F307138
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 200 | 136 | 192 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10000283|Ga0157371_1000028314 |
| Length | 246 |
| Sequence | MRPVSRTYNPCRSGVSVFQTMTPSLRLFFDHPRNTSMTLLDTLHWRYATKSYTNERIAPAKLDAILEAIRLAPSSSGLQPFTVFVITDPALRARLAPVSYDQQQITQASHLLVFAAWDRYTPERINDFFAYSNAIRDVPDSVTDDYRLSLLDGFGSKTAEQQHAHAAKQCYIALGFGLIAAAEAGVDATPMEGFDNQAVDALLGLAEQGLSSAVMLALGHRDVEGDWLVTLAKVRRARAELFIELN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 2 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 3 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 4 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 5 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 6 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 7 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 8 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 80 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 81 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 82 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 83 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 84 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 85 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 86 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 87 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 91 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 92 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 93 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 94 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 95 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 96 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 97 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 98 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 99 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 100 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 101 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 102 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 103 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 109 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 110 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 111 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 112 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 113 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 128 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 129 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 130 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 131 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 132 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 133 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 134 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 135 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 136 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86 |
| Metatranscriptomes | 10 |
| Isolates | 4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.5 |
| Nodule | 0 |
| Rhizoplane | 2.5 |
| Rhizosphere | 77.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002786 | 3300001979 | Bacteria | 7823 |
| 2 | JGI25153J46596_10021649 | 3300003215 | Bacteria | 2390 |
| 3 | rootH2_10021402 | 3300003320 | Bacteria | 63664 |
| 4 | rootH2_10154240 | 3300003320 | Bacteria | 1333 |
| 5 | rootH1_10174188 | 3300003323 | Bacteria | 1515 |
| 6 | JGI25160J50197_1001637 | 3300003354 | Bacteria | 10988 |
| 7 | Ga0055526_1008372 | 3300003771 | Bacteria | 5175 |
| 8 | Ga0055528_1000154 | 3300003790 | Bacteria | 57131 |
| 9 | Ga0055530_10001127 | 3300003791 | Bacteria | 20845 |
| 10 | Ga0055543_1003803 | 3300004625 | Bacteria | 4294 |
| 11 | Ga0065165_1000328 | 3300005262 | Bacteria | 77624 |
| 12 | Ga0065704_10303443 | 3300005289 | Bacteria | 881 |
