F306986

General Info

Members Datasets Scaffolds Average Seq Length
200 126 400 150

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100130073|Ga0068871_1001300734
Length 175
Sequence MGREGREPSVLILSLPKDENQQKEAVMSRAFVKETAESAPPPERMVDEGPNLVTPEGMTQIEAHIARIEASMKTETNVLLRETLARDLRYWEIRKSTAEVAPAPATDIVSFGSTVAIQRKSRTQTFRIVGVDEADASKGQISFRSPLAQAILGARPGDIIEAGEPLGEITIIKIS

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
123 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5
Nodule 0
Rhizoplane 0
Rhizosphere 92
Stem 0
Stem Tuber 0
Unclassified 13.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100130073 3300006358 Bacteria 2134
2 JGI25165J46597_1000017 3300003214 Bacteria 377013
3 JGI25153J46596_10000392 3300003215 Bacteria 29639
4 rootH2_10041435 3300003320 Bacteria 2290
5 Ga0070658_10084946 3300005327 Bacteria 2603
6 Ga0070658_10483103 3300005327 Bacteria 1069
7 Ga0070683_100051453 3300005329 Bacteria 3814
8 Ga0070670_100958662 3300005331 Unclassified 777
9 Ga0068869_100455365 3300005334 Bacteria 1061
10 Ga0068869_100978317 3300005334 Unclassified 736
11 Ga0068868_100305657 3300005338 Bacteria 1352
12 Ga0070671_101238427 3300005355 Bacteria 657
13 Ga0070674_101186780 3300005356 Bacteria 677
14 Ga0070673_100045567 3300005364 Bacteria 3401
15 Ga0070711_100094240 3300005439 Bacteria 2164
16 Ga0070663_100277167 3300005455 Bacteria 1335
17 Ga0070678_100533852 3300005456 Bacteria 1039
18 Ga0068867_100025201 3300005459 Bacteria 4267
19 Ga0068867_100051677 3300005459 Bacteria 3032
20 Ga0070679_101031069 3300005530 Bacteria 767
21 Ga0068853_102159872 3300005539 Unclassified 540
22 Ga0070672_101747655 3300005543 Unclassified 559
23 Ga0070693_100090267 3300005547 Bacteria 1846
24 Ga0070665_100073548 3300005548 Bacteria 3423
25 Ga0070665_100359886 3300005548 Bacteria 1461
26 Ga0070665_100735336 3300005548 Bacteria 1000
27 Ga0068855_101454890 3300005563 Bacteria 705
28 Ga0068857_100210866 3300005577 Bacteria 1773
29 Ga0068856_100253197 3300005614 Bacteria 1776
30 Ga0068863_100676108 3300005841 Unclassified 1025
31 Ga0081455_10507177 3300005937 Bacteria 808
32 Ga0075367_10855617 3300006178 Unclassified 580
33 Ga0097621_100005596 3300006237 Bacteria 8858
34 Ga0097621_100041922 3300006237 Bacteria 3686
35 Ga0097621_100116819 3300006237 Bacteria 2259
36 Ga0097621_100150088 3300006237 Bacteria 1998
37 Ga0097621_100298794 3300006237 Bacteria 1421
38 Ga0097621_100577894 3300006237 Unclassified 1025
39 Ga0068871_100008017 3300006358 Bacteria 7583
40 Ga0068871_100027101 3300006358 Bacteria 4479
41 Ga0068871_100283532 3300006358 Unclassified 1450
42 Ga0068865_100008345 3300006881 Bacteria 6401
43 Ga0105240_10172677 3300009093 Bacteria 2558
44 Ga0105240_10327021 3300009093 Bacteria 1746
45 Ga0105240_10387380 3300009093 Bacteria 1577
46 Ga0105240_11053081 3300009093 Bacteria 868
47 Ga0105245_10699687 3300009098 Unclassified 1047
48 Ga0105245_10943706 3300009098 Bacteria 905
49 Ga0105245_11201334 3300009098 Bacteria 806
50 Ga0105243_10000738 3300009148 Bacteria 31269
51 Ga0105243_12220157 3300009148 Unclassified 586
52 Ga0105242_10012018 3300009176 Bacteria 6665
53 Ga0105242_10433991 3300009176 Bacteria 1234
54 Ga0105248_10284074 3300009177 Unclassified 1863
55 Ga0105248_10379944 3300009177 Bacteria 1590
56 Ga0105237_10109305 3300009545 Bacteria 2757
