F307012

General Info

Members Datasets Scaffolds Average Seq Length
200 125 400 372

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100065169|Ga0075429_1000651691
Length 398
Sequence MRNRIQHLRRDERGMSFVFVGVGLTAFLAATTLAIDVGMFMNARTQAQNSADAGALAGVTALYFNDWNNRSAGGPAVSSAIDAAKHNQVIFKSPVVDPSDVTFPLSPEGLSNRVAVNVFRTSARNDGAGNSSAVPTLMGKLFGVNTVDITATATAEATPANGMTCVKPFMIPDKWEERQTPPWDSTDTFEAFDNKGNLLPDRDWYVPARNCPTCKDNPAYTGYSVNKDKGTRLILRAGTGGNIRPSFYYSWKMPGEIGGDFYRENIANCNQSIVQWNDPMIQEPGDKMGPTIQGVQDLIDKDPTATWDTGCKCVKSTYQGQSPRVFPIPLYDPMYYAEGKANGRPADFKVANFLGFFAEYISGNEIFGYITTVTGIVVPNGGTTVPVAMFPVAIRLVQ

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 30

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100065169 3300006880 Bacteria 3171
2 Ga0065704_10087733 3300005289 Bacteria 2999
3 Ga0065712_10073682 3300005290 Bacteria 4309
4 Ga0065712_10082651 3300005290 Bacteria 2897
5 Ga0065707_10135692 3300005295 Unclassified 1845
6 Ga0070676_10061789 3300005328 Unclassified 2227
7 Ga0070683_100044832 3300005329 Bacteria 4080
8 Ga0070690_100027675 3300005330 Bacteria 3505
9 Ga0070677_10022157 3300005333 Unclassified 2337
10 Ga0070677_10030634 3300005333 Bacteria 2049
11 Ga0070687_100001708 3300005343 Bacteria 7884
12 Ga0070669_100063739 3300005353 Unclassified 2713
13 Ga0070669_100122444 3300005353 Unclassified 1986
14 Ga0070675_100109669 3300005354 Bacteria 2333
15 Ga0070675_100181221 3300005354 Bacteria 1821
16 Ga0070671_100006856 3300005355 Bacteria 9119
17 Ga0070674_100034765 3300005356 Unclassified 3369
18 Ga0070673_100009376 3300005364 Bacteria 6568
19 Ga0070673_100043590 3300005364 Bacteria 3468
20 Ga0070673_100201825 3300005364 Bacteria 1713
21 Ga0070688_100093812 3300005365 Bacteria 1966
22 Ga0070709_10188512 3300005434 Bacteria 1453
23 Ga0070713_100149114 3300005436 Bacteria 2079
24 Ga0070705_100083677 3300005440 Bacteria 1967
25 Ga0070678_100050811 3300005456 Bacteria 3002
26 Ga0070678_100050971 3300005456 Unclassified 2997
27 Ga0070662_100088001 3300005457 Bacteria 2327
28 Ga0070662_100148150 3300005457 Unclassified 1824
29 Ga0070681_10051144 3300005458 Bacteria 4122
30 Ga0068867_100087799 3300005459 Unclassified 2355
31 Ga0070685_10211971 3300005466 Bacteria 1265
32 Ga0070707_100084136 3300005468 Bacteria 3074
33 Ga0070699_100026132 3300005518 Bacteria 5036
34 Ga0070686_100094417 3300005544 Bacteria 2007
35 Ga0070665_100080398 3300005548 Unclassified 3265
36 Ga0070665_100269083 3300005548 Unclassified 1706
37 Ga0070704_100083954 3300005549 Bacteria 2353
38 Ga0070664_100007886 3300005564 Bacteria 8602
39 Ga0070664_100133196 3300005564 Bacteria 2184
40 Ga0068857_100142529 3300005577 Bacteria 2167
41 Ga0068859_100072040 3300005617 Bacteria 3491
42 Ga0068859_100203267 3300005617 Unclassified 2066
43 Ga0068864_100061930 3300005618 Unclassified 3241
44 Ga0068864_100079549 3300005618 Bacteria 2870
45 Ga0068864_100126496 3300005618 Unclassified 2291
46 Ga0068870_10037778 3300005840 Unclassified 2490
47 Ga0068858_100103800 3300005842 Bacteria 2652
48 Ga0081455_10092481 3300005937 Bacteria 2447
49 Ga0097621_100011742 3300006237 Bacteria 6468
