F307138

General Info

Members Datasets Scaffolds Average Seq Length
200 136 192 210

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10000283|Ga0157371_1000028314
Length 246
Sequence MRPVSRTYNPCRSGVSVFQTMTPSLRLFFDHPRNTSMTLLDTLHWRYATKSYTNERIAPAKLDAILEAIRLAPSSSGLQPFTVFVITDPALRARLAPVSYDQQQITQASHLLVFAAWDRYTPERINDFFAYSNAIRDVPDSVTDDYRLSLLDGFGSKTAEQQHAHAAKQCYIALGFGLIAAAEAGVDATPMEGFDNQAVDALLGLAEQGLSSAVMLALGHRDVEGDWLVTLAKVRRARAELFIELN

Samples

Sample ID Description Type Environment
1 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
2 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
3 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
4 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
5 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
6 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
7 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
8 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
92 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
128 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
135 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86
Metatranscriptomes 10
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.5
Nodule 0
Rhizoplane 2.5
Rhizosphere 77.5
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002786 3300001979 Bacteria 7823
2 JGI25153J46596_10021649 3300003215 Bacteria 2390
3 rootH2_10021402 3300003320 Bacteria 63664
4 rootH2_10154240 3300003320 Bacteria 1333
5 rootH1_10174188 3300003323 Bacteria 1515
6 JGI25160J50197_1001637 3300003354 Bacteria 10988
7 Ga0055526_1008372 3300003771 Bacteria 5175
8 Ga0055528_1000154 3300003790 Bacteria 57131
9 Ga0055530_10001127 3300003791 Bacteria 20845
10 Ga0055543_1003803 3300004625 Bacteria 4294
11 Ga0065165_1000328 3300005262 Bacteria 77624
12 Ga0065704_10303443 3300005289 Bacteria 881
13 Ga0070666_10037681 3300005335 Bacteria 3216
14 Ga0068868_100022114 3300005338 Bacteria 4796
15 Ga0070691_10011594 3300005341 Unclassified 4026
16 Ga0070681_10007437 3300005458 Bacteria 10705
17 Ga0070684_100073342 3300005535 Bacteria 3016
18 Ga0068853_100008582 3300005539 Bacteria 8216
19 Ga0068853_100192024 3300005539 Bacteria 1856
20 Ga0068853_100707739 3300005539 Unclassified 961
21 Ga0068855_100001621 3300005563 Bacteria 28227
22 Ga0068855_100003329 3300005563 Bacteria 19653
23 Ga0068855_100279576 3300005563 Unclassified 1854
24 Ga0070664_100000088 3300005564 Bacteria 58607
25 Ga0068857_100136878 3300005577 Bacteria 2212
26 Ga0068857_100213475 3300005577 Bacteria 1761
27 Ga0068852_100000263 3300005616 Bacteria 35308
28 Ga0068852_100047689 3300005616 Bacteria 3656
29 Ga0068852_100427629 3300005616 Bacteria 1307
30 Ga0068859_100012902 3300005617 Bacteria 8395
31 Ga0068860_100000006 3300005843 Bacteria 461966
32 Ga0068860_100389751 3300005843 Bacteria 1376
33 Ga0068860_100831920 3300005843 Bacteria 937
34 Ga0075366_10125461 3300006195 Bacteria 1548
35 Ga0097620_100012902 3300006931 Bacteria 8395
36 Ga0105244_10009681 3300009036 Bacteria 5899