| 13 | Ga0070666_10037681 | 3300005335 | Bacteria | 3216 |
| 14 | Ga0068868_100022114 | 3300005338 | Bacteria | 4796 |
| 15 | Ga0070691_10011594 | 3300005341 | Unclassified | 4026 |
| 16 | Ga0070681_10007437 | 3300005458 | Bacteria | 10705 |
| 17 | Ga0070684_100073342 | 3300005535 | Bacteria | 3016 |
| 18 | Ga0068853_100008582 | 3300005539 | Bacteria | 8216 |
| 19 | Ga0068853_100192024 | 3300005539 | Bacteria | 1856 |
| 20 | Ga0068853_100707739 | 3300005539 | Unclassified | 961 |
| 21 | Ga0068855_100001621 | 3300005563 | Bacteria | 28227 |
| 22 | Ga0068855_100003329 | 3300005563 | Bacteria | 19653 |
| 23 | Ga0068855_100279576 | 3300005563 | Unclassified | 1854 |
| 24 | Ga0070664_100000088 | 3300005564 | Bacteria | 58607 |
| 25 | Ga0068857_100136878 | 3300005577 | Bacteria | 2212 |
| 26 | Ga0068857_100213475 | 3300005577 | Bacteria | 1761 |
| 27 | Ga0068852_100000263 | 3300005616 | Bacteria | 35308 |
| 28 | Ga0068852_100047689 | 3300005616 | Bacteria | 3656 |
| 29 | Ga0068852_100427629 | 3300005616 | Bacteria | 1307 |
| 30 | Ga0068859_100012902 | 3300005617 | Bacteria | 8395 |
| 31 | Ga0068860_100000006 | 3300005843 | Bacteria | 461966 |
| 32 | Ga0068860_100389751 | 3300005843 | Bacteria | 1376 |
| 33 | Ga0068860_100831920 | 3300005843 | Bacteria | 937 |
| 34 | Ga0075366_10125461 | 3300006195 | Bacteria | 1548 |
| 35 | Ga0097620_100012902 | 3300006931 | Bacteria | 8395 |
| 36 | Ga0105244_10009681 | 3300009036 | Bacteria | 5899 |
| 37 | Ga0105240_10000908 | 3300009093 | Bacteria | 52921 |
| 38 | Ga0105240_10001744 | 3300009093 | Bacteria | 36730 |
| 39 | Ga0105240_10002447 | 3300009093 | Bacteria | 29855 |
| 40 | Ga0105240_10023626 | 3300009093 | Bacteria | 8121 |
| 41 | Ga0105240_10026781 | 3300009093 | Bacteria | 7562 |
| 42 | Ga0105240_10090498 | 3300009093 | Bacteria | 3739 |
| 43 | Ga0105240_10230018 | 3300009093 | Bacteria | 2155 |
| 44 | Ga0105242_10001161 | 3300009176 | Bacteria | 20740 |
| 45 | Ga0105237_10001113 | 3300009545 | Bacteria | 35975 |
| 46 | Ga0105237_10001298 | 3300009545 | Bacteria | 33267 |
| 47 | Ga0105237_10012392 | 3300009545 | Bacteria | 8987 |
| 48 | Ga0105237_10141629 | 3300009545 | Bacteria | 2399 |
| 49 | Ga0105238_10052713 | 3300009551 | Bacteria | 4089 |
| 50 | Ga0105238_10098772 | 3300009551 | Bacteria | 2903 |
| 51 | Ga0105238_10844637 | 3300009551 | Bacteria | 933 |
| 52 | Ga0105249_10164283 | 3300009553 | Unclassified | 2148 |
| 53 | Ga0105239_10001497 | 3300010375 | Bacteria | 31050 |
| 54 | Ga0105239_10003418 | 3300010375 | Bacteria | 19466 |
| 55 | Ga0105239_10062274 | 3300010375 | Bacteria | 4095 |
| 56 | Ga0105239_10201244 | 3300010375 | Unclassified | 2231 |
| 57 | Ga0105246_10076832 | 3300011119 | Bacteria | 2367 |
| 58 | Ga0157373_10012483 | 3300013100 | Bacteria | 6243 |
| 59 | Ga0157373_10018279 | 3300013100 | Bacteria | 5105 |
| 60 | Ga0157373_10058845 | 3300013100 | Bacteria | 2723 |
| 61 | Ga0157371_10000283 | 3300013102 | Bacteria | 68598 |
| 62 | Ga0157371_10000350 | 3300013102 | Bacteria | 59321 |
| 63 | Ga0157371_10002692 | 3300013102 | Bacteria | 16784 |
| 64 | Ga0157371_10020163 | 3300013102 | Bacteria | 4907 |
| 65 | Ga0157370_10009497 | 3300013104 | Bacteria | 10380 |
| 66 | Ga0157370_10063924 | 3300013104 | Bacteria | 3485 |
| 67 | Ga0157370_10442030 | 3300013104 | Bacteria | 1196 |
| 68 | Ga0157370_10875954 | 3300013104 | Bacteria | 815 |
| 69 | Ga0157369_10022749 | 3300013105 | Bacteria | 6989 |
| 70 | Ga0157369_10066591 | 3300013105 | Bacteria | 3874 |
| 71 | Ga0157369_10300745 | 3300013105 | Bacteria | 1669 |
| 72 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 73 | Ga0157374_10149874 | 3300013296 | Bacteria | 2267 |
| 74 | Ga0163162_10001993 | 3300013306 | Bacteria | 19205 |
| 75 | Ga0157372_10000250 | 3300013307 | Bacteria | 59465 |
| 76 | Ga0157372_10001956 | 3300013307 | Bacteria | 22388 |
