F306852

General Info

Members Datasets Scaffolds Average Seq Length
200 143 400 96

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100003990|Ga0070706_1000039907
Length 105
Sequence VTGVWVAVLVTAAGCYALKLTGLVVPKSVLASPRVRRFAGLVPVALLAALVAVQAFAAGRSLTVDPARLAGLGAAVAALVLRAPFLVVIVVAAGTAAVLRALGAA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
119 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
120 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
121 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
122 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
123 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
124 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
125 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
126 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
127 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
128 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
129 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
130 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
131 2867475112 Streptomyces sp. TM32 Isolate Unclassified
132 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
133 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
134 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
135 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
136 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
137 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
138 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
139 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
140 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
141 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
142 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
143 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.5
Metatranscriptomes 0
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12
Nodule 0.5
Rhizoplane 9
Rhizosphere 71.5
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100003990 3300005467 Bacteria 14367
2 LJQas_1025513 3300000549 Bacteria 688
3 rootH1_10019615 3300003316 Bacteria 5029
4 Ga0070658_10805741 3300005327 Bacteria 816
5 Ga0068868_102199588 3300005338 Bacteria 525
6 Ga0070668_101028533 3300005347 Bacteria 741
7 Ga0070675_100529176 3300005354 Bacteria 1064
8 Ga0070659_101963059 3300005366 Bacteria 525
9 Ga0070709_10000243 3300005434 Bacteria 35120
10 Ga0070714_100002623 3300005435 Bacteria 13242
11 Ga0070714_100073653 3300005435 Bacteria 2959
12 Ga0070713_100033516 3300005436 Bacteria 4115
13 Ga0070713_100189347 3300005436 Bacteria 1853
14 Ga0070713_100428921 3300005436 Bacteria 1239
15 Ga0070710_10068396 3300005437 Bacteria 2040
16 Ga0070711_100002601 3300005439 Bacteria 10342
17 Ga0070708_100004500 3300005445 Bacteria 10963
18 Ga0070663_101342071 3300005455 Bacteria 632
19 Ga0070678_100951545 3300005456 Bacteria 787
20 Ga0070685_11147810 3300005466 Bacteria 589
21 Ga0070707_100000041 3300005468 Bacteria 111077
22 Ga0070707_100022025 3300005468 Bacteria 6025
23 Ga0070698_100000082 3300005471 Bacteria 73573
24 Ga0070698_100032730 3300005471 Bacteria 5384
25 Ga0070699_100684375 3300005518 Bacteria 937
26 Ga0070697_100024056 3300005536 Bacteria 4849