37 Ga0105240_10000908 3300009093 Bacteria 52921
38 Ga0105240_10001744 3300009093 Bacteria 36730
39 Ga0105240_10002447 3300009093 Bacteria 29855
40 Ga0105240_10023626 3300009093 Bacteria 8121
41 Ga0105240_10026781 3300009093 Bacteria 7562
42 Ga0105240_10090498 3300009093 Bacteria 3739
43 Ga0105240_10230018 3300009093 Bacteria 2155
44 Ga0105242_10001161 3300009176 Bacteria 20740
45 Ga0105237_10001113 3300009545 Bacteria 35975
46 Ga0105237_10001298 3300009545 Bacteria 33267
47 Ga0105237_10012392 3300009545 Bacteria 8987
48 Ga0105237_10141629 3300009545 Bacteria 2399
49 Ga0105238_10052713 3300009551 Bacteria 4089
50 Ga0105238_10098772 3300009551 Bacteria 2903
51 Ga0105238_10844637 3300009551 Bacteria 933
52 Ga0105249_10164283 3300009553 Unclassified 2148
53 Ga0105239_10001497 3300010375 Bacteria 31050
54 Ga0105239_10003418 3300010375 Bacteria 19466
55 Ga0105239_10062274 3300010375 Bacteria 4095
56 Ga0105239_10201244 3300010375 Unclassified 2231
57 Ga0105246_10076832 3300011119 Bacteria 2367
58 Ga0157373_10012483 3300013100 Bacteria 6243
59 Ga0157373_10018279 3300013100 Bacteria 5105
60 Ga0157373_10058845 3300013100 Bacteria 2723
61 Ga0157371_10000283 3300013102 Bacteria 68598
62 Ga0157371_10000350 3300013102 Bacteria 59321
63 Ga0157371_10002692 3300013102 Bacteria 16784
64 Ga0157371_10020163 3300013102 Bacteria 4907
65 Ga0157370_10009497 3300013104 Bacteria 10380
66 Ga0157370_10063924 3300013104 Bacteria 3485
67 Ga0157370_10442030 3300013104 Bacteria 1196
68 Ga0157370_10875954 3300013104 Bacteria 815
69 Ga0157369_10022749 3300013105 Bacteria 6989
70 Ga0157369_10066591 3300013105 Bacteria 3874
71 Ga0157369_10300745 3300013105 Bacteria 1669
72 Ga0157374_10000003 3300013296 Bacteria 854471
73 Ga0157374_10149874 3300013296 Bacteria 2267
74 Ga0163162_10001993 3300013306 Bacteria 19205
75 Ga0157372_10000250 3300013307 Bacteria 59465
76 Ga0157372_10001956 3300013307 Bacteria 22388
77 Ga0157372_10486223 3300013307 Bacteria 1439
78 Ga0157372_10754116 3300013307 Bacteria 1132
79 Ga0157375_10000223 3300013308 Bacteria 53476
80 Ga0157375_10003047 3300013308 Bacteria 14551
81 Ga0163163_10075683 3300014325 Unclassified 3360
82 Ga0157376_10003576 3300014969 Bacteria 10718
83 Ga0182006_1014277 3300015261 Bacteria 3427
84 Ga0182007_10001148 3300015262 Bacteria 14345
85 Ga0163161_10000348 3300017792 Bacteria 39127
86 Ga0163161_10023913 3300017792 Bacteria 4312
87 Ga0206352_10997761 3300020078 Bacteria 1655
88 Ga0209673_1007710 3300025273 Bacteria 4902
89 Ga0209564_1001824 3300025295 Bacteria 19546
90 Ga0209758_1002965 3300025297 Bacteria 16274
91 Ga0209050_1000789 3300025298 Bacteria 44988
92 Ga0207426_1001766 3300025302 Bacteria 16358
93 Ga0209051_1027265 3300025303 Bacteria 2280
94 Ga0209257_1006533 3300025304 Bacteria 7450
95 Ga0207655_1000487 3300025728 Bacteria 51198
96 Ga0207680_10121483 3300025903 Bacteria 1709
97 Ga0207647_10019254 3300025904 Bacteria 4593
98 Ga0207695_10000245 3300025913 Bacteria 141090
99 Ga0207695_10000462 3300025913 Bacteria 88318