| 77 | Ga0157372_10486223 | 3300013307 | Bacteria | 1439 |
| 78 | Ga0157372_10754116 | 3300013307 | Bacteria | 1132 |
| 79 | Ga0157375_10000223 | 3300013308 | Bacteria | 53476 |
| 80 | Ga0157375_10003047 | 3300013308 | Bacteria | 14551 |
| 81 | Ga0163163_10075683 | 3300014325 | Unclassified | 3360 |
| 82 | Ga0157376_10003576 | 3300014969 | Bacteria | 10718 |
| 83 | Ga0182006_1014277 | 3300015261 | Bacteria | 3427 |
| 84 | Ga0182007_10001148 | 3300015262 | Bacteria | 14345 |
| 85 | Ga0163161_10000348 | 3300017792 | Bacteria | 39127 |
| 86 | Ga0163161_10023913 | 3300017792 | Bacteria | 4312 |
| 87 | Ga0206352_10997761 | 3300020078 | Bacteria | 1655 |
| 88 | Ga0209673_1007710 | 3300025273 | Bacteria | 4902 |
| 89 | Ga0209564_1001824 | 3300025295 | Bacteria | 19546 |
| 90 | Ga0209758_1002965 | 3300025297 | Bacteria | 16274 |
| 91 | Ga0209050_1000789 | 3300025298 | Bacteria | 44988 |
| 92 | Ga0207426_1001766 | 3300025302 | Bacteria | 16358 |
| 93 | Ga0209051_1027265 | 3300025303 | Bacteria | 2280 |
| 94 | Ga0209257_1006533 | 3300025304 | Bacteria | 7450 |
| 95 | Ga0207655_1000487 | 3300025728 | Bacteria | 51198 |
| 96 | Ga0207680_10121483 | 3300025903 | Bacteria | 1709 |
| 97 | Ga0207647_10019254 | 3300025904 | Bacteria | 4593 |
| 98 | Ga0207695_10000245 | 3300025913 | Bacteria | 141090 |
| 99 | Ga0207695_10000462 | 3300025913 | Bacteria | 88318 |
| 100 | Ga0207695_10001603 | 3300025913 | Bacteria | 36738 |
| 101 | Ga0207695_10100976 | 3300025913 | Bacteria | 2880 |
| 102 | Ga0207695_10106890 | 3300025913 | Bacteria | 2784 |
| 103 | Ga0207695_10142796 | 3300025913 | Bacteria | 2341 |
| 104 | Ga0207671_10000034 | 3300025914 | Bacteria | 245048 |
| 105 | Ga0207671_10002265 | 3300025914 | Bacteria | 20812 |
| 106 | Ga0207649_10000006 | 3300025920 | Bacteria | 349180 |
| 107 | Ga0207694_10407170 | 3300025924 | Bacteria | 1131 |
| 108 | Ga0207694_10410182 | 3300025924 | Bacteria | 1127 |
| 109 | Ga0207694_10703007 | 3300025924 | Bacteria | 852 |
| 110 | Ga0207661_10055566 | 3300025944 | Bacteria | 3176 |
| 111 | Ga0207679_10000010 | 3300025945 | Bacteria | 349180 |
| 112 | Ga0207667_10000419 | 3300025949 | Bacteria | 57239 |
| 113 | Ga0207667_10051569 | 3300025949 | Unclassified | 4337 |
| 114 | Ga0207640_10003632 | 3300025981 | Bacteria | 8325 |
| 115 | Ga0207677_10083817 | 3300026023 | Bacteria | 2296 |
| 116 | Ga0207639_10008615 | 3300026041 | Bacteria | 6998 |
| 117 | Ga0207639_10150666 | 3300026041 | Bacteria | 1948 |
| 118 | Ga0207702_10218267 | 3300026078 | Bacteria | 1776 |
| 119 | Ga0207698_10001880 | 3300026142 | Bacteria | 12283 |
| 120 | Ga0207698_10122623 | 3300026142 | Bacteria | 2203 |
| 121 | Ga0268264_10000064 | 3300028381 | Bacteria | 301274 |
| 122 | Ga0268264_10174310 | 3300028381 | Bacteria | 1948 |
| 123 | Ga0307517_10001736 | 3300028786 | Bacteria | 35923 |
| 124 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 125 | Ga0307511_10024358 | 3300030521 | Bacteria | 5611 |
| 126 | Ga0316182_1427766 | 3300030745 | Unclassified | 1061 |
| 127 | Ga0265327_10000701 | 3300031251 | Bacteria | 53104 |
| 128 | Ga0307509_10122435 | 3300031507 | Bacteria | 2575 |
| 129 | Ga0307408_100005619 | 3300031548 | Bacteria | 8384 |
| 130 | Ga0307408_100010275 | 3300031548 | Bacteria | 6174 |
| 131 | Ga0307516_10000862 | 3300031730 | Bacteria | 41576 |
| 132 | Ga0307516_10097297 | 3300031730 | Bacteria | 2763 |
| 133 | Ga0307405_10212224 | 3300031731 | Unclassified | 1414 |
| 134 | Ga0307412_10090355 | 3300031911 | Bacteria | 2140 |
| 135 | Ga0307412_10149124 | 3300031911 | Bacteria | 1723 |
| 136 | Ga0307416_100066835 | 3300032002 | Bacteria | 2962 |
| 137 | Ga0307510_10001416 | 3300033180 | Bacteria | 26333 |
| 138 | Ga0439466_0042305 | 3300041411 | Bacteria | 1517 |
| 139 | Ga0451789_0967675 | 3300041443 | Bacteria | 804 |
| 140 | Ga0439432_027978 | 3300042006 | Bacteria | 1838 |
