 3300005456 Ga0070678_101127177 Ga0070678_1011271771 178
29 3300005564 Ga0070664_100011230 Ga0070664_1000112306 178
30 3300005718 Ga0068866_10000005 Ga0068866_1000000542 178
31 3300005843 Ga0068860_100011791 Ga0068860_10001179112 178
32 3300006163 Ga0070715_10000008 Ga0070715_1000000886 178
33 3300006358 Ga0068871_100264491 Ga0068871_1002644912 178
34 3300025899 Ga0207642_10000005 Ga0207642_10000005246 178
35 3300025905 Ga0207685_10000012 Ga0207685_1000001286 178
36 3300025937 Ga0207669_10000140 Ga0207669_1000014037 178
37 3300026121 Ga0207683_10015234 Ga0207683_100152342 178
38 3300028381 Ga0268264_10000725 Ga0268264_1000072530 178
39 3300046642 Ga0495634_0043852 Ga0495634_0043852_670_1263 178
40 3300048912 Ga0496109_0416545 Ga0496109_0416545_392_985 178
41 3300049824 Ga0501045_0348855 Ga0501045_0348855_214_807 178
42 3300005329 Ga0070683_100016897 Ga0070683_1000168974 179
43 3300005439 Ga0070711_100002037 Ga0070711_10000203715 179
44 3300005841 Ga0068863_100002309 Ga0068863_1000023099 179
45 3300007076 Ga0075435_100335273 Ga0075435_1003352732 179
46 3300009551 Ga0105238_10000033 Ga0105238_10000033174 179
47 3300025916 Ga0207663_10000399 Ga0207663_1000039924 179
48 3300025924 Ga0207694_10000012 Ga0207694_10000012175 179
49 3300025944 Ga0207661_10005065 Ga0207661_100050654 179
50 3300026088 Ga0207641_10000062 Ga0207641_10000062185 179
51 3300041491 Ga0451833_1411990 Ga0451833_1411990_627_1220 179
52 3300044694 Ga0466963_0001315 Ga0466963_0001315_3810_4406 179
53 3300046455 Ga0495603_0010008 Ga0495603_0010008_772_1368 179
54 3300046463 Ga0495653_0230478 Ga0495653_0230478_570_1169 179
55 3300046473 Ga0495582_0000002 Ga0495582_0000002_207099_207695 179
56 3300046476 Ga0495662_0000681 Ga0495662_0000681_4954_5550 179
57 3300046529 Ga0495652_0370888 Ga0495652_0370888_238_834 179
58 3300046683 Ga0495658_0000001 Ga0495658_0000001_184573_185169 179
59 3300047317 Ga0495604_0040502 Ga0495604_0040502_585_1178 179
60 3300048909 Ga0496106_0000042 Ga0496106_0000042_101896_102492 179
61 3300001977 JGI24746J21847_1000283 JGI24746J21847_10002838 180
62 3300005329 Ga0070683_100009930 Ga0070683_1000099308 180
63 3300005333 Ga0070677_10000028 Ga0070677_100000288 180
64 3300005336 Ga0070680_100060544 Ga0070680_1000605445 180
65 3300005338 Ga0068868_100001254 Ga0068868_1000012549 180
66 3300005356 Ga0070674_100000327 Ga0070674_10000032725 180
67 3300005406 Ga0070703_10123421 Ga0070703_101234212 180
68 3300005435 Ga0070714_100383704 Ga0070714_1003837041 180
69 3300005444 Ga0070694_100396804 Ga0070694_1003968042 180
70 3300005457 Ga0070662_100000001 Ga0070662_100000001129 180
71 3300005459 Ga0068867_100002663 Ga0068867_1000026639 180
72 3300005535 Ga0070684_100009796 Ga0070684_1000097968 180
73 3300005547 Ga0070693_100024038 Ga0070693_1000240382 180
74 3300005548 Ga0070665_100000022 Ga0070665_10000002264 180
75 3300005578 Ga0068854_100001995 Ga0068854_1000019952 180
76 3300005614 Ga0068856_100255022 Ga0068856_1002550222 180
77 3300005616 Ga0068852_100123384 Ga0068852_1001233841 180
78 3300005718 Ga0068866_10001146 Ga0068866_100011468 180
