F307169

General Info

Members Datasets Scaffolds Average Seq Length
200 133 400 122

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_13445691|Ga0163162_134456911
Length 136
Sequence MPLDSVRTLSRKPTLVPEGAEVPRIEASIARFGPKFIQRIYTPAEIAYVERKANKYERYAARFAAKEAGMKAIGTGWRRGVRWQDFEVANLPSGKPTLKLHGMAARHAAKLGVKTISLSMTHTSELGMAHVILEDC

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.5
Rhizosphere 98.5
Stem 0
Stem Tuber 0
Unclassified 33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_13445691 3300013306 Bacteria 504
2 Ga0070676_10564446 3300005328 Bacteria 816
3 Ga0070676_10564629 3300005328 Bacteria 816
4 Ga0070683_100000011 3300005329 Bacteria 283682
5 Ga0070683_100026858 3300005329 Bacteria 5189
6 Ga0070683_100777757 3300005329 Bacteria 917
7 Ga0070690_101127227 3300005330 Bacteria 623
8 Ga0070670_100113407 3300005331 Bacteria 2337
9 Ga0068869_102014219 3300005334 Bacteria 518
10 Ga0070666_10640423 3300005335 Unclassified 777
11 Ga0070680_100668530 3300005336 Unclassified 893
12 Ga0068868_101117256 3300005338 Unclassified 726
13 Ga0068868_102117818 3300005338 Unclassified 535
14 Ga0070675_100076313 3300005354 Bacteria 2787
15 Ga0070688_100449812 3300005365 Bacteria 963
16 Ga0070667_101069551 3300005367 Bacteria 754
17 Ga0070713_102248077 3300005436 Unclassified 528
18 Ga0070711_101373971 3300005439 Unclassified 614
19 Ga0070705_100243407 3300005440 Unclassified 1258
20 Ga0070705_101212846 3300005440 Unclassified 622
21 Ga0070708_100051359 3300005445 Bacteria 3653
22 Ga0070681_10191875 3300005458 Bacteria 1963
23 Ga0070706_100843632 3300005467 Bacteria 847
24 Ga0070679_100200288 3300005530 Bacteria 1963
25 Ga0070684_100000001 3300005535 Bacteria 300240
26 Ga0070684_100013847 3300005535 Bacteria 6514
27 Ga0070684_100192528 3300005535 Bacteria 1856
28 Ga0070697_100556729 3300005536 Bacteria 1006
29 Ga0070696_100014986 3300005546 Bacteria 5205
30 Ga0070665_101040181 3300005548 Unclassified 831
31 Ga0070665_101602173 3300005548 Bacteria 659
32 Ga0068859_100735712 3300005617 Bacteria 1076
33 Ga0068870_10732692 3300005840 Bacteria 685
34 Ga0068858_100738433 3300005842 Unclassified 959
35 Ga0068860_100899991 3300005843 Bacteria 901
36 Ga0068860_101102390 3300005843 Bacteria 813
37 Ga0070717_10008972 3300006028 Bacteria 7498
38 Ga0097621_100624407 3300006237 Bacteria 987
39 Ga0097621_100784412 3300006237 Bacteria 882
40 Ga0068871_100073646 3300006358 Unclassified 2816
41 Ga0068871_101830069 3300006358 Unclassified 577
42 Ga0075431_100008713 3300006847 Bacteria 10163
43 Ga0068865_101592197 3300006881 Unclassified 587
44 Ga0075436_100004212 3300006914 Bacteria 9869
45 Ga0075436_100670071 3300006914 Unclassified 767
46 Ga0097620_100735570 3300006931 Bacteria 1076
47 Ga0075435_100074664 3300007076 Bacteria 2774
48 Ga0105240_10002536 3300009093 Bacteria 29297
49 Ga0105245_10580143 3300009098 Bacteria 1146
50 Ga0105245_11555251 3300009098 Unclassified 713
51 Ga0105245_11837121 3300009098 Unclassified 659
52 Ga0105242_11281791 3300009176 Bacteria 756
53 Ga0105248_10098027 3300009177 Unclassified 3302
54 Ga0105237_10358459 3300009545 Unclassified 1462
55 Ga0105238_10041940 3300009551 Bacteria 4635
56 Ga0157370_10788357 3300013104 Bacteria 865
57 Ga0157369_10303700 3300013105 Unclassified 1660
58 Ga0157374_10534830 3300013296 Bacteria 1179
59 Ga0157374_10563350 3300013296 Bacteria 1148
60 Ga0157378_10179091 3300013297 Bacteria 1993
61 Ga0157378_10595588 3300013297 Bacteria 1116
62 Ga0157378_10722866 3300013297 Unclassified 1017
63 Ga0163162_12775984 3300013306 Unclassified 564
64 Ga0157375_11285714 3300013308 Unclassified 860
65 Ga0163163_10085436 3300014325 Bacteria 3164
66 Ga0163163_10218539 3300014325 Bacteria 1954
67 Ga0163163_11125294 3300014325 Bacteria 848
68 Ga0163163_11636927 3300014325 Bacteria 705
69 Ga0157377_11279963 3300014745 Bacteria 572
70 Ga0157379_10197188 3300014968 Bacteria 1820
71 Ga0157376_10274163 3300014969 Unclassified 1586
72 Ga0157376_11267933 3300014969 Unclassified 766
73 Ga0157376_11513860 3300014969 Unclassified 704
74 Ga0207680_10444573 3300025903 Bacteria 920
75 Ga0207685_10241192 3300025905 Bacteria 870
76 Ga0207699_10160317 3300025906 Unclassified 1497
77 Ga0207699_10466790 3300025906 Bacteria 907
78 Ga0207699_10741687 3300025906 Bacteria 720
79 Ga0207643_10788537 3300025908 Unclassified 615
80 Ga0207684_10674177 3300025910 Bacteria 880
81 Ga0207707_10340273 3300025912 Bacteria 1293
82 Ga0207695_10047007 3300025913 Bacteria 4571
83 Ga0207660_10476920 3300025917 Bacteria 1011
84 Ga0207652_10081204 3300025921 Bacteria 2836
85 Ga0207694_10038208 3300025924 Bacteria 3691
86 Ga0207659_10526444 3300025926 Bacteria 1003
87 Ga0207687_11796451 3300025927 Unclassified 525
88 Ga0207700_10478578 3300025928 Unclassified 1100
89 Ga0207704_10353477 3300025938 Bacteria 1145
90 Ga0207704_11035366 3300025938 Unclassified 695
91 Ga0207665_10137959 3300025939 Bacteria 1737
92 Ga0207711_10087273 3300025941 Unclassified 2737
93 Ga0207711_11734070 3300025941 Bacteria 568
94 Ga0207661_10000016 3300025944 Bacteria 305159
95 Ga0207661_10095452 3300025944 Bacteria 2486
96 Ga0207658_11000226 3300025986 Unclassified 763
97 Ga0207641_11715122 3300026088 Unclassified 630
98 Ga0207674_11440558 3300026116 Unclassified 658
99 Ga0265338_10665417 3300028800 Unclassified 721
100 Ga0265762_1031325 3300030760 Bacteria 1011
101 Ga0265760_10331280 3300031090 Bacteria 543
102 Ga0265330_10267693 3300031235 Archaea 720
103 Ga0265332_10224224 3300031238 Bacteria 779
104 Ga0265325_10012245 3300031241 Bacteria 4908
105 Ga0265325_10124669 3300031241 Unclassified 1239
106 Ga0265339_10272231 3300031249 Bacteria 814
107 Ga0265331_10031189 3300031250 Unclassified 2650
108 Ga0265316_10338689 3300031344 Bacteria 1090
109 Ga0265314_10057167 3300031711 Unclassified 2681
110 Ga0265342_10021020 3300031712 Bacteria 4175
111 Ga0373926_0159095 3300035083 Unclassified 862
112 Ga0373934_0178237 3300035086 Unclassified 873
113 Ga0373934_0266920 3300035086 Bacteria 708
114 Ga0373923_0151625 3300035111 Bacteria 1053
115 Ga0373945_0263197 3300035116 Unclassified 731
116 Ga0373953_0088756 3300035117 Unclassified 1292
117 Ga0373953_0509765 3300035117 Unclassified 533
118 Ga0373954_0038050 3300035118 Bacteria 2236
119 Ga0373954_0154158 3300035118 Unclassified 1123
120 Ga0373954_0324805 3300035118 Bacteria 760
121 Ga0373957_0298891 3300035120 Bacteria 683
122 Ga0373943_0097427 3300035170 Unclassified 1532
123 Ga0373946_0182616 3300035171 Unclassified 996
124 Ga0373935_0013714 3300035692 Bacteria 4893
125 Ga0373935_0503985 3300035692 Unclassified 879
126 Ga0373927_0001300 3300035695 Bacteria 18881
127 Ga0373927_0004285 3300035695 Bacteria 10016
128 Ga0373927_0004287 3300035695 Bacteria 10011
129 Ga0373927_0051663 3300035695 Bacteria 2658
130 Ga0373927_0523381 3300035695 Unclassified 784
131 Ga0373933_0077154 3300035724 Bacteria 2036
132 Ga0373947_0004192 3300035725 Bacteria 8461
133 Ga0373947_0485226 3300035725 Bacteria 839
134 Ga0373937_0002521 3300036401 Bacteria 15208
135 Ga0373937_0049214 3300036401 Bacteria 3860
136 Ga0373937_0152649 3300036401 Bacteria 2164
137 Ga0373937_0181946 3300036401 Bacteria 1974
138 Ga0373925_0000903 3300037068 Bacteria 27131
139 Ga0373925_0012099 3300037068 Bacteria 6247
140 Ga0373925_0132223 3300037068 Bacteria 1947
141 Ga0373925_0614876 3300037068 Unclassified 895
142 Ga0436365_1772124 3300039437 Unclassified 4782
143 Ga0436360_1091238 3300039438 Unclassified 516
144 Ga0436361_0341016 3300039447 Bacteria 583
145 Ga0451577_0722361 3300042876 Bacteria 902
146 Ga0451577_0760484 3300042876 Unclassified 876
147 Ga0453684_0000053 3300044712 Bacteria 545350
148 Ga0453684_0045798 3300044712 Bacteria 5829
149 Ga0453684_0121825 3300044712 Unclassified 3147
150 Ga0453684_0247608 3300044712 Bacteria 2048
151 Ga0453684_0413635 3300044712 Bacteria 1508
152 Ga0453684_0483423 3300044712 Bacteria 1373
153 Ga0453684_1067079 3300044712 Bacteria 855
154 Ga0453684_2364990 3300044712 Bacteria 527
155 Ga0466957_1123321 3300044842 Bacteria 567
156 Ga0466959_0499779 3300045049 Unclassified 822
157 Ga0451576_0186804 3300045051 Unclassified 2164
158 Ga0451576_1199976 3300045051 Bacteria 792
159 Ga0466958_0195380 3300045836 Unclassified 1287
160 Ga0495629_0168889 3300046459 Bacteria 1518
161 Ga0495651_0172928 3300046462 Bacteria 1536
162 Ga0495651_0702063 3300046462 Unclassified 630
163 Ga0495653_0136863 3300046463 Bacteria 1727
164 Ga0495580_0003067 3300046472 Bacteria 14309
165 Ga0495580_0012856 3300046472 Bacteria 6415
166 Ga0495580_0016274 3300046472 Bacteria 5586
167 Ga0495580_0042931 3300046472 Bacteria 3219
168 Ga0495580_0488004 3300046472 Bacteria 823
169 Ga0495580_0797940 3300046472 Bacteria 612
170 Ga0495582_0049734 3300046473 Bacteria 2309
171 Ga0495582_0253736 3300046473 Bacteria 1009
172 Ga0495662_0490355 3300046476 Unclassified 602
173 Ga0495594_0354100 3300046499 Bacteria 836
174 Ga0495630_0251035 3300046517 Bacteria 1351
175 Ga0495666_0143747 3300046526 Bacteria 1111
176 Ga0495642_0311040 3300046528 Bacteria 691
177 Ga0495665_0193122 3300046531 Bacteria 1056
178 Ga0495667_0368989 3300046559 Bacteria 906
179 Ga0495635_0049240 3300046663 Bacteria 2904
180 Ga0495635_0473713 3300046663 Bacteria 826
181 Ga0495613_0392878 3300046689 Bacteria 947
182 Ga0495624_0626954 3300046690 Unclassified 640
183 Ga0495600_0239519 3300046809 Bacteria 1156
184 Ga0495674_0055587 3300047319 Unclassified 3470
185 Ga0495674_0153949 3300047319 Bacteria 1927
186 Ga0495674_0595794 3300047319 Unclassified 876
187 Ga0495675_0129341 3300047444 Bacteria 1570
188 Ga0495675_0173375 3300047444 Bacteria 1324
189 Ga0495684_0021623 3300047471 Bacteria 4953
190 Ga0495684_0662939 3300047471 Unclassified 696
191 Ga0495593_0441966 3300047673 Unclassified 651
192 Ga0495602_0170524 3300048088 Bacteria 1690
193 Ga0496115_0173840 3300048918 Bacteria 1781
194 Ga0501072_1395884 3300049588 Bacteria 542
195 nmdc:mga06r32_167696_c1 3300050510 Unclassified 2179
196 nmdc:mga0n895_2093217_c1 3300050512 Unclassified 522
197 nmdc:mga0rr50_223269_c1 3300050513 Bacteria 1556
198 nmdc:mga08x19_3311_c1 3300050514 Bacteria 9630
199 nmdc:mga08x19_716501_c1 3300050514 Unclassified 710
200 2842892468 2842888712 Bacteria 4279094
201 Ga0163162_13445691
202 Ga0070676_10564446
203 Ga0070676_10564629
204 Ga0070683_100000011
205 Ga0070683_100026858
206 Ga0070683_100777757
207 Ga0070690_101127227
208 Ga0070670_100113407
209 Ga0068869_102014219
210 Ga0070666_10640423
211 Ga0070680_100668530
212 Ga0068868_101117256
213 Ga0068868_102117818
214 Ga0070675_100076313
215 Ga0070688_100449812
216 Ga0070667_101069551
217 Ga0070713_102248077
218 Ga0070711_101373971
219 Ga0070705_100243407
220 Ga0070705_101212846
221 Ga0070708_100051359
222 Ga0070681_10191875
223 Ga0070706_100843632
224 Ga0070679_100200288
225 Ga0070684_100000001
226 Ga0070684_100013847
227 Ga0070684_100192528
228 Ga0070697_100556729
229 Ga0070696_100014986
230 Ga0070665_101040181
231 Ga0070665_101602173
232 Ga0068859_100735712
233 Ga0068870_10732692
234 Ga0068858_100738433
235 Ga0068860_100899991
236 Ga0068860_101102390
237 Ga0070717_10008972
238 Ga0097621_100624407
239 Ga0097621_100784412
240 Ga0068871_100073646
241 Ga0068871_101830069
242 Ga0075431_100008713
243 Ga0068865_101592197
244 Ga0075436_100004212
245 Ga0075436_100670071
246 Ga0097620_100735570
247 Ga0075435_100074664
248 Ga0105240_10002536
249 Ga0105245_10580143
250 Ga0105245_11555251
251 Ga0105245_11837121
252 Ga0105242_11281791
253 Ga0105248_10098027
254 Ga0105237_10358459
255 Ga0105238_10041940
256 Ga0157370_10788357
257 Ga0157369_10303700
258 Ga0157374_10534830
259 Ga0157374_10563350
260 Ga0157378_10179091
261 Ga0157378_10595588
262 Ga0157378_10722866
263 Ga0163162_12775984
264 Ga0157375_11285714
265 Ga0163163_10085436
266 Ga0163163_10218539
267 Ga0163163_11125294
268 Ga0163163_11636927
269 Ga0157377_11279963
270 Ga0157379_10197188
271 Ga0157376_10274163
272 Ga0157376_11267933
273 Ga0157376_11513860
274 Ga0207680_10444573
275 Ga0207685_10241192
276 Ga0207699_10160317
277 Ga0207699_10466790
278 Ga0207699_10741687
279 Ga0207643_10788537
280 Ga0207684_10674177
281 Ga0207707_10340273
282 Ga0207695_10047007
283 Ga0207660_10476920
284 Ga0207652_10081204
285 Ga0207694_10038208
286 Ga0207659_10526444
287 Ga0207687_11796451
288 Ga0207700_10478578
289 Ga0207704_10353477
290 Ga0207704_11035366
291 Ga0207665_10137959
292 Ga0207711_10087273
293 Ga0207711_11734070
294 Ga0207661_10000016
295 Ga0207661_10095452
296 Ga0207658_11000226
297 Ga0207641_11715122
298 Ga0207674_11440558
299 Ga0265338_10665417
300 Ga0265762_1031325
301 Ga0265760_10331280
302 Ga0265330_10267693
303 Ga0265332_10224224
304 Ga0265325_10012245
305 Ga0265325_10124669
306 Ga0265339_10272231
307 Ga0265331_10031189
308 Ga0265316_10338689
309 Ga0265314_10057167
310 Ga0265342_10021020
311 Ga0373926_0159095
312 Ga0373934_0178237
313 Ga0373934_0266920
314 Ga0373923_0151625
315 Ga0373945_0263197
316 Ga0373953_0088756
317 Ga0373953_0509765
318 Ga0373954_0038050
319 Ga0373954_0154158
320 Ga0373954_0324805
321 Ga0373957_0298891
322 Ga0373943_0097427
323 Ga0373946_0182616
324 Ga0373935_0013714
325 Ga0373935_0503985
326 Ga0373927_0001300
327 Ga0373927_0004285
328 Ga0373927_0004287
329 Ga0373927_0051663
330 Ga0373927_0523381
331 Ga0373933_0077154
332 Ga0373947_0004192
333 Ga0373947_0485226
334 Ga0373937_0002521
335 Ga0373937_0049214
336 Ga0373937_0152649
337 Ga0373937_0181946
338 Ga0373925_0000903
339 Ga0373925_0012099
340 Ga0373925_0132223
341 Ga0373925_0614876
342 Ga0436365_1772124
343 Ga0436360_1091238
344 Ga0436361_0341016
345 Ga0451577_0722361
346 Ga0451577_0760484
347 Ga0453684_0000053
348 Ga0453684_0045798
349 Ga0453684_0121825
350 Ga0453684_0247608
351 Ga0453684_0413635
352 Ga0453684_0483423
353 Ga0453684_1067079
354 Ga0453684_2364990
355 Ga0466957_1123321
356 Ga0466959_0499779
357 Ga0451576_0186804
358 Ga0451576_1199976
359 Ga0466958_0195380
360 Ga0495629_0168889
361 Ga0495651_0172928
362 Ga0495651_0702063
363 Ga0495653_0136863
364 Ga0495580_0003067
365 Ga0495580_0012856
366 Ga0495580_0016274
367 Ga0495580_0042931
368 Ga0495580_0488004
369 Ga0495580_0797940
370 Ga0495582_0049734
371 Ga0495582_0253736
372 Ga0495662_0490355
373 Ga0495594_0354100
374 Ga0495630_0251035
375 Ga0495666_0143747
376 Ga0495642_0311040
377 Ga0495665_0193122
378 Ga0495667_0368989
379 Ga0495635_0049240
380 Ga0495635_0473713
381 Ga0495613_0392878
382 Ga0495624_0626954
383 Ga0495600_0239519
384 Ga0495674_0055587
385 Ga0495674_0153949
386 Ga0495674_0595794
387 Ga0495675_0129341
388 Ga0495675_0173375
389 Ga0495684_0021623
390 Ga0495684_0662939
391 Ga0495593_0441966
392 Ga0495602_0170524
393 Ga0496115_0173840
394 Ga0501072_1395884
395 nmdc:mga06r32_167696_c1
396 nmdc:mga0n895_2093217_c1
397 nmdc:mga0rr50_223269_c1
398 nmdc:mga08x19_3311_c1
399 nmdc:mga08x19_716501_c1
400 2842892468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

20

129

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qmn-assembly1.cif.gz_B crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor 0.9488 1 125
2was-assembly2.cif.gz_E structure of the fungal type i fas ppt domain 0.9419 4 125
5xuh-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.9416 1 125
3qmn-assembly1.cif.gz_B crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor 0.9416 1 125
5xu7-assembly1.cif.gz_A crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9375 1 125
ID Description Score Start End Superfamily
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9329 1 125 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9254 1 125 3.90.470.20
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9193 4 125 3.90.470.20
2wasC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9115 4 125 3.90.470.20
5xukA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9052 5 124 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A2N9M0H4-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 1.001 1 125 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7X2TYY6-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9976 1 125 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A2V9TKS4-F1-model_v4 Holo-[acyl-carrier-protein] synthase 0.9938 29 125 GO:0000287
GO:0006633
GO:0008897
AF-A0A7X2TYY6-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9897 1 125 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A2V9YC95-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9845 1 125 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map