| 141 | Ga0439463_000879 | 3300042016 | Bacteria | 8278 |
| 142 | Ga0439464_0000378 | 3300042439 | Bacteria | 8722 |
| 143 | Ga0439464_0037351 | 3300042439 | Bacteria | 1377 |
| 144 | Ga0466972_0001142 | 3300044658 | Bacteria | 12720 |
| 145 | Ga0466965_0020376 | 3300044683 | Bacteria | 3187 |
| 146 | Ga0466961_0049434 | 3300044693 | Bacteria | 2688 |
| 147 | Ga0466971_0074493 | 3300044719 | Bacteria | 1543 |
| 148 | Ga0466970_0024897 | 3300044765 | Bacteria | 3131 |
| 149 | Ga0466959_0029437 | 3300045049 | Bacteria | 4068 |
| 150 | Ga0466958_0064951 | 3300045836 | Bacteria | 2227 |
| 151 | Ga0495638_0151600 | 3300046460 | Bacteria | 1344 |
| 152 | Ga0495648_0006935 | 3300046524 | Bacteria | 9135 |
| 153 | Ga0495633_0000472 | 3300046558 | Bacteria | 40822 |
| 154 | Ga0495687_000158 | 3300047443 | Bacteria | 103129 |
| 155 | Ga0495686_0000039 | 3300047472 | Bacteria | 304821 |
| 156 | Ga0496103_0002474 | 3300048906 | Bacteria | 11583 |
| 157 | Ga0496114_0043039 | 3300048917 | Bacteria | 3745 |
| 158 | Ga0496115_0310555 | 3300048918 | Unclassified | 1291 |
| 159 | Ga0496122_0192996 | 3300048925 | Bacteria | 1200 |
| 160 | Ga0496122_0380168 | 3300048925 | Bacteria | 725 |
| 161 | Ga0496125_0003612 | 3300048928 | Bacteria | 18576 |
| 162 | Ga0496125_0042649 | 3300048928 | Bacteria | 3861 |
| 163 | Ga0501306_003198 | 3300049127 | Unclassified | 1746 |
| 164 | Ga0501306_023849 | 3300049127 | Bacteria | 871 |
| 165 | Ga0501308_003698 | 3300049128 | Unclassified | 1433 |
| 166 | Ga0501310_007451 | 3300049130 | Bacteria | 1169 |
| 167 | Ga0501305_010530 | 3300049161 | Bacteria | 1236 |
| 168 | Ga0501307_006965 | 3300049162 | Unclassified | 1236 |
| 169 | Ga0501311_007245 | 3300049527 | Bacteria | 1274 |
| 170 | Ga0501312_039233 | 3300049528 | Bacteria | 769 |
| 171 | Ga0501315_011880 | 3300049531 | Bacteria | 1070 |
| 172 | Ga0501315_015190 | 3300049531 | Unclassified | 984 |
| 173 | Ga0501316_003946 | 3300049532 | Unclassified | 1468 |
| 174 | Ga0501320_008351 | 3300049536 | Bacteria | 1017 |
| 175 | Ga0501321_016877 | 3300049537 | Bacteria | 873 |
| 176 | Ga0501322_002926 | 3300049538 | Unclassified | 1079 |
| 177 | Ga0501323_006810 | 3300049539 | Unclassified | 1287 |
| 178 | Ga0501335_000526 | 3300049551 | Bacteria | 2501 |
| 179 | Ga0501335_001431 | 3300049551 | Bacteria | 1830 |
| 180 | Ga0501335_003526 | 3300049551 | Unclassified | 1329 |
| 181 | Ga0501335_020224 | 3300049551 | Bacteria | 707 |
| 182 | Ga0501240_000905 | 3300049673 | Bacteria | 2691 |
| 183 | Ga0501225_0000231 | 3300049705 | Bacteria | 17496 |
| 184 | nmdc:mga0k408_333160_c1 | 3300050493 | Bacteria | 905 |
| 185 | Ga0500578_0000144 | 3300053086 | Bacteria | 85335 |
| 186 | Ga0500642_0025877 | 3300053130 | Bacteria | 2389 |
| 187 | Ga0500568_0011956 | 3300053139 | Bacteria | 4005 |
| 188 | Ga0500616_0014943 | 3300053153 | Bacteria | 4450 |
| 189 | Ga0500622_0000657 | 3300053156 | Bacteria | 30758 |
| 190 | Ga0500622_0002440 | 3300053156 | Bacteria | 13425 |
| 191 | Ga0500637_0291891 | 3300053178 | Bacteria | 893 |
| 192 | Ga0466962_0021402 | 3300061719 | Bacteria | 3105 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049538 | Ga0501322_002926 | Ga0501322_002926_23_571 | 182 |
| 2 | 3300046524 | Ga0495648_0006935 | Ga0495648_0006935_6252_6830 | 184 |
| 3 | 3300053130 | Ga0500642_0025877 | Ga0500642_0025877_508_1086 | 184 |
| 4 | 3300053156 | Ga0500622_0000657 | Ga0500622_0000657_13971_14549 | 184 |
| 5 | 3300049127 | Ga0501306_003198 | Ga0501306_003198_59_640 | 193 |
| 6 | 3300049130 | Ga0501310_007451 | Ga0501310_007451_534_1115 | 193 |
| 7 | 3300049161 | Ga0501305_010530 | Ga0501305_010530_597_1178 | 193 |
| 8 | 3300049162 | Ga0501307_006965 | Ga0501307_006965_53_634 | 193 |
| 9 | 3300049527 | Ga0501311_007245 | Ga0501311_007245_59_640 | 193 |