100 Ga0207695_10001603 3300025913 Bacteria 36738
101 Ga0207695_10100976 3300025913 Bacteria 2880
102 Ga0207695_10106890 3300025913 Bacteria 2784
103 Ga0207695_10142796 3300025913 Bacteria 2341
104 Ga0207671_10000034 3300025914 Bacteria 245048
105 Ga0207671_10002265 3300025914 Bacteria 20812
106 Ga0207649_10000006 3300025920 Bacteria 349180
107 Ga0207694_10407170 3300025924 Bacteria 1131
108 Ga0207694_10410182 3300025924 Bacteria 1127
109 Ga0207694_10703007 3300025924 Bacteria 852
110 Ga0207661_10055566 3300025944 Bacteria 3176
111 Ga0207679_10000010 3300025945 Bacteria 349180
112 Ga0207667_10000419 3300025949 Bacteria 57239
113 Ga0207667_10051569 3300025949 Unclassified 4337
114 Ga0207640_10003632 3300025981 Bacteria 8325
115 Ga0207677_10083817 3300026023 Bacteria 2296
116 Ga0207639_10008615 3300026041 Bacteria 6998
117 Ga0207639_10150666 3300026041 Bacteria 1948
118 Ga0207702_10218267 3300026078 Bacteria 1776
119 Ga0207698_10001880 3300026142 Bacteria 12283
120 Ga0207698_10122623 3300026142 Bacteria 2203
121 Ga0268264_10000064 3300028381 Bacteria 301274
122 Ga0268264_10174310 3300028381 Bacteria 1948
123 Ga0307517_10001736 3300028786 Bacteria 35923
124 Ga0307515_10000002 3300028794 Bacteria 1231751
125 Ga0307511_10024358 3300030521 Bacteria 5611
126 Ga0316182_1427766 3300030745 Unclassified 1061
127 Ga0265327_10000701 3300031251 Bacteria 53104
128 Ga0307509_10122435 3300031507 Bacteria 2575
129 Ga0307408_100005619 3300031548 Bacteria 8384
130 Ga0307408_100010275 3300031548 Bacteria 6174
131 Ga0307516_10000862 3300031730 Bacteria 41576
132 Ga0307516_10097297 3300031730 Bacteria 2763
133 Ga0307405_10212224 3300031731 Unclassified 1414
134 Ga0307412_10090355 3300031911 Bacteria 2140
135 Ga0307412_10149124 3300031911 Bacteria 1723
136 Ga0307416_100066835 3300032002 Bacteria 2962
137 Ga0307510_10001416 3300033180 Bacteria 26333
138 Ga0439466_0042305 3300041411 Bacteria 1517
139 Ga0451789_0967675 3300041443 Bacteria 804
140 Ga0439432_027978 3300042006 Bacteria 1838
141 Ga0439463_000879 3300042016 Bacteria 8278
142 Ga0439464_0000378 3300042439 Bacteria 8722
143 Ga0439464_0037351 3300042439 Bacteria 1377
144 Ga0466972_0001142 3300044658 Bacteria 12720
145 Ga0466965_0020376 3300044683 Bacteria 3187
146 Ga0466961_0049434 3300044693 Bacteria 2688
147 Ga0466971_0074493 3300044719 Bacteria 1543
148 Ga0466970_0024897 3300044765 Bacteria 3131
149 Ga0466959_0029437 3300045049 Bacteria 4068
150 Ga0466958_0064951 3300045836 Bacteria 2227
151 Ga0495638_0151600 3300046460 Bacteria 1344
152 Ga0495648_0006935 3300046524 Bacteria 9135
153 Ga0495633_0000472 3300046558 Bacteria 40822
154 Ga0495687_000158 3300047443 Bacteria 103129
155 Ga0495686_0000039 3300047472 Bacteria 304821
156 Ga0496103_0002474 3300048906 Bacteria 11583
157 Ga0496114_0043039 3300048917 Bacteria 3745
158 Ga0496115_0310555 3300048918 Unclassified 1291
159 Ga0496122_0192996 3300048925 Bacteria 1200
160 Ga0496122_0380168 3300048925 Bacteria 725
161 Ga0496125_0003612 3300048928 Bacteria 18576
162 Ga0496125_0042649 3300048928 Bacteria 3861