79 3300005842 Ga0068858_100004437 Ga0068858_10000443710 180
80 3300006173 Ga0070716_100108928 Ga0070716_1001089281 180
81 3300006175 Ga0070712_100200119 Ga0070712_1002001192 180
82 3300006358 Ga0068871_100363685 Ga0068871_1003636852 180
83 3300006852 Ga0075433_10003730 Ga0075433_1000373013 180
84 3300009098 Ga0105245_10017829 Ga0105245_100178297 180
85 3300009553 Ga0105249_10000368 Ga0105249_1000036828 180
86 3300010375 Ga0105239_11135473 Ga0105239_111354732 180
87 3300011119 Ga0105246_10540164 Ga0105246_105401642 180
88 3300013296 Ga0157374_10000785 Ga0157374_1000078523 180
89 3300013296 Ga0157374_10976079 Ga0157374_109760792 180
90 3300013308 Ga0157375_10018276 Ga0157375_100182766 180
91 3300014325 Ga0163163_10202140 Ga0163163_102021402 180
92 3300014326 Ga0157380_10068512 Ga0157380_100685123 180
93 3300014326 Ga0157380_10248843 Ga0157380_102488432 180
94 3300014968 Ga0157379_10009082 Ga0157379_100090827 180
95 3300017792 Ga0163161_10000064 Ga0163161_1000006473 180
96 3300025885 Ga0207653_10115712 Ga0207653_101157122 180
97 3300025893 Ga0207682_10000041 Ga0207682_1000004119 180
98 3300025899 Ga0207642_10000221 Ga0207642_100002217 180
99 3300025912 Ga0207707_10226135 Ga0207707_102261352 180
100 3300025915 Ga0207693_10061084 Ga0207693_100610842 180
101 3300025917 Ga0207660_10226298 Ga0207660_102262982 180
102 3300025921 Ga0207652_10000232 Ga0207652_1000023253 180
103 3300025927 Ga0207687_10009959 Ga0207687_100099597 180
104 3300025929 Ga0207664_10015228 Ga0207664_100152288 180
105 3300025933 Ga0207706_10000003 Ga0207706_10000003199 180
106 3300025935 Ga0207709_10012427 Ga0207709_100124273 180
107 3300025936 Ga0207670_10120254 Ga0207670_101202543 180
108 3300025937 Ga0207669_10000029 Ga0207669_1000002971 180
109 3300025939 Ga0207665_10146252 Ga0207665_101462523 180
110 3300025944 Ga0207661_10006598 Ga0207661_100065989 180
111 3300025961 Ga0207712_10000027 Ga0207712_10000027281 180
112 3300025981 Ga0207640_10004505 Ga0207640_100045052 180
113 3300026023 Ga0207677_10001420 Ga0207677_1000142015 180
114 3300026035 Ga0207703_10000020 Ga0207703_10000020117 180
115 3300026041 Ga0207639_10003217 Ga0207639_1000321710 180
116 3300026078 Ga0207702_10003502 Ga0207702_100035022 180
117 3300026078 Ga0207702_10392931 Ga0207702_103929312 180
118 3300026089 Ga0207648_10005599 Ga0207648_100055999 180
119 3300026142 Ga0207698_10060810 Ga0207698_100608102 180
120 3300028379 Ga0268266_10000029 Ga0268266_10000029386 180
121 3300028558 Ga0265326_10000179 Ga0265326_100001792 180
122 3300028654 Ga0265322_10000005 Ga0265322_10000005109 180
123 3300028666 Ga0265336_10030488 Ga0265336_100304882 180
124 3300031239 Ga0265328_10000563 Ga0265328_1000056322 180
125 3300031240 Ga0265320_10000010 Ga0265320_10000010155 180
126 3300031250 Ga0265331_10005825 Ga0265331_100058252 180
127 3300031251 Ga0265327_10000040 Ga0265327_10000040151 180
128 3300031344 Ga0265316_10057449 Ga0265316_100574492 180
129 3300041512 Ga0451853_1174682 Ga0451853_1174682_1850_2449 180
130 3300045976 Ga0466967_0022277 Ga0466967_0022277_958_1560 180
131 3300046454 Ga0495592_0000423 Ga0495592_0000423_11151_11750 180