| 10 | 3300049528 | Ga0501312_039233 | Ga0501312_039233_55_636 | 193 |
| 11 | 3300049531 | Ga0501315_011880 | Ga0501315_011880_433_1014 | 193 |
| 12 | 3300049532 | Ga0501316_003946 | Ga0501316_003946_834_1415 | 193 |
| 13 | 3300049537 | Ga0501321_016877 | Ga0501321_016877_56_637 | 193 |
| 14 | 3300049539 | Ga0501323_006810 | Ga0501323_006810_654_1235 | 193 |
| 15 | 3300049551 | Ga0501335_001431 | Ga0501335_001431_170_751 | 193 |
| 16 | 3300005563 | Ga0068855_100001621 | Ga0068855_10000162127 | 194 |
| 17 | 3300009093 | Ga0105240_10002447 | Ga0105240_100024474 | 194 |
| 18 | 3300013104 | Ga0157370_10009497 | Ga0157370_100094979 | 194 |
| 19 | 3300020078 | Ga0206352_10997761 | Ga0206352_109977612 | 194 |
| 20 | 3300025913 | Ga0207695_10000245 | Ga0207695_1000024531 | 194 |
| 21 | 3300025944 | Ga0207661_10055566 | Ga0207661_100555662 | 194 |
| 22 | 3300049551 | Ga0501335_003526 | Ga0501335_003526_43_627 | 194 |
| 23 | 3300046460 | Ga0495638_0151600 | Ga0495638_0151600_266_862 | 195 |
| 24 | 3300049705 | Ga0501225_0000231 | Ga0501225_0000231_2436_3023 | 195 |
| 25 | 3300050493 | nmdc:mga0k408_333160_c1 | nmdc:mga0k408_333160_c1_67_654 | 195 |
| 26 | 3300053086 | Ga0500578_0000144 | Ga0500578_0000144_69647_70234 | 195 |
| 27 | 3300053153 | Ga0500616_0014943 | Ga0500616_0014943_685_1272 | 195 |
| 28 | 3300044658 | Ga0466972_0001142 | Ga0466972_0001142_2000_2596 | 198 |
| 29 | iso_pu_bacteria | 2585428061 | 2587752982 | 205 |
| 30 | iso_pu_bacteria | 2585428183 | 2588212616 | 205 |
| 31 | iso_pu_bacteria | 2643221725 | 2644686026 | 205 |
| 32 | iso_pu_bacteria | 2919692658 | 2919692934 | 205 |
| 33 | iso_pu_bacteria | 2929239360 | 2929241925 | 205 |
| 34 | iso_pu_bacteria | 2599185179 | 2599451182 | 206 |
| 35 | iso_pu_bacteria | 2910245624 | 2910248170 | 206 |
| 36 | iso_pu_bacteria | 2919481497 | 2919482802 | 206 |
| 37 | 3300013102 | Ga0157371_10020163 | Ga0157371_100201632 | 208 |
| 38 | 3300013105 | Ga0157369_10300745 | Ga0157369_103007452 | 208 |
| 39 | 3300013307 | Ga0157372_10000250 | Ga0157372_1000025036 | 208 |
| 40 | 3300030745 | Ga0316182_1427766 | Ga0316182_14277662 | 208 |
| 41 | 3300031911 | Ga0307412_10149124 | Ga0307412_101491243 | 208 |
| 42 | 3300049127 | Ga0501306_023849 | Ga0501306_023849_235_861 | 208 |
| 43 | 3300003320 | rootH2_10021402 | rootH2_1002140238 | 209 |
| 44 | 3300003320 | rootH2_10154240 | rootH2_101542402 | 209 |
| 45 | 3300005338 | Ga0068868_100022114 | Ga0068868_1000221147 | 209 |
| 46 | 3300005341 | Ga0070691_10011594 | Ga0070691_100115944 | 209 |
| 47 | 3300005535 | Ga0070684_100073342 | Ga0070684_1000733423 | 209 |
| 48 | 3300005539 | Ga0068853_100707739 | Ga0068853_1007077391 | 209 |
| 49 | 3300005563 | Ga0068855_100279576 | Ga0068855_1002795762 | 209 |
| 50 | 3300005616 | Ga0068852_100427629 | Ga0068852_1004276291 | 209 |
| 51 | 3300005843 | Ga0068860_100389751 | Ga0068860_1003897512 | 209 |
| 52 | 3300013100 | Ga0157373_10018279 | Ga0157373_100182795 | 209 |
| 53 | 3300013296 | Ga0157374_10000003 | Ga0157374_1000000355 | 209 |
| 54 | 3300013308 | Ga0157375_10000223 | Ga0157375_1000022318 | 209 |
| 55 | 3300014325 | Ga0163163_10075683 | Ga0163163_100756834 | 209 |
| 56 | 3300014969 | Ga0157376_10003576 | Ga0157376_100035764 | 209 |
| 57 | 3300017792 | Ga0163161_10000348 | Ga0163161_1000034835 | 209 |
| 58 | 3300025913 | Ga0207695_10100976 | Ga0207695_101009762 | 209 |
| 59 | 3300025914 | Ga0207671_10002265 | Ga0207671_1000226511 | 209 |
| 60 | 3300025924 | Ga0207694_10703007 | Ga0207694_107030072 | 209 |
| 61 | 3300025949 | Ga0207667_10051569 | Ga0207667_100515693 | 209 |
| 62 | 3300026023 | Ga0207677_10083817 | Ga0207677_100838172 | 209 |
| 63 | 3300028381 | Ga0268264_10174310 | Ga0268264_101743103 | 209 |
| 64 | 3300031251 | Ga0265327_10000701 | Ga0265327_1000070123 | 209 |
| 65 | 3300031507 | Ga0307509_10122435 | Ga0307509_101224352 | 209 |