50 Ga0075428_100001764 3300006844 Bacteria 23092
51 Ga0075428_100001890 3300006844 Bacteria 22472
52 Ga0075428_100066958 3300006844 Bacteria 3932
53 Ga0075428_100331106 3300006844 Bacteria 1636
54 Ga0075430_100000262 3300006846 Bacteria 36942
55 Ga0075431_100000517 3300006847 Bacteria 32332
56 Ga0075431_100253063 3300006847 Unclassified 1789
57 Ga0075431_100290801 3300006847 Bacteria 1653
58 Ga0075433_10001213 3300006852 Bacteria 18802
59 Ga0075434_100032323 3300006871 Bacteria 5160
60 Ga0075434_100138871 3300006871 Unclassified 2450
61 Ga0075429_100029902 3300006880 Unclassified 4731
62 Ga0075429_100064742 3300006880 Bacteria 3184
63 Ga0075429_100179075 3300006880 Bacteria 1858
64 Ga0068865_100080160 3300006881 Unclassified 2340
65 Ga0075436_100021111 3300006914 Bacteria 4468
66 Ga0075436_100055855 3300006914 Unclassified 2727
67 Ga0097620_100072043 3300006931 Bacteria 3491
68 Ga0097620_100203263 3300006931 Unclassified 2066
69 Ga0075435_100001163 3300007076 Bacteria 16812
70 Ga0075435_100050613 3300007076 Unclassified 3344
71 Ga0111539_10181444 3300009094 Unclassified 2458
72 Ga0111539_10552699 3300009094 Unclassified 1341
73 Ga0105245_10119861 3300009098 Unclassified 2457
74 Ga0105247_10001119 3300009101 Bacteria 19989
75 Ga0114129_10002879 3300009147 Bacteria 24086
76 Ga0114129_10010673 3300009147 Bacteria 13100
77 Ga0114129_10043734 3300009147 Bacteria 6302
78 Ga0105243_10059421 3300009148 Unclassified 3051
79 Ga0105242_10027384 3300009176 Unclassified 4525
80 Ga0105248_10002081 3300009177 Bacteria 22128
81 Ga0105248_10026668 3300009177 Bacteria 6425
82 Ga0105248_10143041 3300009177 Unclassified 2698
83 Ga0105248_10176414 3300009177 Unclassified 2408
84 Ga0105249_10010840 3300009553 Bacteria 8009
85 Ga0157378_10088609 3300013297 Unclassified 2809
86 Ga0163162_10249114 3300013306 Unclassified 1908
87 Ga0163162_10282793 3300013306 Unclassified 1791
88 Ga0163162_10380233 3300013306 Bacteria 1545
89 Ga0157375_10020139 3300013308 Bacteria 6089
90 Ga0157375_10145531 3300013308 Bacteria 2500
91 Ga0157375_10266125 3300013308 Bacteria 1876
92 Ga0163163_10001048 3300014325 Bacteria 23404
93 Ga0163163_10020310 3300014325 Bacteria 6252
94 Ga0163163_10062285 3300014325 Bacteria 3696
95 Ga0157380_10001788 3300014326 Bacteria 14197
96 Ga0157380_10145130 3300014326 Unclassified 2044
97 Ga0157380_10183771 3300014326 Unclassified 1839
98 Ga0157379_10098621 3300014968 Bacteria 2623
99 Ga0163161_10004534 3300017792 Bacteria 9666
100 Ga0163161_10016006 3300017792 Bacteria 5234
101 Ga0207697_10079112 3300025315 Unclassified 1384
102 Ga0207682_10001500 3300025893 Bacteria 10777
103 Ga0207682_10006171 3300025893 Bacteria 4844
104 Ga0207688_10000543 3300025901 Bacteria 18375
105 Ga0207688_10005890 3300025901 Bacteria 6673
106 Ga0207680_10055688 3300025903 Unclassified 2384
107 Ga0207645_10001978 3300025907 Bacteria 16464
108 Ga0207645_10039082 3300025907 Unclassified 3041
109 Ga0207645_10074285 3300025907 Unclassified 2176
110 Ga0207643_10003962 3300025908 Bacteria 7971
111 Ga0207662_10000756 3300025918 Bacteria 14817