163 Ga0501306_003198 3300049127 Unclassified 1746
164 Ga0501306_023849 3300049127 Bacteria 871
165 Ga0501308_003698 3300049128 Unclassified 1433
166 Ga0501310_007451 3300049130 Bacteria 1169
167 Ga0501305_010530 3300049161 Bacteria 1236
168 Ga0501307_006965 3300049162 Unclassified 1236
169 Ga0501311_007245 3300049527 Bacteria 1274
170 Ga0501312_039233 3300049528 Bacteria 769
171 Ga0501315_011880 3300049531 Bacteria 1070
172 Ga0501315_015190 3300049531 Unclassified 984
173 Ga0501316_003946 3300049532 Unclassified 1468
174 Ga0501320_008351 3300049536 Bacteria 1017
175 Ga0501321_016877 3300049537 Bacteria 873
176 Ga0501322_002926 3300049538 Unclassified 1079
177 Ga0501323_006810 3300049539 Unclassified 1287
178 Ga0501335_000526 3300049551 Bacteria 2501
179 Ga0501335_001431 3300049551 Bacteria 1830
180 Ga0501335_003526 3300049551 Unclassified 1329
181 Ga0501335_020224 3300049551 Bacteria 707
182 Ga0501240_000905 3300049673 Bacteria 2691
183 Ga0501225_0000231 3300049705 Bacteria 17496
184 nmdc:mga0k408_333160_c1 3300050493 Bacteria 905
185 Ga0500578_0000144 3300053086 Bacteria 85335
186 Ga0500642_0025877 3300053130 Bacteria 2389
187 Ga0500568_0011956 3300053139 Bacteria 4005
188 Ga0500616_0014943 3300053153 Bacteria 4450
189 Ga0500622_0000657 3300053156 Bacteria 30758
190 Ga0500622_0002440 3300053156 Bacteria 13425
191 Ga0500637_0291891 3300053178 Bacteria 893
192 Ga0466962_0021402 3300061719 Bacteria 3105

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049538 Ga0501322_002926 Ga0501322_002926_23_571 182
2 3300046524 Ga0495648_0006935 Ga0495648_0006935_6252_6830 184
3 3300053130 Ga0500642_0025877 Ga0500642_0025877_508_1086 184
4 3300053156 Ga0500622_0000657 Ga0500622_0000657_13971_14549 184
5 3300049127 Ga0501306_003198 Ga0501306_003198_59_640 193
6 3300049130 Ga0501310_007451 Ga0501310_007451_534_1115 193
7 3300049161 Ga0501305_010530 Ga0501305_010530_597_1178 193
8 3300049162 Ga0501307_006965 Ga0501307_006965_53_634 193
9 3300049527 Ga0501311_007245 Ga0501311_007245_59_640 193
10 3300049528 Ga0501312_039233 Ga0501312_039233_55_636 193
11 3300049531 Ga0501315_011880 Ga0501315_011880_433_1014 193
12 3300049532 Ga0501316_003946 Ga0501316_003946_834_1415 193
13 3300049537 Ga0501321_016877 Ga0501321_016877_56_637 193
14 3300049539 Ga0501323_006810 Ga0501323_006810_654_1235 193
15 3300049551 Ga0501335_001431 Ga0501335_001431_170_751 193
16 3300005563 Ga0068855_100001621 Ga0068855_10000162127 194
17 3300009093 Ga0105240_10002447 Ga0105240_100024474 194
18 3300013104 Ga0157370_10009497 Ga0157370_100094979 194
19 3300020078 Ga0206352_10997761 Ga0206352_109977612 194
20 3300025913 Ga0207695_10000245 Ga0207695_1000024531 194
21 3300025944 Ga0207661_10055566 Ga0207661_100555662 194
22 3300049551 Ga0501335_003526 Ga0501335_003526_43_627 194
23 3300046460 Ga0495638_0151600 Ga0495638_0151600_266_862 195
24 3300049705 Ga0501225_0000231 Ga0501225_0000231_2436_3023 195
25 3300050493 nmdc:mga0k408_333160_c1 nmdc:mga0k408_333160_c1_67_654 195