| 66 | 3300031548 | Ga0307408_100005619 | Ga0307408_1000056196 | 209 |
| 67 | 3300031548 | Ga0307408_100010275 | Ga0307408_1000102754 | 209 |
| 68 | 3300031730 | Ga0307516_10097297 | Ga0307516_100972973 | 209 |
| 69 | 3300031731 | Ga0307405_10212224 | Ga0307405_102122242 | 209 |
| 70 | 3300031911 | Ga0307412_10090355 | Ga0307412_100903551 | 209 |
| 71 | 3300032002 | Ga0307416_100066835 | Ga0307416_1000668353 | 209 |
| 72 | 3300033180 | Ga0307510_10001416 | Ga0307510_100014163 | 209 |
| 73 | 3300044693 | Ga0466961_0049434 | Ga0466961_0049434_822_1451 | 209 |
| 74 | 3300044719 | Ga0466971_0074493 | Ga0466971_0074493_342_971 | 209 |
| 75 | 3300044765 | Ga0466970_0024897 | Ga0466970_0024897_1835_2464 | 209 |
| 76 | 3300045049 | Ga0466959_0029437 | Ga0466959_0029437_1756_2385 | 209 |
| 77 | 3300045836 | Ga0466958_0064951 | Ga0466958_0064951_983_1612 | 209 |
| 78 | 3300047472 | Ga0495686_0000039 | Ga0495686_0000039_303006_303635 | 209 |
| 79 | 3300049128 | Ga0501308_003698 | Ga0501308_003698_11_640 | 209 |
| 80 | 3300049551 | Ga0501335_020224 | Ga0501335_020224_45_695 | 209 |
| 81 | 3300049673 | Ga0501240_000905 | Ga0501240_000905_876_1505 | 209 |
| 82 | 3300061719 | Ga0466962_0021402 | Ga0466962_0021402_1381_2010 | 209 |
| 83 | 3300005289 | Ga0065704_10303443 | Ga0065704_103034431 | 210 |
| 84 | 3300005335 | Ga0070666_10037681 | Ga0070666_100376813 | 210 |
| 85 | 3300005539 | Ga0068853_100008582 | Ga0068853_1000085829 | 210 |
| 86 | 3300005564 | Ga0070664_100000088 | Ga0070664_10000008829 | 210 |
| 87 | 3300005577 | Ga0068857_100213475 | Ga0068857_1002134752 | 210 |
| 88 | 3300005616 | Ga0068852_100047689 | Ga0068852_1000476895 | 210 |
| 89 | 3300005617 | Ga0068859_100012902 | Ga0068859_1000129028 | 210 |
| 90 | 3300005843 | Ga0068860_100000006 | Ga0068860_100000006100 | 210 |
| 91 | 3300005843 | Ga0068860_100831920 | Ga0068860_1008319202 | 210 |
| 92 | 3300006931 | Ga0097620_100012902 | Ga0097620_1000129028 | 210 |
| 93 | 3300009036 | Ga0105244_10009681 | Ga0105244_100096815 | 210 |
| 94 | 3300009093 | Ga0105240_10000908 | Ga0105240_1000090815 | 210 |
| 95 | 3300009093 | Ga0105240_10001744 | Ga0105240_1000174416 | 210 |
| 96 | 3300009093 | Ga0105240_10023626 | Ga0105240_100236264 | 210 |
| 97 | 3300009093 | Ga0105240_10026781 | Ga0105240_100267816 | 210 |
| 98 | 3300009176 | Ga0105242_10001161 | Ga0105242_100011617 | 210 |
| 99 | 3300009545 | Ga0105237_10001113 | Ga0105237_1000111320 | 210 |
| 100 | 3300009545 | Ga0105237_10001298 | Ga0105237_100012983 | 210 |
| 101 | 3300009545 | Ga0105237_10012392 | Ga0105237_100123921 | 210 |
| 102 | 3300009551 | Ga0105238_10052713 | Ga0105238_100527136 | 210 |
| 103 | 3300009551 | Ga0105238_10098772 | Ga0105238_100987723 | 210 |
| 104 | 3300009551 | Ga0105238_10844637 | Ga0105238_108446371 | 210 |
| 105 | 3300009553 | Ga0105249_10164283 | Ga0105249_101642832 | 210 |
| 106 | 3300010375 | Ga0105239_10001497 | Ga0105239_100014975 | 210 |
| 107 | 3300010375 | Ga0105239_10003418 | Ga0105239_100034184 | 210 |
| 108 | 3300010375 | Ga0105239_10062274 | Ga0105239_100622742 | 210 |
| 109 | 3300010375 | Ga0105239_10201244 | Ga0105239_102012444 | 210 |
| 110 | 3300011119 | Ga0105246_10076832 | Ga0105246_100768322 | 210 |
| 111 | 3300013100 | Ga0157373_10012483 | Ga0157373_100124833 | 210 |
| 112 | 3300013102 | Ga0157371_10000350 | Ga0157371_1000035057 | 210 |
| 113 | 3300013104 | Ga0157370_10063924 | Ga0157370_100639244 | 210 |
| 114 | 3300013104 | Ga0157370_10442030 | Ga0157370_104420301 | 210 |
| 115 | 3300013105 | Ga0157369_10022749 | Ga0157369_100227493 | 210 |
| 116 | 3300013296 | Ga0157374_10149874 | Ga0157374_101498743 | 210 |
| 117 | 3300013306 | Ga0163162_10001993 | Ga0163162_1000199313 | 210 |
| 118 | 3300013307 | Ga0157372_10486223 | Ga0157372_104862232 | 210 |