57 Ga0105237_10244762 3300009545 Bacteria 1795
58 Ga0105237_10448994 3300009545 Bacteria 1295
59 Ga0105238_10276038 3300009551 Bacteria 1661
60 Ga0105249_10552052 3300009553 Bacteria 1203
61 Ga0105249_11906394 3300009553 Bacteria 667
62 Ga0157373_10935460 3300013100 Bacteria 644
63 Ga0157374_10195751 3300013296 Bacteria 1978
64 Ga0157374_10386715 3300013296 Bacteria 1394
65 Ga0157378_10058439 3300013297 Bacteria 3439
66 Ga0157378_10127570 3300013297 Bacteria 2352
67 Ga0157378_10978326 3300013297 Unclassified 880
68 Ga0157378_11085423 3300013297 Bacteria 837
69 Ga0163162_10023927 3300013306 Bacteria 6028
70 Ga0163162_10029306 3300013306 Bacteria 5447
71 Ga0157375_10014500 3300013308 Bacteria 7032
72 Ga0157375_10136235 3300013308 Bacteria 2579
73 Ga0157375_13289135 3300013308 Bacteria 539
74 Ga0163163_10000004 3300014325 Bacteria 416569
75 Ga0163163_10072268 3300014325 Bacteria 3439
76 Ga0157379_10330767 3300014968 Bacteria 1392
77 Ga0157376_10006132 3300014969 Bacteria 8464
78 Ga0157376_12012049 3300014969 Unclassified 615
79 Ga0163161_10008097 3300017792 Bacteria 7268
80 Ga0163161_11956540 3300017792 Unclassified 522
81 Ga0209233_1000006 3300025261 Bacteria 1473685
82 Ga0209758_1000008 3300025297 Bacteria 1215263
83 Ga0207705_10164713 3300025909 Bacteria 1667
84 Ga0207705_10356960 3300025909 Bacteria 1127
85 Ga0207707_10120209 3300025912 Bacteria 2296
86 Ga0207695_10016108 3300025913 Bacteria 8769
87 Ga0207695_10294485 3300025913 Bacteria 1515
88 Ga0207695_10835017 3300025913 Bacteria 801
89 Ga0207657_10010134 3300025919 Bacteria 9418
90 Ga0207652_10034829 3300025921 Bacteria 4246
91 Ga0207694_10030483 3300025924 Bacteria 4120
92 Ga0207694_10178816 3300025924 Bacteria 1720
93 Ga0207650_10747472 3300025925 Unclassified 827
94 Ga0207650_11748548 3300025925 Bacteria 527
95 Ga0207687_10630518 3300025927 Bacteria 905
96 Ga0207686_10312816 3300025934 Bacteria 1170
97 Ga0207669_10311536 3300025937 Bacteria 1201
98 Ga0207669_11003587 3300025937 Bacteria 701
99 Ga0207704_10029816 3300025938 Bacteria 3049
100 Ga0207689_10428513 3300025942 Bacteria 1104
101 Ga0207689_10752173 3300025942 Bacteria 822
102 Ga0207651_10191931 3300025960 Bacteria 1630
103 Ga0207712_10457657 3300025961 Bacteria 1083
104 Ga0207668_11291825 3300025972 Unclassified 657
105 Ga0207677_10279455 3300026023 Bacteria 1370
106 Ga0207678_10936399 3300026067 Unclassified 766
107 Ga0207678_10971784 3300026067 Bacteria 751
108 Ga0207702_10915514 3300026078 Bacteria 869
109 Ga0207641_11838381 3300026088 Unclassified 607
110 Ga0207648_10010704 3300026089 Bacteria 8667
111 Ga0207648_10371226 3300026089 Bacteria 1292
112 Ga0207648_11140624 3300026089 Bacteria 731
113 Ga0207683_10053280 3300026121 Bacteria 3547
114 Ga0207683_10203567 3300026121 Bacteria 1800
115 Ga0207698_10225843 3300026142 Bacteria 1696
116 Ga0268266_10238841 3300028379 Bacteria 1676
117 Ga0265318_10000972 3300028577 Bacteria 18388
118 Ga0265338_10043899 3300028800 Unclassified 4137
119 Ga0265332_10116766 3300031238 Bacteria 1122
120 Ga0265320_10308266 3300031240 Bacteria 700
121 Ga0265325_10032132 3300031241 Bacteria 2804
122 Ga0265325_10322635 3300031241 Unclassified 686
123 Ga0265339_10033319 3300031249 Bacteria 2901
124 Ga0265339_10167690 3300031249 Unclassified 1101
125 Ga0265331_10012974 3300031250 Bacteria 4492
126 Ga0265331_10022696 3300031250 Bacteria 3199
127 Ga0265331_10114818 3300031250 Bacteria 1233
128 Ga0265331_10154005 3300031250 Unclassified 1043
129 Ga0265327_10000052 3300031251 Bacteria 256602
130 Ga0265316_10039520 3300031344 Bacteria 3788
131 Ga0307513_10345532 3300031456 Bacteria 1237
132 Ga0265313_10016633 3300031595 Bacteria 4220
133 Ga0265313_10016818 3300031595 Unclassified 4192
134 Ga0265313_10147114 3300031595 Bacteria 1009
135 Ga0265314_10066752 3300031711 Bacteria 2425
136 Ga0265314_10132967 3300031711 Unclassified 1549
137 Ga0265314_10143465 3300031711 Bacteria 1473
138 Ga0265342_10064378 3300031712 Bacteria 2152
139 Ga0307516_10074270 3300031730 Bacteria 3256
140 Ga0307405_11934470 3300031731 Unclassified 527
141 Ga0395900_0681767 3300037418 Bacteria 962
142 Ga0395900_0739125 3300037418 Bacteria 915
143 Ga0395898_0184904 3300037466 Bacteria 1991
144 Ga0395901_0022145 3300038443 Bacteria 6511
145 Ga0436365_1028042 3300039437 Bacteria 941
146 Ga0436360_0190321 3300039438 Bacteria 939
147 Ga0495606_0097287 3300046507 Bacteria 1799
148 Ga0495622_0019583 3300046557 Bacteria 3150
149 Ga0495611_0097139 3300046648 Bacteria 1365
150 Ga0496120_0212520 3300048923 Bacteria 929
151 Ga0496121_0827976 3300048924 Unclassified 541
152 Ga0501031_0000701 3300049568 Bacteria 20005
153 Ga0501032_0035860 3300049569 Bacteria 3388
154 Ga0501032_0777497 3300049569 Bacteria 605
155 Ga0501033_0054808 3300049570 Bacteria 2948
156 Ga0501033_0132611 3300049570 Bacteria 1804
157 Ga0501033_0201489 3300049570 Bacteria 1421
158 Ga0501034_0022624 3300049571 Bacteria 6403
159 Ga0501034_0135379 3300049571 Bacteria 2444
160 Ga0501034_0149727 3300049571 Bacteria 2310
161 Ga0501036_0014613 3300049572 Bacteria 6539
162 Ga0501036_0504693 3300049572 Bacteria 1006
163 Ga0501037_0003841 3300049573 Bacteria 10906
164 Ga0501037_0562211 3300049573 Bacteria 769
165 Ga0501038_0026598 3300049574 Bacteria 5152
166 Ga0501038_0605630 3300049574 Bacteria 828
167 Ga0501039_0003532 3300049575 Bacteria 11711
168 Ga0501042_0286256 3300049578 Bacteria 1190
169 Ga0501043_0008447 3300049579 Bacteria 8106
170 Ga0501046_0007418 3300049580 Bacteria 9639
171 Ga0501046_0081231 3300049580 Bacteria 2504
172 Ga0501047_0000665 3300049581 Bacteria 35776
173 Ga0501047_0166346 3300049581 Bacteria 2075
174 Ga0501047_0251991 3300049581 Bacteria 1614
175 Ga0501067_0006946 3300049583 Bacteria 6283
176 Ga0501067_0556002 3300049583 Bacteria 643
177 Ga0501070_0010695 3300049586 Bacteria 7759
178 Ga0501071_0775027 3300049587 Bacteria 739
179 Ga0501073_0011322 3300049589 Bacteria 6525
180 Ga0501074_0012561 3300049590 Bacteria 6156
181 Ga0501076_0410324 3300049592 Bacteria 1114
182 Ga0501079_0025181 3300049741 Bacteria 4563
183 Ga0501080_0019075 3300049742 Bacteria 6350
184 Ga0501080_0699399 3300049742 Bacteria 894
185 Ga0501083_0002063 3300049744 Bacteria 13824
186 Ga0501083_0254019 3300049744 Bacteria 1144
187 Ga0501035_0048704 3300049822 Bacteria 3800
188 Ga0501035_0116543 3300049822 Bacteria 2337
189 Ga0501035_0548555 3300049822 Bacteria 947
190 Ga0501044_0023085 3300049823 Bacteria 6622
191 Ga0501044_0069028 3300049823 Bacteria 3599
192 Ga0501044_0175576 3300049823 Bacteria 2111
193 Ga0501044_0984279 3300049823 Bacteria 716
194 nmdc:mga06z11_562495_c1 3300050494 Unclassified 693
195 Ga0500644_0329144 3300053088 Bacteria 658