26 3300053086 Ga0500578_0000144 Ga0500578_0000144_69647_70234 195
27 3300053153 Ga0500616_0014943 Ga0500616_0014943_685_1272 195
28 3300044658 Ga0466972_0001142 Ga0466972_0001142_2000_2596 198
29 iso_pu_bacteria 2585428061 2587752982 205
30 iso_pu_bacteria 2585428183 2588212616 205
31 iso_pu_bacteria 2643221725 2644686026 205
32 iso_pu_bacteria 2919692658 2919692934 205
33 iso_pu_bacteria 2929239360 2929241925 205
34 iso_pu_bacteria 2599185179 2599451182 206
35 iso_pu_bacteria 2910245624 2910248170 206
36 iso_pu_bacteria 2919481497 2919482802 206
37 3300013102 Ga0157371_10020163 Ga0157371_100201632 208
38 3300013105 Ga0157369_10300745 Ga0157369_103007452 208
39 3300013307 Ga0157372_10000250 Ga0157372_1000025036 208
40 3300030745 Ga0316182_1427766 Ga0316182_14277662 208
41 3300031911 Ga0307412_10149124 Ga0307412_101491243 208
42 3300049127 Ga0501306_023849 Ga0501306_023849_235_861 208
43 3300003320 rootH2_10021402 rootH2_1002140238 209
44 3300003320 rootH2_10154240 rootH2_101542402 209
45 3300005338 Ga0068868_100022114 Ga0068868_1000221147 209
46 3300005341 Ga0070691_10011594 Ga0070691_100115944 209
47 3300005535 Ga0070684_100073342 Ga0070684_1000733423 209
48 3300005539 Ga0068853_100707739 Ga0068853_1007077391 209
49 3300005563 Ga0068855_100279576 Ga0068855_1002795762 209
50 3300005616 Ga0068852_100427629 Ga0068852_1004276291 209
51 3300005843 Ga0068860_100389751 Ga0068860_1003897512 209
52 3300013100 Ga0157373_10018279 Ga0157373_100182795 209
53 3300013296 Ga0157374_10000003 Ga0157374_1000000355 209
54 3300013308 Ga0157375_10000223 Ga0157375_1000022318 209
55 3300014325 Ga0163163_10075683 Ga0163163_100756834 209
56 3300014969 Ga0157376_10003576 Ga0157376_100035764 209
57 3300017792 Ga0163161_10000348 Ga0163161_1000034835 209
58 3300025913 Ga0207695_10100976 Ga0207695_101009762 209
59 3300025914 Ga0207671_10002265 Ga0207671_1000226511 209
60 3300025924 Ga0207694_10703007 Ga0207694_107030072 209
61 3300025949 Ga0207667_10051569 Ga0207667_100515693 209
62 3300026023 Ga0207677_10083817 Ga0207677_100838172 209
63 3300028381 Ga0268264_10174310 Ga0268264_101743103 209
64 3300031251 Ga0265327_10000701 Ga0265327_1000070123 209
65 3300031507 Ga0307509_10122435 Ga0307509_101224352 209
66 3300031548 Ga0307408_100005619 Ga0307408_1000056196 209
67 3300031548 Ga0307408_100010275 Ga0307408_1000102754 209
68 3300031730 Ga0307516_10097297 Ga0307516_100972973 209
69 3300031731 Ga0307405_10212224 Ga0307405_102122242 209
70 3300031911 Ga0307412_10090355 Ga0307412_100903551 209
71 3300032002 Ga0307416_100066835 Ga0307416_1000668353 209
72 3300033180 Ga0307510_10001416 Ga0307510_100014163 209
73 3300044693 Ga0466961_0049434 Ga0466961_0049434_822_1451 209
74 3300044719 Ga0466971_0074493 Ga0466971_0074493_342_971 209
75 3300044765 Ga0466970_0024897 Ga0466970_0024897_1835_2464 209
76 3300045049 Ga0466959_0029437 Ga0466959_0029437_1756_2385 209
77 3300045836 Ga0466958_0064951 Ga0466958_0064951_983_1612 209
78 3300047472 Ga0495686_0000039 Ga0495686_0000039_303006_303635 209