| 119 | 3300013308 | Ga0157375_10003047 | Ga0157375_100030475 | 210 |
| 120 | 3300015262 | Ga0182007_10001148 | Ga0182007_1000114813 | 210 |
| 121 | 3300017792 | Ga0163161_10023913 | Ga0163161_100239133 | 210 |
| 122 | 3300025728 | Ga0207655_1000487 | Ga0207655_100048712 | 210 |
| 123 | 3300025903 | Ga0207680_10121483 | Ga0207680_101214833 | 210 |
| 124 | 3300025913 | Ga0207695_10000462 | Ga0207695_1000046260 | 210 |
| 125 | 3300025913 | Ga0207695_10001603 | Ga0207695_1000160318 | 210 |
| 126 | 3300025913 | Ga0207695_10106890 | Ga0207695_101068902 | 210 |
| 127 | 3300025913 | Ga0207695_10142796 | Ga0207695_101427962 | 210 |
| 128 | 3300025914 | Ga0207671_10000034 | Ga0207671_1000003497 | 210 |
| 129 | 3300025920 | Ga0207649_10000006 | Ga0207649_10000006157 | 210 |
| 130 | 3300025924 | Ga0207694_10410182 | Ga0207694_104101822 | 210 |
| 131 | 3300025945 | Ga0207679_10000010 | Ga0207679_10000010157 | 210 |
| 132 | 3300026041 | Ga0207639_10008615 | Ga0207639_100086159 | 210 |
| 133 | 3300026142 | Ga0207698_10122623 | Ga0207698_101226231 | 210 |
| 134 | 3300028381 | Ga0268264_10000064 | Ga0268264_1000006494 | 210 |
| 135 | 3300028786 | Ga0307517_10001736 | Ga0307517_100017369 | 210 |
| 136 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002816 | 210 |
| 137 | 3300030521 | Ga0307511_10024358 | Ga0307511_100243583 | 210 |
| 138 | 3300031730 | Ga0307516_10000862 | Ga0307516_100008629 | 210 |
| 139 | 3300041443 | Ga0451789_0967675 | Ga0451789_0967675_40_678 | 210 |
| 140 | 3300042016 | Ga0439463_000879 | Ga0439463_000879_2405_3037 | 210 |
| 141 | 3300042439 | Ga0439464_0037351 | Ga0439464_0037351_356_988 | 210 |
| 142 | 3300044683 | Ga0466965_0020376 | Ga0466965_0020376_233_865 | 210 |
| 143 | 3300047443 | Ga0495687_000158 | Ga0495687_000158_96203_96835 | 210 |
| 144 | 3300048906 | Ga0496103_0002474 | Ga0496103_0002474_5217_5852 | 210 |
| 145 | 3300048917 | Ga0496114_0043039 | Ga0496114_0043039_1399_2088 | 210 |
| 146 | 3300048918 | Ga0496115_0310555 | Ga0496115_0310555_383_1021 | 210 |
| 147 | 3300048925 | Ga0496122_0380168 | Ga0496122_0380168_26_658 | 210 |
| 148 | 3300048928 | Ga0496125_0003612 | Ga0496125_0003612_2559_3191 | 210 |
| 149 | 3300048928 | Ga0496125_0042649 | Ga0496125_0042649_3069_3701 | 210 |
| 150 | 3300049531 | Ga0501315_015190 | Ga0501315_015190_284_916 | 210 |
| 151 | 3300049536 | Ga0501320_008351 | Ga0501320_008351_363_995 | 210 |
| 152 | 3300049551 | Ga0501335_000526 | Ga0501335_000526_671_1303 | 210 |
| 153 | 3300053139 | Ga0500568_0011956 | Ga0500568_0011956_301_933 | 210 |
| 154 | 3300001979 | JGI24740J21852_10002786 | JGI24740J21852_100027862 | 211 |
| 155 | 3300003215 | JGI25153J46596_10021649 | JGI25153J46596_100216494 | 211 |
| 156 | 3300003323 | rootH1_10174188 | rootH1_101741881 | 211 |
| 157 | 3300003354 | JGI25160J50197_1001637 | JGI25160J50197_100163712 | 211 |
| 158 | 3300003771 | Ga0055526_1008372 | Ga0055526_10083722 | 211 |
| 159 | 3300003790 | Ga0055528_1000154 | Ga0055528_100015430 | 211 |
| 160 | 3300003791 | Ga0055530_10001127 | Ga0055530_1000112713 | 211 |
| 161 | 3300004625 | Ga0055543_1003803 | Ga0055543_10038031 | 211 |
| 162 | 3300005262 | Ga0065165_1000328 | Ga0065165_100032856 | 211 |
| 163 | 3300005458 | Ga0070681_10007437 | Ga0070681_100074378 | 211 |
| 164 | 3300005539 | Ga0068853_100192024 | Ga0068853_1001920241 | 211 |
| 165 | 3300005563 | Ga0068855_100003329 | Ga0068855_1000033293 | 211 |
| 166 | 3300005577 | Ga0068857_100136878 | Ga0068857_1001368782 | 211 |
| 167 | 3300005616 | Ga0068852_100000263 | Ga0068852_10000026317 | 211 |
| 168 | 3300006195 | Ga0075366_10125461 | Ga0075366_101254612 | 211 |
| 169 | 3300009093 | Ga0105240_10090498 | Ga0105240_100904982 | 211 |
| 170 | 3300009093 | Ga0105240_10230018 | Ga0105240_102300182 | 211 |
| 171 | 3300009545 | Ga0105237_10141629 | Ga0105237_101416292 | 211 |