196 Ga0500592_038472 3300053116 Bacteria 773
197 Ga0500568_0188562 3300053139 Bacteria 757
198 Ga0500573_0000060 3300053140 Bacteria 68257
199 Ga0501084_0010685 3300054114 Bacteria 7598
200 Ga0501082_0004577 3300060353 Bacteria 12078
201 Ga0068871_100130073
202 JGI25165J46597_1000017
203 JGI25153J46596_10000392
204 rootH2_10041435
205 Ga0070658_10084946
206 Ga0070658_10483103
207 Ga0070683_100051453
208 Ga0070670_100958662
209 Ga0068869_100455365
210 Ga0068869_100978317
211 Ga0068868_100305657
212 Ga0070671_101238427
213 Ga0070674_101186780
214 Ga0070673_100045567
215 Ga0070711_100094240
216 Ga0070663_100277167
217 Ga0070678_100533852
218 Ga0068867_100025201
219 Ga0068867_100051677
220 Ga0070679_101031069
221 Ga0068853_102159872
222 Ga0070672_101747655
223 Ga0070693_100090267
224 Ga0070665_100073548
225 Ga0070665_100359886
226 Ga0070665_100735336
227 Ga0068855_101454890
228 Ga0068857_100210866
229 Ga0068856_100253197
230 Ga0068863_100676108
231 Ga0081455_10507177
232 Ga0075367_10855617
233 Ga0097621_100005596
234 Ga0097621_100041922
235 Ga0097621_100116819
236 Ga0097621_100150088
237 Ga0097621_100298794
238 Ga0097621_100577894
239 Ga0068871_100008017
240 Ga0068871_100027101
241 Ga0068871_100283532
242 Ga0068865_100008345
243 Ga0105240_10172677
244 Ga0105240_10327021
245 Ga0105240_10387380
246 Ga0105240_11053081
247 Ga0105245_10699687
248 Ga0105245_10943706
249 Ga0105245_11201334
250 Ga0105243_10000738
251 Ga0105243_12220157
252 Ga0105242_10012018
253 Ga0105242_10433991
254 Ga0105248_10284074
255 Ga0105248_10379944
256 Ga0105237_10109305
257 Ga0105237_10244762
258 Ga0105237_10448994
259 Ga0105238_10276038
260 Ga0105249_10552052
261 Ga0105249_11906394
262 Ga0157373_10935460
263 Ga0157374_10195751
264 Ga0157374_10386715
265 Ga0157378_10058439
266 Ga0157378_10127570
267 Ga0157378_10978326
268 Ga0157378_11085423
269 Ga0163162_10023927
270 Ga0163162_10029306
271 Ga0157375_10014500
272 Ga0157375_10136235
273 Ga0157375_13289135
274 Ga0163163_10000004
275 Ga0163163_10072268
276 Ga0157379_10330767
277 Ga0157376_10006132
278 Ga0157376_12012049
279 Ga0163161_10008097
280 Ga0163161_11956540
281 Ga0209233_1000006
282 Ga0209758_1000008
283 Ga0207705_10164713
284 Ga0207705_10356960
285 Ga0207707_10120209
286 Ga0207695_10016108
287 Ga0207695_10294485
288 Ga0207695_10835017
289 Ga0207657_10010134
290 Ga0207652_10034829
291 Ga0207694_10030483
292 Ga0207694_10178816
293 Ga0207650_10747472
294 Ga0207650_11748548
295 Ga0207687_10630518
296 Ga0207686_10312816
297 Ga0207669_10311536
298 Ga0207669_11003587
299 Ga0207704_10029816
300 Ga0207689_10428513
301 Ga0207689_10752173
302 Ga0207651_10191931
303 Ga0207712_10457657
304 Ga0207668_11291825
305 Ga0207677_10279455
306 Ga0207678_10936399
307 Ga0207678_10971784
308 Ga0207702_10915514
309 Ga0207641_11838381
310 Ga0207648_10010704
311 Ga0207648_10371226
312 Ga0207648_11140624
313 Ga0207683_10053280
314 Ga0207683_10203567
315 Ga0207698_10225843
316 Ga0268266_10238841
317 Ga0265318_10000972
318 Ga0265338_10043899
319 Ga0265332_10116766
320 Ga0265320_10308266
321 Ga0265325_10032132
322 Ga0265325_10322635
323 Ga0265339_10033319
324 Ga0265339_10167690
325 Ga0265331_10012974
326 Ga0265331_10022696
327 Ga0265331_10114818
328 Ga0265331_10154005
329 Ga0265327_10000052
330 Ga0265316_10039520
331 Ga0307513_10345532
332 Ga0265313_10016633
333 Ga0265313_10016818
334 Ga0265313_10147114
335 Ga0265314_10066752
336 Ga0265314_10132967
337 Ga0265314_10143465
338 Ga0265342_10064378
339 Ga0307516_10074270
340 Ga0307405_11934470
341 Ga0395900_0681767
342 Ga0395900_0739125
343 Ga0395898_0184904
344 Ga0395901_0022145
345 Ga0436365_1028042
346 Ga0436360_0190321
347 Ga0495606_0097287
348 Ga0495622_0019583
349 Ga0495611_0097139
350 Ga0496120_0212520
351 Ga0496121_0827976
352 Ga0501031_0000701
353 Ga0501032_0035860
354 Ga0501032_0777497
355 Ga0501033_0054808
356 Ga0501033_0132611
357 Ga0501033_0201489
358 Ga0501034_0022624
359 Ga0501034_0135379
360 Ga0501034_0149727
361 Ga0501036_0014613
362 Ga0501036_0504693
363 Ga0501037_0003841
364 Ga0501037_0562211
365 Ga0501038_0026598
366 Ga0501038_0605630
367 Ga0501039_0003532
368 Ga0501042_0286256
369 Ga0501043_0008447
370 Ga0501046_0007418
371 Ga0501046_0081231
372 Ga0501047_0000665
373 Ga0501047_0166346
374 Ga0501047_0251991
375 Ga0501067_0006946
376 Ga0501067_0556002
377 Ga0501070_0010695
378 Ga0501071_0775027
379 Ga0501073_0011322
380 Ga0501074_0012561
381 Ga0501076_0410324
382 Ga0501079_0025181
383 Ga0501080_0019075
384 Ga0501080_0699399
385 Ga0501083_0002063
386 Ga0501083_0254019
387 Ga0501035_0048704
388 Ga0501035_0116543
389 Ga0501035_0548555
390 Ga0501044_0023085
391 Ga0501044_0069028
392 Ga0501044_0175576
393 Ga0501044_0984279
394 nmdc:mga06z11_562495_c1
395 Ga0500644_0329144
396 Ga0500592_038472
397 Ga0500568_0188562
398 Ga0500573_0000060
399 Ga0501084_0010685
400 Ga0501082_0004577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

103

175

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iuh-assembly1.cif.gz_4 rna polymerase iii pre-initiation complex open complex 1 0.9942 32 70
2a26-assembly2.cif.gz_C crystal structure of the n-terminal, dimerization domain of siah interacting protein 0.9935 32 70
7f6j-assembly1.cif.gz_C crystal structure of the pdzd8 coiled-coil domain - rab7 complex 0.9933 30 70
2jgu-assembly1.cif.gz_A crystal structure of dna-directed dna polymerase 0.9861 29 69
8foj-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex in the post rna handoff state 0.986 32 71
ID Description Score Start End Superfamily
af_Q9CXW3_1_48_4.10.860.10 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;UVR domain 1.008 32 70 4.10.860.10
af_K7MJT1_34_182_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9996 32 66 1.20.140.40
af_Q9UTB2_49_154_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.9977 30 70 1.10.287.40
af_Q9W0N6_1_89_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.9976 30 70 1.20.58.400
2a26C01 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;UVR domain 0.9935 32 70 4.10.860.10
ID Description Score Start End GO Terms
AF-A0A1F7Z2X8-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.8812 82 149 GO:0003677
GO:0032784
AF-A0A1G1Y669-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.878 82 149 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-A0A1G1YQ82-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.8693 76 149 GO:0003677
GO:0032784
AF-A5ILE7-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.861 23 148 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-A0A6L7UXR0-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.8555 24 149 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063

Map