132 3300046455 Ga0495603_0000194 Ga0495603_0000194_30041_30643 180
133 3300046459 Ga0495629_0163408 Ga0495629_0163408_35_634 180
134 3300046461 Ga0495641_0000004 Ga0495641_0000004_124094_124693 180
135 3300046475 Ga0495639_0003343 Ga0495639_0003343_425_1024 180
136 3300046511 Ga0495608_0000092 Ga0495608_0000092_1053_1655 180
137 3300046511 Ga0495608_0020753 Ga0495608_0020753_1506_2105 180
138 3300046514 Ga0495618_0000094 Ga0495618_0000094_62689_63288 180
139 3300046515 Ga0495620_0001737 Ga0495620_0001737_10988_11587 180
140 3300046516 Ga0495628_0014113 Ga0495628_0014113_1240_1839 180
141 3300046516 Ga0495628_0038288 Ga0495628_0038288_2278_2880 180
142 3300046516 Ga0495628_0239185 Ga0495628_0239185_737_1336 180
143 3300046517 Ga0495630_0000519 Ga0495630_0000519_14226_14825 180
144 3300046523 Ga0495644_0005806 Ga0495644_0005806_820_1419 180
145 3300046535 Ga0495586_0001540 Ga0495586_0001540_7379_7978 180
146 3300046535 Ga0495586_0092506 Ga0495586_0092506_900_1499 180
147 3300046536 Ga0495587_0094397 Ga0495587_0094397_160_759 180
148 3300046539 Ga0495621_0001277 Ga0495621_0001277_2458_3057 180
149 3300046543 Ga0495645_0031021 Ga0495645_0031021_1088_1687 180
150 3300046543 Ga0495645_0049365 Ga0495645_0049365_1591_2190 180
151 3300046642 Ga0495634_0000002 Ga0495634_0000002_78934_79533 180
152 3300046663 Ga0495635_0000182 Ga0495635_0000182_19430_20029 180
153 3300046675 Ga0495657_0038722 Ga0495657_0038722_988_1587 180
154 3300046678 Ga0495599_0058373 Ga0495599_0058373_971_1570 180
155 3300046678 Ga0495599_0123708 Ga0495599_0123708_720_1322 180
156 3300046679 Ga0495623_0163919 Ga0495623_0163919_230_829 180
157 3300046681 Ga0495647_0000005 Ga0495647_0000005_48897_49496 180
158 3300046684 Ga0495669_0000248 Ga0495669_0000248_11603_12202 180
159 3300046689 Ga0495613_0000173 Ga0495613_0000173_60801_61400 180
160 3300046690 Ga0495624_0000600 Ga0495624_0000600_962_1561 180
161 3300046690 Ga0495624_0202568 Ga0495624_0202568_393_992 180
162 3300046694 Ga0495649_0003329 Ga0495649_0003329_4310_4909 180
163 3300046809 Ga0495600_0007928 Ga0495600_0007928_1016_1615 180
164 3300046809 Ga0495600_0200146 Ga0495600_0200146_57_656 180
165 3300047317 Ga0495604_0000437 Ga0495604_0000437_16976_17575 180
166 3300047320 Ga0495672_0234618 Ga0495672_0234618_265_864 180
167 3300047321 Ga0495676_0000320 Ga0495676_0000320_9458_10057 180
168 3300047321 Ga0495676_0279816 Ga0495676_0279816_181_780 180
169 3300047322 Ga0495680_0000113 Ga0495680_0000113_63800_64402 180
170 3300047322 Ga0495680_0005581 Ga0495680_0005581_5135_5734 180
171 3300047322 Ga0495680_0259548 Ga0495680_0259548_195_794 180
172 3300047446 Ga0495679_004087 Ga0495679_004087_5955_6554 180
173 3300047673 Ga0495593_0129876 Ga0495593_0129876_622_1221 180
174 3300048088 Ga0495602_0038771 Ga0495602_0038771_838_1437 180
175 3300048903 Ga0496100_0000234 Ga0496100_0000234_16751_17350 180
176 3300048903 Ga0496100_0904505 Ga0496100_0904505_19_618 180
177 3300048904 Ga0496101_0000382 Ga0496101_0000382_16751_17350 180
178 3300048907 Ga0496104_0000008 Ga0496104_0000008_173551_174150 180
179 3300048907 Ga0496104_0007004 Ga0496104_0007004_590_1192 180
180 3300048908 Ga0496105_0000003 Ga0496105_0000003_173551_174150 180
181 3300048908 Ga0496105_0000051 Ga0496105_0000051_22665_23267 180
182 3300048909 Ga0496106_0000455 Ga0496106_0000455_11959_12558 180
183 3300048910 Ga0496107_0000234 Ga0496107_0000234_16739_17338 180
184 3300048911 Ga0496108_0000004 Ga0496108_0000004_423152_423751 180
185 3300048912 Ga0496109_0000013 Ga0496109_0000013_105593_106192 180
186 3300048913 Ga0496110_0044686 Ga0496110_0044686_923_1522 180
187 3300048914 Ga0496111_0120044 Ga0496111_0120044_224_823 180
188 3300048915 Ga0496112_0000026 Ga0496112_0000026_74255_74854 180
189 3300048916 Ga0496113_0020261 Ga0496113_0020261_1107_1706 180
190 3300048916 Ga0496113_0253626 Ga0496113_0253626_506_1105 180
191 3300048917 Ga0496114_0007563 Ga0496114_0007563_7013_7612 180
192 3300049577 Ga0501041_0357152 Ga0501041_0357152_169_765 180
193 3300050515 nmdc:mga0a205_4_c1 nmdc:mga0a205_4_c1_86371_86970 180
194 3300053077 Ga0495601_0000444 Ga0495601_0000444_5052_5651 180
195 3300053077 Ga0495601_0135839 Ga0495601_0135839_335_937 180
196 3300053077 Ga0495601_0372845 Ga0495601_0372845_63_662 180
197 3300053078 Ga0495612_0002922 Ga0495612_0002922_2804_3403 180
198 3300053078 Ga0495612_0041298 Ga0495612_0041298_166_768 180
199 3300053084 Ga0495595_0004468 Ga0495595_0004468_1077_1679 180
200 3300053085 Ga0495619_0014404 Ga0495619_0014404_1748_2347 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

7

194

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.8741 2 171
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.8632 1 173
2e5x-assembly1.cif.gz_A-2 structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3 0.8502 2 173
2mjp-assembly1.cif.gz_B structure-based identification of the biochemical function of a hypothetical protein from methanococcus jannaschii:mj0226 0.8415 2 171
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.8385 2 173
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8868 2 173 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8632 1 173 3.90.950.10
af_P47119_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.859 2 173 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8578 2 172 3.90.950.10
af_Q4DRX4_9_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8554 1 170 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A838V3Y1-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9169 15 176 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A1M3B816-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.916 15 171 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7W0U9L5-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9146 1 174 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A6I3FT66-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9133 2 171 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A6J6Q8A2-F1-model_v4 Unannotated protein 0.9129 1 173 GO:0000166
GO:0005829
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429

Feature Viewer

pLDDT pTM Quality
88.72 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map