79 3300049128 Ga0501308_003698 Ga0501308_003698_11_640 209
80 3300049551 Ga0501335_020224 Ga0501335_020224_45_695 209
81 3300049673 Ga0501240_000905 Ga0501240_000905_876_1505 209
82 3300061719 Ga0466962_0021402 Ga0466962_0021402_1381_2010 209
83 3300005289 Ga0065704_10303443 Ga0065704_103034431 210
84 3300005335 Ga0070666_10037681 Ga0070666_100376813 210
85 3300005539 Ga0068853_100008582 Ga0068853_1000085829 210
86 3300005564 Ga0070664_100000088 Ga0070664_10000008829 210
87 3300005577 Ga0068857_100213475 Ga0068857_1002134752 210
88 3300005616 Ga0068852_100047689 Ga0068852_1000476895 210
89 3300005617 Ga0068859_100012902 Ga0068859_1000129028 210
90 3300005843 Ga0068860_100000006 Ga0068860_100000006100 210
91 3300005843 Ga0068860_100831920 Ga0068860_1008319202 210
92 3300006931 Ga0097620_100012902 Ga0097620_1000129028 210
93 3300009036 Ga0105244_10009681 Ga0105244_100096815 210
94 3300009093 Ga0105240_10000908 Ga0105240_1000090815 210
95 3300009093 Ga0105240_10001744 Ga0105240_1000174416 210
96 3300009093 Ga0105240_10023626 Ga0105240_100236264 210
97 3300009093 Ga0105240_10026781 Ga0105240_100267816 210
98 3300009176 Ga0105242_10001161 Ga0105242_100011617 210
99 3300009545 Ga0105237_10001113 Ga0105237_1000111320 210
100 3300009545 Ga0105237_10001298 Ga0105237_100012983 210
101 3300009545 Ga0105237_10012392 Ga0105237_100123921 210
102 3300009551 Ga0105238_10052713 Ga0105238_100527136 210
103 3300009551 Ga0105238_10098772 Ga0105238_100987723 210
104 3300009551 Ga0105238_10844637 Ga0105238_108446371 210
105 3300009553 Ga0105249_10164283 Ga0105249_101642832 210
106 3300010375 Ga0105239_10001497 Ga0105239_100014975 210
107 3300010375 Ga0105239_10003418 Ga0105239_100034184 210
108 3300010375 Ga0105239_10062274 Ga0105239_100622742 210
109 3300010375 Ga0105239_10201244 Ga0105239_102012444 210
110 3300011119 Ga0105246_10076832 Ga0105246_100768322 210
111 3300013100 Ga0157373_10012483 Ga0157373_100124833 210
112 3300013102 Ga0157371_10000350 Ga0157371_1000035057 210
113 3300013104 Ga0157370_10063924 Ga0157370_100639244 210
114 3300013104 Ga0157370_10442030 Ga0157370_104420301 210
115 3300013105 Ga0157369_10022749 Ga0157369_100227493 210
116 3300013296 Ga0157374_10149874 Ga0157374_101498743 210
117 3300013306 Ga0163162_10001993 Ga0163162_1000199313 210
118 3300013307 Ga0157372_10486223 Ga0157372_104862232 210
119 3300013308 Ga0157375_10003047 Ga0157375_100030475 210
120 3300015262 Ga0182007_10001148 Ga0182007_1000114813 210
121 3300017792 Ga0163161_10023913 Ga0163161_100239133 210
122 3300025728 Ga0207655_1000487 Ga0207655_100048712 210
123 3300025903 Ga0207680_10121483 Ga0207680_101214833 210
124 3300025913 Ga0207695_10000462 Ga0207695_1000046260 210
125 3300025913 Ga0207695_10001603 Ga0207695_1000160318 210
126 3300025913 Ga0207695_10106890 Ga0207695_101068902 210
127 3300025913 Ga0207695_10142796 Ga0207695_101427962 210
128 3300025914 Ga0207671_10000034 Ga0207671_1000003497 210
129 3300025920 Ga0207649_10000006 Ga0207649_10000006157 210
130 3300025924 Ga0207694_10410182 Ga0207694_104101822 210
131 3300025945 Ga0207679_10000010 Ga0207679_10000010157 210
132 3300026041 Ga0207639_10008615 Ga0207639_100086159 210
133 3300026142 Ga0207698_10122623 Ga0207698_101226231 210
134 3300028381 Ga0268264_10000064 Ga0268264_1000006494 210
135 3300028786 Ga0307517_10001736 Ga0307517_100017369 210
136 3300028794 Ga0307515_10000002 Ga0307515_10000002816 210
137 3300030521 Ga0307511_10024358 Ga0307511_100243583 210
138 3300031730 Ga0307516_10000862 Ga0307516_100008629 210
139 3300041443 Ga0451789_0967675 Ga0451789_0967675_40_678 210
140 3300042016 Ga0439463_000879 Ga0439463_000879_2405_3037 210
141 3300042439 Ga0439464_0037351 Ga0439464_0037351_356_988 210
142 3300044683 Ga0466965_0020376 Ga0466965_0020376_233_865 210
143 3300047443 Ga0495687_000158 Ga0495687_000158_96203_96835 210
144 3300048906 Ga0496103_0002474 Ga0496103_0002474_5217_5852 210
145 3300048917 Ga0496114_0043039 Ga0496114_0043039_1399_2088 210
146 3300048918 Ga0496115_0310555 Ga0496115_0310555_383_1021 210
147 3300048925 Ga0496122_0380168 Ga0496122_0380168_26_658 210
148 3300048928 Ga0496125_0003612 Ga0496125_0003612_2559_3191 210
149 3300048928 Ga0496125_0042649 Ga0496125_0042649_3069_3701 210
150 3300049531 Ga0501315_015190 Ga0501315_015190_284_916 210
151 3300049536 Ga0501320_008351 Ga0501320_008351_363_995 210
152 3300049551 Ga0501335_000526 Ga0501335_000526_671_1303 210
153 3300053139 Ga0500568_0011956 Ga0500568_0011956_301_933 210
154 3300001979 JGI24740J21852_10002786 JGI24740J21852_100027862 211
155 3300003215 JGI25153J46596_10021649 JGI25153J46596_100216494 211
156 3300003323 rootH1_10174188 rootH1_101741881 211
157 3300003354 JGI25160J50197_1001637 JGI25160J50197_100163712 211
158 3300003771 Ga0055526_1008372 Ga0055526_10083722 211
159 3300003790 Ga0055528_1000154 Ga0055528_100015430 211
160 3300003791 Ga0055530_10001127 Ga0055530_1000112713 211
161 3300004625 Ga0055543_1003803 Ga0055543_10038031 211
162 3300005262 Ga0065165_1000328 Ga0065165_100032856 211
163 3300005458 Ga0070681_10007437 Ga0070681_100074378 211
164 3300005539 Ga0068853_100192024 Ga0068853_1001920241 211
165 3300005563 Ga0068855_100003329 Ga0068855_1000033293 211
166 3300005577 Ga0068857_100136878 Ga0068857_1001368782 211
167 3300005616 Ga0068852_100000263 Ga0068852_10000026317 211
168 3300006195 Ga0075366_10125461 Ga0075366_101254612 211
169 3300009093 Ga0105240_10090498 Ga0105240_100904982 211
170 3300009093 Ga0105240_10230018 Ga0105240_102300182 211
171 3300009545 Ga0105237_10141629 Ga0105237_101416292 211
172 3300013100 Ga0157373_10058845 Ga0157373_100588452 211
173 3300013102 Ga0157371_10000283 Ga0157371_1000028314 211
174 3300013102 Ga0157371_10002692 Ga0157371_100026927 211
175 3300013104 Ga0157370_10875954 Ga0157370_108759542 211
176 3300013105 Ga0157369_10066591 Ga0157369_100665913 211
177 3300013307 Ga0157372_10001956 Ga0157372_100019563 211
178 3300013307 Ga0157372_10754116 Ga0157372_107541162 211
179 3300015261 Ga0182006_1014277 Ga0182006_10142772 211