27 Ga0070672_100674063 3300005543 Bacteria 904
28 Ga0068856_100006297 3300005614 Bacteria 11643
29 Ga0068864_100865442 3300005618 Bacteria 891
30 Ga0081455_10350648 3300005937 Bacteria 1041
31 Ga0070717_10013283 3300006028 Bacteria 6304
32 Ga0070717_10096703 3300006028 Bacteria 2501
33 Ga0070717_10380741 3300006028 Bacteria 1265
34 Ga0075365_10013342 3300006038 Bacteria 4910
35 Ga0075365_10058745 3300006038 Bacteria 2561
36 Ga0075365_10230681 3300006038 Bacteria 1299
37 Ga0075365_10865901 3300006038 Bacteria 637
38 Ga0075368_10173176 3300006042 Bacteria 907
39 Ga0075363_100226101 3300006048 Bacteria 1073
40 Ga0075364_10235110 3300006051 Bacteria 1244
41 Ga0070715_10788019 3300006163 Bacteria 576
42 Ga0070716_100003465 3300006173 Bacteria 7430
43 Ga0070712_100029251 3300006175 Bacteria 3692
44 Ga0075362_10106447 3300006177 Bacteria 1316
45 Ga0075370_10090173 3300006353 Bacteria 1768
46 Ga0105243_10792844 3300009148 Bacteria 933
47 Ga0157369_10009699 3300013105 Bacteria 11010
48 Ga0157369_10693701 3300013105 Bacteria 1049
49 Ga0163163_10691161 3300014325 Bacteria 1084
50 Ga0207692_10002390 3300025898 Bacteria 7204
51 Ga0207688_10060090 3300025901 Bacteria 2141
52 Ga0207685_10445378 3300025905 Bacteria 672
53 Ga0207699_10002518 3300025906 Bacteria 8649
54 Ga0207684_10000339 3300025910 Bacteria 65102
55 Ga0207684_10298994 3300025910 Bacteria 1388
56 Ga0207707_11183332 3300025912 Bacteria 619
57 Ga0207693_10020673 3300025915 Bacteria 5235
58 Ga0207663_10006201 3300025916 Bacteria 6094
59 Ga0207657_11139085 3300025919 Bacteria 595
60 Ga0207646_10000061 3300025922 Bacteria 151425
61 Ga0207646_10714586 3300025922 Bacteria 895
62 Ga0207659_10228471 3300025926 Bacteria 1500
63 Ga0207687_11638639 3300025927 Bacteria 552
64 Ga0207700_10000763 3300025928 Bacteria 18571
65 Ga0207700_10021909 3300025928 Bacteria 4374
66 Ga0207700_10040270 3300025928 Bacteria 3409
67 Ga0207700_10351981 3300025928 Bacteria 1283
68 Ga0207664_10003925 3300025929 Bacteria 9997
69 Ga0207664_10023824 3300025929 Bacteria 4593
70 Ga0207664_11226364 3300025929 Bacteria 668
71 Ga0207665_10000276 3300025939 Bacteria 35590
72 Ga0207691_10514703 3300025940 Bacteria 1016
73 Ga0207678_10535106 3300026067 Bacteria 1024
74 Ga0207708_10481832 3300026075 Bacteria 1037
75 Ga0207702_10013858 3300026078 Bacteria 6694
76 Ga0209813_10138937 3300027866 Bacteria 861
77 Ga0265336_10009315 3300028666 Bacteria 3402
78 Ga0265338_10002852 3300028800 Bacteria 25261
79 Ga0316576_10080759 3300031727 Bacteria 2412
80 Ga0316576_10340772 3300031727 Bacteria 1116
81 Ga0316576_10619366 3300031727 Bacteria 789
82 Ga0316576_10960018 3300031727 Bacteria 610
83 Ga0316578_10059707 3300031728 Bacteria 2244
84 Ga0316578_10106335 3300031728 Bacteria 1684
85 Ga0307405_10245331 3300031731 Bacteria 1329
86 Ga0307405_10372697 3300031731 Bacteria 1109
87 Ga0307405_11351798 3300031731 Bacteria 621
88 Ga0307405_11820706 3300031731 Bacteria 542
89 Ga0307410_10335475 3300031852 Bacteria 1204
90 Ga0307410_10572925 3300031852 Bacteria 938
91 Ga0307410_11091515 3300031852 Bacteria 691
92 Ga0307410_11939140 3300031852 Unclassified 525
93 Ga0307406_11246088 3300031901 Bacteria 647