112 Ga0207681_10024151 3300025923 Bacteria 3898
113 Ga0207681_10111575 3300025923 Unclassified 1990
114 Ga0207659_10016543 3300025926 Unclassified 4801
115 Ga0207659_10043524 3300025926 Unclassified 3154
116 Ga0207659_10080676 3300025926 Bacteria 2404
117 Ga0207687_10131933 3300025927 Unclassified 1884
118 Ga0207687_10203210 3300025927 Bacteria 1550
119 Ga0207664_10048650 3300025929 Bacteria 3335
120 Ga0207644_10073091 3300025931 Bacteria 2513
121 Ga0207706_10018886 3300025933 Bacteria 6200
122 Ga0207706_10101395 3300025933 Unclassified 2533
123 Ga0207670_10068698 3300025936 Unclassified 2442
124 Ga0207670_10101555 3300025936 Bacteria 2055
125 Ga0207670_10198114 3300025936 Bacteria 1524
126 Ga0207704_10031421 3300025938 Unclassified 2991
127 Ga0207704_10062188 3300025938 Unclassified 2320
128 Ga0207691_10014125 3300025940 Bacteria 7618
129 Ga0207691_10102899 3300025940 Unclassified 2547
130 Ga0207711_10009604 3300025941 Bacteria 8065
131 Ga0207689_10001150 3300025942 Bacteria 25470
132 Ga0207679_10027936 3300025945 Bacteria 3908
133 Ga0207651_10058202 3300025960 Unclassified 2670
134 Ga0207651_10115769 3300025960 Bacteria 2022
135 Ga0207712_10043347 3300025961 Bacteria 3103
136 Ga0207658_10081100 3300025986 Unclassified 2487
137 Ga0207677_10207427 3300026023 Bacteria 1562
138 Ga0207703_10033350 3300026035 Bacteria 4081
139 Ga0207703_10057230 3300026035 Bacteria 3178
140 Ga0207703_10090271 3300026035 Bacteria 2575
141 Ga0207641_10025655 3300026088 Unclassified 4859
142 Ga0207641_10035199 3300026088 Bacteria 4170
143 Ga0207648_10089700 3300026089 Unclassified 2686
144 Ga0207674_10182569 3300026116 Unclassified 2049
145 Ga0207674_10297210 3300026116 Bacteria 1564
146 Ga0207675_100006207 3300026118 Bacteria 11348
147 Ga0207675_100014403 3300026118 Bacteria 7372
148 Ga0207683_10002309 3300026121 Bacteria 16723
149 Ga0207683_10013018 3300026121 Bacteria 7101
150 Ga0268265_10069448 3300028380 Bacteria 2736
151 Ga0307409_100075170 3300031995 Bacteria 2704
152 Ga0307416_100004114 3300032002 Bacteria 8708
153 Ga0307416_100028815 3300032002 Bacteria 4137
154 Ga0307416_100338391 3300032002 Bacteria 1516
155 Ga0373937_0143759 3300036401 Bacteria 2232
156 Ga0439450_018630 3300042008 Bacteria 1461
157 Ga0439464_0006285 3300042439 Unclassified 3092
158 Ga0453683_0242283 3300044673 Unclassified 1149
159 Ga0466967_0334004 3300045976 Bacteria 1464
160 Ga0495584_0025907 3300046491 Bacteria 2972
161 Ga0495598_0003331 3300046537 Bacteria 3402
162 Ga0495645_0007627 3300046543 Bacteria 7528
163 Ga0495633_0059995 3300046558 Bacteria 1783
164 Ga0495659_0077966 3300046664 Bacteria 1252
165 Ga0495647_0026371 3300046681 Unclassified 2129
166 Ga0495658_0024489 3300046683 Bacteria 3216
167 Ga0495669_0009686 3300046684 Bacteria 4066
168 Ga0496104_0188309 3300048907 Bacteria 1974
169 Ga0496105_0006404 3300048908 Bacteria 9049
170 Ga0496106_0226715 3300048909 Bacteria 1491
171 Ga0496108_0031733 3300048911 Bacteria 4385
172 Ga0496109_0252392 3300048912 Bacteria 1661
173 Ga0496109_0350075 3300048912 Unclassified 1396
174 Ga0496112_0001479 3300048915 Bacteria 18055
175 Ga0496114_0009075 3300048917 Bacteria 7887
176 Ga0496114_0012263 3300048917 Bacteria 6859
177 Ga0496115_0103376 3300048918 Unclassified 2337
178 nmdc:mga05p37_222635_c1 3300050507 Bacteria 2276
179 nmdc:mga05p37_305179_c1 3300050507 Bacteria 1889
180 nmdc:mga05p37_44814_c1 3300050507 Bacteria 5441
181 nmdc:mga05p37_9128_c1 3300050507 Bacteria 11722
182 nmdc:mga09592_118884_c1 3300050508 Unclassified 2268
183 nmdc:mga09592_1618_c1 3300050508 Bacteria 18121
184 nmdc:mga09592_168001_c1 3300050508 Bacteria 1896
185 nmdc:mga09592_6503_c1 3300050508 Bacteria 9520
186 nmdc:mga0qj67_258_c1 3300050509 Bacteria 36243
187 nmdc:mga06r32_1786_c1 3300050510 Bacteria 19309
188 nmdc:mga06r32_48176_c1 3300050510 Bacteria 4073
189 nmdc:mga08y16_170440_c1 3300050511 Unclassified 2261
190 nmdc:mga08y16_317008_c1 3300050511 Bacteria 1606
191 nmdc:mga0n895_24781_c1 3300050512 Bacteria 5659
192 nmdc:mga0n895_49747_c1 3300050512 Bacteria 4108
193 nmdc:mga0n895_8256_c1 3300050512 Bacteria 9006
194 nmdc:mga0rr50_30649_c1 3300050513 Bacteria 3811
195 nmdc:mga0rr50_5261_c1 3300050513 Bacteria 7699
196 nmdc:mga08x19_27376_c1 3300050514 Unclassified 3565
197 nmdc:mga0a205_1204_c1 3300050515 Bacteria 9014
198 Ga0495595_0037654 3300053084 Bacteria 2200
199 Ga0495619_0004315 3300053085 Bacteria 9073
200 Ga0590077_018293 3300059426 Bacteria 1479
201 Ga0075429_100065169
202 Ga0065704_10087733
203 Ga0065712_10073682
204 Ga0065712_10082651
205 Ga0065707_10135692
206 Ga0070676_10061789
207 Ga0070683_100044832
208 Ga0070690_100027675
209 Ga0070677_10022157
210 Ga0070677_10030634
211 Ga0070687_100001708
212 Ga0070669_100063739
213 Ga0070669_100122444
214 Ga0070675_100109669
215 Ga0070675_100181221
216 Ga0070671_100006856
217 Ga0070674_100034765
218 Ga0070673_100009376
219 Ga0070673_100043590
220 Ga0070673_100201825
221 Ga0070688_100093812
222 Ga0070709_10188512
223 Ga0070713_100149114
224 Ga0070705_100083677
225 Ga0070678_100050811
226 Ga0070678_100050971
227 Ga0070662_100088001
228 Ga0070662_100148150
229 Ga0070681_10051144
230 Ga0068867_100087799
231 Ga0070685_10211971
232 Ga0070707_100084136
233 Ga0070699_100026132
234 Ga0070686_100094417
235 Ga0070665_100080398
236 Ga0070665_100269083
237 Ga0070704_100083954
238 Ga0070664_100007886
239 Ga0070664_100133196
240 Ga0068857_100142529
241 Ga0068859_100072040
242 Ga0068859_100203267
243 Ga0068864_100061930
244 Ga0068864_100079549
245 Ga0068864_100126496
246 Ga0068870_10037778
247 Ga0068858_100103800
248 Ga0081455_10092481
249 Ga0097621_100011742
250 Ga0075428_100001764
251 Ga0075428_100001890
252 Ga0075428_100066958
253 Ga0075428_100331106
254 Ga0075430_100000262
255 Ga0075431_100000517
256 Ga0075431_100253063
257 Ga0075431_100290801
258 Ga0075433_10001213
259 Ga0075434_100032323
260 Ga0075434_100138871
261 Ga0075429_100029902
262 Ga0075429_100064742
263 Ga0075429_100179075
264 Ga0068865_100080160
265 Ga0075436_100021111
266 Ga0075436_100055855
267 Ga0097620_100072043
268 Ga0097620_100203263
269 Ga0075435_100001163
270 Ga0075435_100050613
271 Ga0111539_10181444
272 Ga0111539_10552699
273 Ga0105245_10119861
274 Ga0105247_10001119
275 Ga0114129_10002879
276 Ga0114129_10010673
277 Ga0114129_10043734
278 Ga0105243_10059421
279 Ga0105242_10027384
280 Ga0105248_10002081
281 Ga0105248_10026668
282 Ga0105248_10143041
283 Ga0105248_10176414
284 Ga0105249_10010840
285 Ga0157378_10088609
286 Ga0163162_10249114
287 Ga0163162_10282793
288 Ga0163162_10380233
289 Ga0157375_10020139
290 Ga0157375_10145531
291 Ga0157375_10266125
292 Ga0163163_10001048
293 Ga0163163_10020310
294 Ga0163163_10062285
295 Ga0157380_10001788
296 Ga0157380_10145130
297 Ga0157380_10183771
298 Ga0157379_10098621
299 Ga0163161_10004534
300 Ga0163161_10016006
301 Ga0207697_10079112
302 Ga0207682_10001500
303 Ga0207682_10006171
304 Ga0207688_10000543
305 Ga0207688_10005890
306 Ga0207680_10055688
307 Ga0207645_10001978
308 Ga0207645_10039082
309 Ga0207645_10074285
310 Ga0207643_10003962
311 Ga0207662_10000756
312 Ga0207681_10024151
313 Ga0207681_10111575
314 Ga0207659_10016543
315 Ga0207659_10043524
316 Ga0207659_10080676
317 Ga0207687_10131933
318 Ga0207687_10203210
319 Ga0207664_10048650
320 Ga0207644_10073091
321 Ga0207706_10018886
322 Ga0207706_10101395
323 Ga0207670_10068698
324 Ga0207670_10101555
325 Ga0207670_10198114
326 Ga0207704_10031421
327 Ga0207704_10062188
328 Ga0207691_10014125
329 Ga0207691_10102899
330 Ga0207711_10009604
331 Ga0207689_10001150
332 Ga0207679_10027936
333 Ga0207651_10058202
334 Ga0207651_10115769
335 Ga0207712_10043347
336 Ga0207658_10081100
337 Ga0207677_10207427
338 Ga0207703_10033350
339 Ga0207703_10057230
340 Ga0207703_10090271
341 Ga0207641_10025655
342 Ga0207641_10035199
343 Ga0207648_10089700
344 Ga0207674_10182569
345 Ga0207674_10297210
346 Ga0207675_100006207
347 Ga0207675_100014403
348 Ga0207683_10002309
349 Ga0207683_10013018
350 Ga0268265_10069448
351 Ga0307409_100075170
352 Ga0307416_100004114
353 Ga0307416_100028815
354 Ga0307416_100338391
355 Ga0373937_0143759
356 Ga0439450_018630
357 Ga0439464_0006285
358 Ga0453683_0242283
359 Ga0466967_0334004
360 Ga0495584_0025907
361 Ga0495598_0003331
362 Ga0495645_0007627
363 Ga0495633_0059995
364 Ga0495659_0077966
365 Ga0495647_0026371
366 Ga0495658_0024489
367 Ga0495669_0009686
368 Ga0496104_0188309
369 Ga0496105_0006404
370 Ga0496106_0226715
371 Ga0496108_0031733
372 Ga0496109_0252392
373 Ga0496109_0350075
374 Ga0496112_0001479
375 Ga0496114_0009075
376 Ga0496114_0012263
377 Ga0496115_0103376
378 nmdc:mga05p37_222635_c1
379 nmdc:mga05p37_305179_c1
380 nmdc:mga05p37_44814_c1
381 nmdc:mga05p37_9128_c1
382 nmdc:mga09592_118884_c1
383 nmdc:mga09592_1618_c1
384 nmdc:mga09592_168001_c1
385 nmdc:mga09592_6503_c1
386 nmdc:mga0qj67_258_c1
387 nmdc:mga06r32_1786_c1
388 nmdc:mga06r32_48176_c1
389 nmdc:mga08y16_170440_c1
390 nmdc:mga08y16_317008_c1
391 nmdc:mga0n895_24781_c1
392 nmdc:mga0n895_49747_c1
393 nmdc:mga0n895_8256_c1
394 nmdc:mga0rr50_30649_c1
395 nmdc:mga0rr50_5261_c1
396 nmdc:mga08x19_27376_c1
397 nmdc:mga0a205_1204_c1
398 Ga0495595_0037654
399 Ga0495619_0004315
400 Ga0590077_018293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13400

Tad

Putative Flp pilus-assembly TadE/G-like

14

61

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yng-assembly2.cif.gz_H twinned pyruvate kinase from e. coli in the t-state 0.911 328 344
8eq0-assembly1.cif.gz_B escherichia coli pyruvate kinase g381a 0.8995 328 344
4yng-assembly2.cif.gz_F twinned pyruvate kinase from e. coli in the t-state 0.893 328 344
8eq3-assembly1.cif.gz_B-2 escherichia coli pyruvate kinase a301t 0.8853 328 344
8edr-assembly1.cif.gz_A-2 e. coli pyruvate kinase (pykf) p70q 0.8846 328 344
ID Description Score Start End Superfamily
1e0uB03 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7853 326 344 2.40.33.10
5i7qA02 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7456 325 343 2.40.10.330
af_Q54SC0_1_67_2.40.240.20 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.7369 299 344 2.40.240.20
af_Q69WE5_8_94_2.40.33.10 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.6408 328 368 2.40.33.10
1vhyA01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.6007 301 345 2.40.240.20
ID Description Score Start End GO Terms
AF-A0A286RL45-F1-model_v4 Endoglucanase (EC 3.2.1.4) 0.8751 20 151 GO:0008810
AF-A0A1V5KJS4-F1-model_v4 Flp pilus-assembly TadG-like N-terminal domain-containing protein 0.8635 10 370 GO:0016020
AF-A0A832GDR7-F1-model_v4 Flp pilus-assembly TadG-like N-terminal domain-containing protein 0.8631 16 149
AF-A0A2V8BKV0-F1-model_v4 Putative Flp pilus-assembly TadG-like N-terminal domain-containing protein 0.8556 10 370
AF-A0A177R5D8-F1-model_v4 deleted 0.8541 13 146

Map