180 3300025273 Ga0209673_1007710 Ga0209673_10077104 211
181 3300025295 Ga0209564_1001824 Ga0209564_100182417 211
182 3300025297 Ga0209758_1002965 Ga0209758_10029658 211
183 3300025298 Ga0209050_1000789 Ga0209050_100078932 211
184 3300025302 Ga0207426_1001766 Ga0207426_100176613 211
185 3300025303 Ga0209051_1027265 Ga0209051_10272652 211
186 3300025304 Ga0209257_1006533 Ga0209257_10065339 211
187 3300025904 Ga0207647_10019254 Ga0207647_100192543 211
188 3300025924 Ga0207694_10407170 Ga0207694_104071701 211
189 3300025949 Ga0207667_10000419 Ga0207667_1000041936 211
190 3300025981 Ga0207640_10003632 Ga0207640_100036326 211
191 3300026041 Ga0207639_10150666 Ga0207639_101506662 211
192 3300026078 Ga0207702_10218267 Ga0207702_102182673 211
193 3300026142 Ga0207698_10001880 Ga0207698_100018803 211
194 3300041411 Ga0439466_0042305 Ga0439466_0042305_123_770 211
195 3300042006 Ga0439432_027978 Ga0439432_027978_519_1178 211
196 3300042439 Ga0439464_0000378 Ga0439464_0000378_2156_2803 211
197 3300046558 Ga0495633_0000472 Ga0495633_0000472_6016_6654 211
198 3300048925 Ga0496122_0192996 Ga0496122_0192996_137_784 211
199 3300053156 Ga0500622_0002440 Ga0500622_0002440_10119_10754 211
200 3300053178 Ga0500637_0291891 Ga0500637_0291891_34_702 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

43

220

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3of4-assembly2.cif.gz_C-2 crystal structure of a fmn/fad- and nad(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution 0.9467 2 210
3of4-assembly2.cif.gz_C-2 crystal structure of a fmn/fad- and nad(p)h-dependent nitroreductase (nfnb, il2077) from idiomarina loihiensis l2tr at 1.90 a resolution 0.9424 2 210
6czp-assembly1.cif.gz_A 2.2 angstrom resolution crystal structure oxygen-insensitive nad(p)h-dependent nitroreductase nfsb from vibrio vulnificus in complex with fmn 0.9293 4 210
8og3-assembly1.cif.gz_A e. coli nfsb triple mutant t41l/n71s/f124t bound to citrate 0.9268 4 210
1nec-assembly1.cif.gz_A nitroreductase from enterobacter cloacae 0.9267 4 210
ID Description Score Start End Superfamily
3of4C00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9458 4 210 3.40.109.10
3of4C00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.937 4 210 3.40.109.10
1vfrA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9264 1 210 3.40.109.10
1vfrA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.918 1 210 3.40.109.10
1icvD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9067 4 210 3.40.109.10
ID Description Score Start End GO Terms
AF-C6W2Q5-F1-model_v4 Nitroreductase 0.9846 1 210 GO:0016491
AF-A0A226HHD5-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9817 2 211 GO:0016491
AF-A0A2G4HZL3-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9816 4 210 GO:0016491
AF-A0A5S9QQA7-F1-model_v4 deleted 0.9805 4 211
AF-A0A7K0FVN6-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9794 2 211 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.65 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map