94 Ga0307406_11403303 3300031901 Bacteria 612
95 Ga0307407_10262851 3300031903 Bacteria 1188
96 Ga0307407_11162637 3300031903 Bacteria 602
97 Ga0307409_100396576 3300031995 Bacteria 1317
98 Ga0307409_100444189 3300031995 Bacteria 1250
99 Ga0307409_100457603 3300031995 Bacteria 1233
100 Ga0307409_100856519 3300031995 Bacteria 920
101 Ga0307409_101274785 3300031995 Bacteria 759
102 Ga0307409_101666890 3300031995 Bacteria 666
103 Ga0307416_100106788 3300032002 Bacteria 2455
104 Ga0307416_100168623 3300032002 Bacteria 2035
105 Ga0307416_100410825 3300032002 Bacteria 1394
106 Ga0307416_100432808 3300032002 Bacteria 1363
107 Ga0307416_100663470 3300032002 Bacteria 1129
108 Ga0307416_102625289 3300032002 Bacteria 601
109 Ga0307411_10789591 3300032005 Bacteria 835
110 Ga0307411_11197243 3300032005 Bacteria 689
111 Ga0307415_100092223 3300032126 Bacteria 2196
112 Ga0307415_100820153 3300032126 Bacteria 851
113 Ga0316580_10228254 3300032139 Bacteria 575
114 Ga0373943_0234695 3300035170 Bacteria 1026
115 Ga0316574_0323949 3300035398 Unclassified 978
116 Ga0373935_0881885 3300035692 Bacteria 662
117 Ga0373947_0798619 3300035725 Bacteria 644
118 Ga0373937_2125470 3300036401 Bacteria 507
119 Ga0373925_0185528 3300037068 Bacteria 1649
120 Ga0373925_0381786 3300037068 Bacteria 1147
121 Ga0395899_0020329 3300037312 Bacteria 5036
122 Ga0395899_0613330 3300037312 Bacteria 692
123 Ga0395900_0328389 3300037418 Bacteria 1508
124 Ga0395898_0454041 3300037466 Bacteria 1220
125 Ga0395905_1652415 3300037471 Bacteria 546
126 Ga0395901_0531770 3300038443 Bacteria 1193
127 Ga0450901_040184 3300042533 Bacteria 527
128 Ga0466965_0140764 3300044683 Bacteria 1256
129 Ga0466966_0377873 3300044684 Bacteria 851
130 Ga0466963_0213892 3300044694 Bacteria 1349
131 Ga0466968_0273084 3300044735 Bacteria 807
132 Ga0466960_0859055 3300044901 Bacteria 552
133 Ga0495629_0033720 3300046459 Bacteria 3621
134 Ga0495664_0379725 3300046477 Bacteria 849
135 Ga0495608_0516568 3300046511 Bacteria 722
136 Ga0495631_0388297 3300046518 Bacteria 594
137 Ga0495640_0563168 3300046533 Bacteria 690
138 Ga0495621_0181062 3300046539 Bacteria 841
139 Ga0495656_0011289 3300046615 Bacteria 3276
140 Ga0495671_0489190 3300046692 Bacteria 587
141 Ga0495581_0047268 3300047315 Bacteria 2487
142 Ga0495677_0315070 3300047445 Bacteria 616
143 Ga0495685_061315 3300047447 Bacteria 1267
144 Ga0495615_0113677 3300048090 Bacteria 777
145 Ga0496100_0041861 3300048903 Bacteria 2923
146 Ga0496100_1618337 3300048903 Bacteria 512
147 Ga0496104_0004501 3300048907 Bacteria 12142
148 Ga0496105_0011816 3300048908 Bacteria 6915
149 Ga0496105_0997039 3300048908 Unclassified 627
150 Ga0496105_1273481 3300048908 Bacteria 538
151 Ga0496106_0397921 3300048909 Bacteria 1107
152 Ga0496108_0011328 3300048911 Bacteria 7246
153 Ga0496108_0516247 3300048911 Unclassified 1043
154 Ga0496109_0063547 3300048912 Bacteria 3377
155 Ga0496109_0756204 3300048912 Bacteria 910
156 Ga0496109_1680255 3300048912 Bacteria 569
157 Ga0496110_0784381 3300048913 Bacteria 857
158 Ga0496112_0016526 3300048915 Bacteria 6917
159 Ga0496112_1003194 3300048915 Bacteria 755
160 Ga0496113_0005289 3300048916 Bacteria 8038
161 Ga0496115_0492992 3300048918 Bacteria 985
162 nmdc:mga00v17_137952_c1 3300050491 Bacteria 1562
163 nmdc:mga00v17_78149_c1 3300050491 Bacteria 2062
164 nmdc:mga0yw44_225001_c1 3300050492 Bacteria 1244
165 nmdc:mga0yw44_334053_c1 3300050492 Bacteria 1019
166 nmdc:mga0yw44_58910_c1 3300050492 Bacteria 2348
167 nmdc:mga0yw44_859576_c1 3300050492 Bacteria 616
168 nmdc:mga06z11_251009_c1 3300050494 Bacteria 1042
169 nmdc:mga04h51_6733_c1 3300050495 Bacteria 2997
170 nmdc:mga07m45_187223_c1 3300050496 Bacteria 1203
171 nmdc:mga07m45_250396_c1 3300050496 Bacteria 1031
172 Ga0500644_0000981 3300053088 Bacteria 8889
173 Ga0500644_0265278 3300053088 Bacteria 727
174 Ga0500616_0327147 3300053153 Bacteria 629
175 Ga0500587_035153 3300053739 Bacteria 701
176 2537900813 2537561592 Bacteria 4348607
177 2676475348 2675903058 Bacteria 6822861
178 2775657803 2775506735 Bacteria 4556596
179 2785340814 2784746763 Bacteria 9783172
180 2808829680 2808606357 Bacteria 4466944
181 2808850862 2808606360 Bacteria 4404006
182 2808876628 2808606366 Bacteria 4415912
183 2808898132 2808606371 Bacteria 4251511
184 2812318618 2811994871 Bacteria 4497550
185 2812478414 2811994917 Bacteria 7761064
186 2827629720 2827628540 Bacteria 6858585
187 2863409025 2863404153 Bacteria 9672205
188 2867478940 2867475112 Bacteria 6909112
189 2945916374 2945916053 Bacteria 4555517
190 2945944857 2945941187 Bacteria 4682474
191 2974304335 2974302888 Bacteria 4369871
192 2990092126 2990088156 Bacteria 6657676
193 2997454982 2997451912 Bacteria 8492419
194 8008563179 8008558824 Bacteria 10610750
195 8047895702 8047893842 Bacteria 11723082
196 8048363237 8048356638 Bacteria 11044339
197 8048372726 8048369669 Bacteria 11666822
198 8048381660 8048379754 Bacteria 11877923
199 8048408674 8048406513 Bacteria 8936924
200 8054163999 8054160619 Bacteria 7783213
201 Ga0070706_100003990
202 LJQas_1025513
203 rootH1_10019615
204 Ga0070658_10805741
205 Ga0068868_102199588
206 Ga0070668_101028533
207 Ga0070675_100529176
208 Ga0070659_101963059
209 Ga0070709_10000243
210 Ga0070714_100002623
211 Ga0070714_100073653
212 Ga0070713_100033516
213 Ga0070713_100189347
214 Ga0070713_100428921
215 Ga0070710_10068396
216 Ga0070711_100002601
217 Ga0070708_100004500
218 Ga0070663_101342071
219 Ga0070678_100951545
220 Ga0070685_11147810
221 Ga0070707_100000041
222 Ga0070707_100022025
223 Ga0070698_100000082
224 Ga0070698_100032730
225 Ga0070699_100684375
226 Ga0070697_100024056
227 Ga0070672_100674063
228 Ga0068856_100006297
229 Ga0068864_100865442
230 Ga0081455_10350648
231 Ga0070717_10013283
232 Ga0070717_10096703
233 Ga0070717_10380741
234 Ga0075365_10013342
235 Ga0075365_10058745
236 Ga0075365_10230681
237 Ga0075365_10865901
238 Ga0075368_10173176
239 Ga0075363_100226101
240 Ga0075364_10235110
241 Ga0070715_10788019
242 Ga0070716_100003465
243 Ga0070712_100029251
244 Ga0075362_10106447
245 Ga0075370_10090173
246 Ga0105243_10792844
247 Ga0157369_10009699
248 Ga0157369_10693701
249 Ga0163163_10691161
250 Ga0207692_10002390
251 Ga0207688_10060090
252 Ga0207685_10445378
253 Ga0207699_10002518
254 Ga0207684_10000339
255 Ga0207684_10298994
256 Ga0207707_11183332
257 Ga0207693_10020673
258 Ga0207663_10006201
259 Ga0207657_11139085
260 Ga0207646_10000061
261 Ga0207646_10714586
262 Ga0207659_10228471
263 Ga0207687_11638639
264 Ga0207700_10000763
265 Ga0207700_10021909
266 Ga0207700_10040270
267 Ga0207700_10351981
268 Ga0207664_10003925
269 Ga0207664_10023824
270 Ga0207664_11226364
271 Ga0207665_10000276
272 Ga0207691_10514703
273 Ga0207678_10535106
274 Ga0207708_10481832
275 Ga0207702_10013858
276 Ga0209813_10138937
277 Ga0265336_10009315
278 Ga0265338_10002852
279 Ga0316576_10080759
280 Ga0316576_10340772
281 Ga0316576_10619366
282 Ga0316576_10960018
283 Ga0316578_10059707
284 Ga0316578_10106335
285 Ga0307405_10245331
286 Ga0307405_10372697
287 Ga0307405_11351798
288 Ga0307405_11820706
289 Ga0307410_10335475
290 Ga0307410_10572925
291 Ga0307410_11091515
292 Ga0307410_11939140
293 Ga0307406_11246088
294 Ga0307406_11403303
295 Ga0307407_10262851
296 Ga0307407_11162637
297 Ga0307409_100396576
298 Ga0307409_100444189
299 Ga0307409_100457603
300 Ga0307409_100856519
301 Ga0307409_101274785
302 Ga0307409_101666890
303 Ga0307416_100106788
304 Ga0307416_100168623
305 Ga0307416_100410825
306 Ga0307416_100432808
307 Ga0307416_100663470
308 Ga0307416_102625289
309 Ga0307411_10789591
310 Ga0307411_11197243
311 Ga0307415_100092223
312 Ga0307415_100820153
313 Ga0316580_10228254
314 Ga0373943_0234695
315 Ga0316574_0323949
316 Ga0373935_0881885
317 Ga0373947_0798619
318 Ga0373937_2125470
319 Ga0373925_0185528
320 Ga0373925_0381786
321 Ga0395899_0020329
322 Ga0395899_0613330
323 Ga0395900_0328389
324 Ga0395898_0454041
325 Ga0395905_1652415
326 Ga0395901_0531770
327 Ga0450901_040184
328 Ga0466965_0140764
329 Ga0466966_0377873
330 Ga0466963_0213892
331 Ga0466968_0273084
332 Ga0466960_0859055
333 Ga0495629_0033720
334 Ga0495664_0379725
335 Ga0495608_0516568
336 Ga0495631_0388297
337 Ga0495640_0563168
338 Ga0495621_0181062
339 Ga0495656_0011289
340 Ga0495671_0489190
341 Ga0495581_0047268
342 Ga0495677_0315070
343 Ga0495685_061315
344 Ga0495615_0113677
345 Ga0496100_0041861
346 Ga0496100_1618337
347 Ga0496104_0004501
348 Ga0496105_0011816
349 Ga0496105_0997039
350 Ga0496105_1273481
351 Ga0496106_0397921
352 Ga0496108_0011328
353 Ga0496108_0516247
354 Ga0496109_0063547
355 Ga0496109_0756204
356 Ga0496109_1680255
357 Ga0496110_0784381
358 Ga0496112_0016526
359 Ga0496112_1003194
360 Ga0496113_0005289
361 Ga0496115_0492992
362 nmdc:mga00v17_137952_c1
363 nmdc:mga00v17_78149_c1
364 nmdc:mga0yw44_225001_c1
365 nmdc:mga0yw44_334053_c1
366 nmdc:mga0yw44_58910_c1
367 nmdc:mga0yw44_859576_c1
368 nmdc:mga06z11_251009_c1
369 nmdc:mga04h51_6733_c1
370 nmdc:mga07m45_187223_c1
371 nmdc:mga07m45_250396_c1
372 Ga0500644_0000981
373 Ga0500644_0265278
374 Ga0500616_0327147
375 Ga0500587_035153
376 2537900813
377 2676475348
378 2775657803
379 2785340814
380 2808829680
381 2808850862
382 2808876628
383 2808898132
384 2812318618
385 2812478414
386 2827629720
387 2863409025
388 2867478940
389 2945916374
390 2945944857
391 2974304335
392 2990092126
393 2997454982
394 8008563179
395 8047895702
396 8048363237
397 8048372726
398 8048381660
399 8048408674
400 8054163999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

4

100

0.96

Map