| 172 | 3300013100 | Ga0157373_10058845 | Ga0157373_100588452 | 211 |
| 173 | 3300013102 | Ga0157371_10000283 | Ga0157371_1000028314 | 211 |
| 174 | 3300013102 | Ga0157371_10002692 | Ga0157371_100026927 | 211 |
| 175 | 3300013104 | Ga0157370_10875954 | Ga0157370_108759542 | 211 |
| 176 | 3300013105 | Ga0157369_10066591 | Ga0157369_100665913 | 211 |
| 177 | 3300013307 | Ga0157372_10001956 | Ga0157372_100019563 | 211 |
| 178 | 3300013307 | Ga0157372_10754116 | Ga0157372_107541162 | 211 |
| 179 | 3300015261 | Ga0182006_1014277 | Ga0182006_10142772 | 211 |
| 180 | 3300025273 | Ga0209673_1007710 | Ga0209673_10077104 | 211 |
| 181 | 3300025295 | Ga0209564_1001824 | Ga0209564_100182417 | 211 |
| 182 | 3300025297 | Ga0209758_1002965 | Ga0209758_10029658 | 211 |
| 183 | 3300025298 | Ga0209050_1000789 | Ga0209050_100078932 | 211 |
| 184 | 3300025302 | Ga0207426_1001766 | Ga0207426_100176613 | 211 |
| 185 | 3300025303 | Ga0209051_1027265 | Ga0209051_10272652 | 211 |
| 186 | 3300025304 | Ga0209257_1006533 | Ga0209257_10065339 | 211 |
| 187 | 3300025904 | Ga0207647_10019254 | Ga0207647_100192543 | 211 |
| 188 | 3300025924 | Ga0207694_10407170 | Ga0207694_104071701 | 211 |
| 189 | 3300025949 | Ga0207667_10000419 | Ga0207667_1000041936 | 211 |
| 190 | 3300025981 | Ga0207640_10003632 | Ga0207640_100036326 | 211 |
| 191 | 3300026041 | Ga0207639_10150666 | Ga0207639_101506662 | 211 |
| 192 | 3300026078 | Ga0207702_10218267 | Ga0207702_102182673 | 211 |
| 193 | 3300026142 | Ga0207698_10001880 | Ga0207698_100018803 | 211 |
| 194 | 3300041411 | Ga0439466_0042305 | Ga0439466_0042305_123_770 | 211 |
| 195 | 3300042006 | Ga0439432_027978 | Ga0439432_027978_519_1178 | 211 |
| 196 | 3300042439 | Ga0439464_0000378 | Ga0439464_0000378_2156_2803 | 211 |
| 197 | 3300046558 | Ga0495633_0000472 | Ga0495633_0000472_6016_6654 | 211 |
| 198 | 3300048925 | Ga0496122_0192996 | Ga0496122_0192996_137_784 | 211 |
| 199 | 3300053156 | Ga0500622_0002440 | Ga0500622_0002440_10119_10754 | 211 |
| 200 | 3300053178 | Ga0500637_0291891 | Ga0500637_0291891_34_702 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3of4-assembly2.cif.gz_C-2 | crystal structure of a fmn/fad- and nad(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution | 0.9467 | 2 | 210 |
| 3of4-assembly2.cif.gz_C-2 | crystal structure of a fmn/fad- and nad(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution | 0.9424 | 2 | 210 |
| 6czp-assembly1.cif.gz_A | 2.2 angstrom resolution crystal structure oxygen-insensitive nad(p)h-dependent nitroreductase nfsb from vibrio vulnificus in complex with fmn | 0.9293 | 4 | 210 |
| 8og3-assembly1.cif.gz_A | e. coli nfsb triple mutant t41l/n71s/f124t bound to citrate | 0.9268 | 4 | 210 |
| 1nec-assembly1.cif.gz_A | nitroreductase from enterobacter cloacae | 0.9267 | 4 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3of4C00 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.9458 | 4 | 210 | 3.40.109.10 |
| 3of4C00 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.937 | 4 | 210 | 3.40.109.10 |
| 1vfrA00 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.9264 | 1 | 210 | 3.40.109.10 |
| 1vfrA00 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.918 | 1 | 210 | 3.40.109.10 |
| 1icvD00 | Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase | 0.9067 | 4 | 210 | 3.40.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C6W2Q5-F1-model_v4 | Nitroreductase | 0.9846 | 1 | 210 |
GO:0016491
|
| AF-A0A226HHD5-F1-model_v4 | NAD(P)H-dependent oxidoreductase | 0.9817 | 2 | 211 |
GO:0016491
|
| AF-A0A2G4HZL3-F1-model_v4 | NAD(P)H-dependent oxidoreductase | 0.9816 | 4 | 210 |
GO:0016491
|
| AF-A0A5S9QQA7-F1-model_v4 | deleted | 0.9805 | 4 | 211 |
|
| AF-A0A7K0FVN6-F1-model_v4 | NAD(P)H-dependent oxidoreductase | 0.9794 | 2 | 211 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar