F306817

General Info

Members Datasets Scaffolds Average Seq Length
200 80 200 73

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10276973|Ga0070710_102769732
Length 76
Sequence MPDEKPQKISIGFEGGQVLSSRVQPAELTKLRQALEQMDGWHDLAAEDGTVALHLKRVVYVLVDHEEHRVGFGSAR

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
21 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
34 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
35 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
36 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
37 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
38 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
39 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
49 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
50 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
57 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
65 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
66 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
67 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
68 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
76 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
77 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
78 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
79 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
80 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.5
Rhizosphere 77.5
Stem 0
Stem Tuber 0
Unclassified 18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_101491499 3300005337 Bacteria 581
2 Ga0070688_101047089 3300005365 Bacteria 650
3 Ga0070709_10420822 3300005434 Bacteria 1001
4 Ga0070709_10993364 3300005434 Bacteria 667
5 Ga0070709_11708893 3300005434 Bacteria 514
6 Ga0070714_100652770 3300005435 Bacteria 1013
7 Ga0070714_100824580 3300005435 Bacteria 899
8 Ga0070714_101268637 3300005435 Bacteria 719
9 Ga0070714_101652643 3300005435 Bacteria 626
10 Ga0070714_101705084 3300005435 Bacteria 615
11 Ga0070713_100706064 3300005436 Unclassified 963
12 Ga0070713_100954136 3300005436 Bacteria 826
13 Ga0070713_101051409 3300005436 Bacteria 786
14 Ga0070710_10276973 3300005437 Bacteria 1087
15 Ga0070710_11232952 3300005437 Bacteria 554
16 Ga0070711_101045580 3300005439 Bacteria 702
17 Ga0070711_101216692 3300005439 Unclassified 652
18 Ga0070678_100555134 3300005456 Bacteria 1020
19 Ga0070707_100136315 3300005468 Bacteria 2388
20 Ga0070697_102088192 3300005536 Bacteria 507
21 Ga0070664_100246205 3300005564 Bacteria 1606
22 Ga0070717_10649964 3300006028 Bacteria 957
23 Ga0070717_10770780 3300006028 Bacteria 875
24 Ga0070717_11237804 3300006028 Archaea 679
25 Ga0070716_101133788 3300006173 Bacteria 625
26 Ga0070716_101189691 3300006173 Bacteria 612
27 Ga0070712_100202017 3300006175 Bacteria 1562
28 Ga0070712_100280037 3300006175 Bacteria 1343
29 Ga0070712_100491026 3300006175 Unclassified 1028
30 Ga0070712_101013606 3300006175 Bacteria 719
31 Ga0070712_101208013 3300006175 Unclassified 658
32 Ga0070712_101736672 3300006175 Unclassified 546
33 Ga0075434_102383587 3300006871 Bacteria 531
34 Ga0105241_10699427 3300009174 Bacteria 925
35 Ga0105237_10003606 3300009545 Bacteria 18291
36 Ga0105237_10730762 3300009545 Unclassified 996
37 Ga0157372_10806040 3300013307 Bacteria 1091
38 Ga0157372_12405953 3300013307 Unclassified 605
39 Ga0206353_10615270 3300020082 Unclassified 684
40 Ga0213873_10156594 3300021358 Bacteria 688
41 Ga0213874_10025232 3300021377 Bacteria 1674
42 Ga0213876_10053518 3300021384 Bacteria 2131
43 Ga0213876_10157007 3300021384 Bacteria 1210
44 Ga0213876_10557080 3300021384 Bacteria 610
45 Ga0213875_10024412 3300021388 Bacteria 2883
46 Ga0213875_10100674 3300021388 Bacteria 1348
47 Ga0213875_10139674 3300021388 Bacteria 1133
48 Ga0213875_10183839 3300021388 Bacteria 982
49 Ga0213875_10335085 3300021388 Bacteria 718
50 Ga0207654_10094427 3300025911 Bacteria 1830
51 Ga0207671_10003355 3300025914 Bacteria 16063
52 Ga0207693_10666259 3300025915 Bacteria 808
53 Ga0207693_10838902 3300025915 Bacteria 707
54 Ga0207693_10885048 3300025915 Unclassified 686
55 Ga0207693_11092584 3300025915 Unclassified 606
56 Ga0207663_10196221 3300025916 Bacteria 1453
57 Ga0207663_10789302 3300025916 Bacteria 756
58 Ga0207663_11530204 3300025916 Bacteria 537
59 Ga0207646_10101698 3300025922 Bacteria 2577
60 Ga0207700_11176777 3300025928 Bacteria 685
61 Ga0207664_10355270 3300025929 Bacteria 1297
62 Ga0207664_10532063 3300025929 Bacteria 1054
63 Ga0207664_10994804 3300025929 Bacteria 752
64 Ga0207665_11482003 3300025939 Bacteria 539
65 Ga0207679_10298845 3300025945 Bacteria 1387
66 Ga0265337_1004936 3300028556 Bacteria 5428
67 Ga0265326_10020449 3300028558 Bacteria 1897
68 Ga0265319_1000451 3300028563 Bacteria 29289
69 Ga0265334_10029342 3300028573 Bacteria 2206
70 Ga0265318_10003203 3300028577 Bacteria 8349
71 Ga0265322_10187814 3300028654 Bacteria 591
72 Ga0265336_10000017 3300028666 Bacteria 231370
73 Ga0265338_10000044 3300028800 Bacteria 223643
74 Ga0265324_10003597 3300029957 Bacteria 7294
75 Ga0265320_10115664 3300031240 Bacteria 1226
76 Ga0265340_10000003 3300031247 Bacteria 320583
77 Ga0265316_10017414 3300031344 Bacteria 6213
78 Ga0265342_10014064 3300031712 Bacteria 5325
79 Ga0373925_0625904 3300037068 Bacteria 887
80 Ga0436364_0233658 3300037853 Bacteria 9593
81 Ga0436364_0385881 3300037853 Unclassified 1041
82 Ga0436364_0409804 3300037853 Bacteria 970
83 Ga0436364_0568939 3300037853 Bacteria 19992
84 Ga0436364_0907275 3300037853 Bacteria 706
85 Ga0436364_1089096 3300037853 Bacteria 676
86 Ga0436364_1215003 3300037853 Bacteria 1006
87 Ga0436364_1241683 3300037853 Bacteria 1260
88 Ga0436364_1246908 3300037853 Unclassified 914
89 Ga0436364_1349313 3300037853 Bacteria 2413
90 Ga0436364_1376779 3300037853 Bacteria 2392
91 Ga0436364_1448129 3300037853 Bacteria 1305
92 Ga0436365_0183110 3300039437 Archaea 1115
93 Ga0436365_0249881 3300039437 Bacteria 22069
94 Ga0436365_0415891 3300039437 Bacteria 2297
95 Ga0436365_0424484 3300039437 Bacteria 4120
96 Ga0436365_0669087 3300039437 Bacteria 1664
97 Ga0436365_1259851 3300039437 Bacteria 1060
98 Ga0436365_1363530 3300039437 Bacteria 999
99 Ga0436365_1877005 3300039437 Bacteria 831
100 Ga0436365_1925032 3300039437 Bacteria 6579
101 Ga0436363_0078075 3300039450 Bacteria 1332
102 Ga0436363_0089653 3300039450 Bacteria 1331
103 Ga0436363_0443584 3300039450 Unclassified 571
104 Ga0436363_0607622 3300039450 Bacteria 706
105 Ga0436363_1337790 3300039450 Bacteria 1519
106 Ga0436362_0232241 3300039453 Bacteria 1159
107 Ga0436362_0238775 3300039453 Bacteria 4532
108 Ga0436362_0347864 3300039453 Bacteria 517
109 Ga0436362_0396615 3300039453 Bacteria 2624
110 Ga0466969_0154087 3300044656 Unclassified 1058
111 Ga0466969_0157723 3300044656 Bacteria 1043
112 Ga0466969_0301150 3300044656 Bacteria 726
113 Ga0466969_0452505 3300044656 Unclassified 584
114 Ga0466965_0375278 3300044683 Bacteria 782
115 Ga0466966_0034062 3300044684 Bacteria 3296
116 Ga0466966_0113383 3300044684 Bacteria 1670
117 Ga0466966_0162346 3300044684 Bacteria 1360
118 Ga0466966_0204666 3300044684 Bacteria 1194
119 Ga0466966_0208670 3300044684 Bacteria 1181
120 Ga0466966_0819342 3300044684 Bacteria 561
121 Ga0466961_0007430 3300044693 Bacteria 6974
122 Ga0466961_0015037 3300044693 Bacteria 4969
123 Ga0466961_0753568 3300044693 Unclassified 582
124 Ga0466963_0000745 3300044694 Bacteria 16045
125 Ga0466963_0044047 3300044694 Bacteria 2936
126 Ga0466963_0097985 3300044694 Bacteria 2004
127 Ga0466963_0178221 3300044694 Bacteria 1483
128 Ga0466963_0215699 3300044694 Bacteria 1343
129 Ga0466971_0013703 3300044719 Bacteria 3565
130 Ga0466971_0219731 3300044719 Bacteria 900
131 Ga0466971_0239690 3300044719 Bacteria 862
132 Ga0466971_0570252 3300044719 Bacteria 563
133 Ga0466968_0019172 3300044735 Bacteria 2752
134 Ga0466968_0033166 3300044735 Bacteria 2151
135 Ga0466968_0084414 3300044735 Bacteria 1400
136 Ga0466968_0185515 3300044735 Bacteria 969
137 Ga0466968_0334082 3300044735 Unclassified 734
138 Ga0466968_0413825 3300044735 Bacteria 662
139 Ga0466968_0627683 3300044735 Unclassified 544
140 Ga0466970_0002492 3300044765 Bacteria 8886
141 Ga0466970_0070745 3300044765 Bacteria 1876
142 Ga0466970_0460195 3300044765 Unclassified 730
143 Ga0466957_0011323 3300044842 Bacteria 5142
144 Ga0466957_0026729 3300044842 Bacteria 3425
145 Ga0466957_0189769 3300044842 Bacteria 1346
146 Ga0466957_0338259 3300044842 Bacteria 1019
147 Ga0466957_0358797 3300044842 Bacteria 990
148 Ga0466957_0977839 3300044842 Bacteria 607
149 Ga0466959_0039105 3300045049 Bacteria 3505
150 Ga0466959_0058346 3300045049 Bacteria 2811
151 Ga0466959_0063548 3300045049 Bacteria 2680
152 Ga0466959_0154360 3300045049 Unclassified 1616
153 Ga0466959_0195984 3300045049 Unclassified 1408
154 Ga0466959_0371668 3300045049 Bacteria 974
155 Ga0466959_0554472 3300045049 Bacteria 775
156 Ga0466959_0572316 3300045049 Unclassified 761
157 Ga0466959_0604917 3300045049 Bacteria 737
158 Ga0466958_0041143 3300045836 Bacteria 2779
159 Ga0466958_0057222 3300045836 Bacteria 2370
160 Ga0466958_0059575 3300045836 Bacteria 2323
161 Ga0466958_0059929 3300045836 Bacteria 2316
162 Ga0466958_0071667 3300045836 Bacteria 2122
163 Ga0466958_0100146 3300045836 Bacteria 1801
164 Ga0466958_0211023 3300045836 Bacteria 1237
165 Ga0466958_0218764 3300045836 Bacteria 1215
166 Ga0466958_0258991 3300045836 Bacteria 1113
167 Ga0466958_0698663 3300045836 Bacteria 661
168 Ga0466967_0162250 3300045976 Bacteria 2099
169 Ga0466967_0371744 3300045976 Bacteria 1387
170 Ga0466967_0427703 3300045976 Unclassified 1291
171 Ga0466967_0976486 3300045976 Bacteria 843
172 Ga0466967_1376089 3300045976 Bacteria 703
173 Ga0466967_2096842 3300045976 Bacteria 562
174 Ga0466967_2203420 3300045976 Bacteria 547
175 Ga0466967_2291539 3300045976 Unclassified 536
176 Ga0495664_0001383 3300046477 Bacteria 12819
177 Ga0495645_0000688 3300046543 Bacteria 23257
178 Ga0495676_0376095 3300047321 Bacteria 946
179 Ga0495684_0009555 3300047471 Bacteria 7476
180 Ga0495602_0665487 3300048088 Bacteria 710
181 Ga0496100_0000240 3300048903 Bacteria 28546
182 Ga0496102_1012125 3300048905 Bacteria 751
183 Ga0496103_0255841 3300048906 Bacteria 1127
184 Ga0496108_0580586 3300048911 Unclassified 977
185 Ga0496113_1293239 3300048916 Bacteria 567
186 Ga0496114_1415750 3300048917 Unclassified 583
187 Ga0496115_0000023 3300048918 Bacteria 163267
188 Ga0496115_0000041 3300048918 Bacteria 122947
189 Ga0496115_0931385 3300048918 Bacteria 668
190 Ga0496122_0103012 3300048925 Bacteria 1901
191 nmdc:mga0rr50_1272367_c1 3300050513 Bacteria 624
192 Ga0495601_0085579 3300053077 Bacteria 2026
193 Ga0495612_0343934 3300053078 Bacteria 673
194 Ga0495619_1182467 3300053085 Bacteria 507
195 Ga0466962_0016513 3300061719 Bacteria 3560
196 Ga0466962_0259730 3300061719 Bacteria 855
197 Ga0466962_0413849 3300061719 Unclassified 676
198 Ga0466962_0463384 3300061719 Unclassified 639
199 Ga0466962_0591044 3300061719 Bacteria 565
200 Ga0466962_0754041 3300061719 Unclassified 501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10993364 Ga0070709_109933641 70
2 3300005435 Ga0070714_100824580 Ga0070714_1008245803 70
3 3300006028 Ga0070717_10649964 Ga0070717_106499643 70
4 3300009545 Ga0105237_10730762 Ga0105237_107307622 70
5 3300028556 Ga0265337_1004936 Ga0265337_10049365 70
6 3300028558 Ga0265326_10020449 Ga0265326_100204493 70
7 3300028563 Ga0265319_1000451 Ga0265319_10004517 70
8 3300028573 Ga0265334_10029342 Ga0265334_100293422 70
9 3300028577 Ga0265318_10003203 Ga0265318_100032038 70
10 3300028654 Ga0265322_10187814 Ga0265322_101878142 70
11 3300028666 Ga0265336_10000017 Ga0265336_1000001726 70
12 3300028800 Ga0265338_10000044 Ga0265338_1000004426 70
13 3300029957 Ga0265324_10003597 Ga0265324_100035979 70
14 3300031240 Ga0265320_10115664 Ga0265320_101156642 70
15 3300031247 Ga0265340_10000003 Ga0265340_10000003142 70
16 3300031344 Ga0265316_10017414 Ga0265316_100174142 70
17 3300031712 Ga0265342_10014064 Ga0265342_100140647 70
18 3300044842 Ga0466957_0358797 Ga0466957_0358797_302_514 70
19 3300048088 Ga0495602_0665487 Ga0495602_0665487_14_226 70
20 3300048918 Ga0496115_0931385 Ga0496115_0931385_259_471 70
21 3300005365 Ga0070688_101047089 Ga0070688_1010470891 71
22 3300020082 Ga0206353_10615270 Ga0206353_106152702 71
23 3300053085 Ga0495619_1182467 Ga0495619_1182467_122_337 71
24 3300005434 Ga0070709_10420822 Ga0070709_104208222 72
25 3300005434 Ga0070709_11708893 Ga0070709_117088932 72
26 3300005435 Ga0070714_100652770 Ga0070714_1006527702 72
27 3300005435 Ga0070714_101652643 Ga0070714_1016526432 72
28 3300005437 Ga0070710_11232952 Ga0070710_112329522 72
29 3300005439 Ga0070711_101045580 Ga0070711_1010455801 72
30 3300005456 Ga0070678_100555134 Ga0070678_1005551341 72
31 3300005468 Ga0070707_100136315 Ga0070707_1001363153 72
32 3300005536 Ga0070697_102088192 Ga0070697_1020881921 72
33 3300005564 Ga0070664_100246205 Ga0070664_1002462053 72
34 3300006173 Ga0070716_101133788 Ga0070716_1011337882 72
35 3300006173 Ga0070716_101189691 Ga0070716_1011896912 72
36 3300006175 Ga0070712_100280037 Ga0070712_1002800372 72
37 3300006175 Ga0070712_101013606 Ga0070712_1010136062 72
38 3300006175 Ga0070712_101208013 Ga0070712_1012080132 72
39 3300006871 Ga0075434_102383587 Ga0075434_1023835872 72
40 3300009174 Ga0105241_10699427 Ga0105241_106994272 72
41 3300009545 Ga0105237_10003606 Ga0105237_1000360616 72
42 3300013307 Ga0157372_10806040 Ga0157372_108060402 72
43 3300013307 Ga0157372_12405953 Ga0157372_124059532 72
44 3300025911 Ga0207654_10094427 Ga0207654_100944272 72
45 3300025914 Ga0207671_10003355 Ga0207671_1000335513 72
46 3300025915 Ga0207693_10666259 Ga0207693_106662592 72
47 3300025915 Ga0207693_10838902 Ga0207693_108389021 72
48 3300025915 Ga0207693_10885048 Ga0207693_108850482 72
49 3300025916 Ga0207663_10196221 Ga0207663_101962211 72
50 3300025916 Ga0207663_10789302 Ga0207663_107893021 72
51 3300025916 Ga0207663_11530204 Ga0207663_115302041 72
52 3300025922 Ga0207646_10101698 Ga0207646_101016984 72
53 3300025939 Ga0207665_11482003 Ga0207665_114820031 72
54 3300025945 Ga0207679_10298845 Ga0207679_102988453 72
55 3300044656 Ga0466969_0157723 Ga0466969_0157723_548_766 72
56 3300044684 Ga0466966_0034062 Ga0466966_0034062_122_340 72
57 3300044693 Ga0466961_0015037 Ga0466961_0015037_2941_3159 72
58 3300044694 Ga0466963_0097985 Ga0466963_0097985_1542_1760 72
59 3300044765 Ga0466970_0460195 Ga0466970_0460195_400_618 72
60 3300044842 Ga0466957_0338259 Ga0466957_0338259_696_914 72
61 3300045049 Ga0466959_0063548 Ga0466959_0063548_1335_1553 72
62 3300045836 Ga0466958_0059575 Ga0466958_0059575_242_460 72
63 3300045836 Ga0466958_0258991 Ga0466958_0258991_203_421 72
64 3300045976 Ga0466967_0976486 Ga0466967_0976486_490_708 72
65 3300046477 Ga0495664_0001383 Ga0495664_0001383_5429_5647 72
66 3300046543 Ga0495645_0000688 Ga0495645_0000688_21348_21566 72
67 3300047471 Ga0495684_0009555 Ga0495684_0009555_3443_3661 72
68 3300048903 Ga0496100_0000240 Ga0496100_0000240_6353_6571 72
69 3300048905 Ga0496102_1012125 Ga0496102_1012125_306_524 72
70 3300048906 Ga0496103_0255841 Ga0496103_0255841_415_633 72
71 3300048918 Ga0496115_0000023 Ga0496115_0000023_137327_137545 72
72 3300048918 Ga0496115_0000041 Ga0496115_0000041_97821_98039 72
73 3300048925 Ga0496122_0103012 Ga0496122_0103012_1116_1334 72
74 3300053077 Ga0495601_0085579 Ga0495601_0085579_1640_1858 72
75 3300053078 Ga0495612_0343934 Ga0495612_0343934_195_413 72
76 3300061719 Ga0466962_0259730 Ga0466962_0259730_232_450 72
77 3300061719 Ga0466962_0463384 Ga0466962_0463384_394_612 72
78 3300005435 Ga0070714_101268637 Ga0070714_1012686371 73
79 3300005435 Ga0070714_101705084 Ga0070714_1017050842 73
80 3300005436 Ga0070713_100706064 Ga0070713_1007060641 73
81 3300005436 Ga0070713_100954136 Ga0070713_1009541361 73
82 3300005436 Ga0070713_101051409 Ga0070713_1010514092 73
83 3300005437 Ga0070710_10276973 Ga0070710_102769732 73
84 3300006028 Ga0070717_11237804 Ga0070717_112378042 73
85 3300006175 Ga0070712_100202017 Ga0070712_1002020173 73
86 3300021358 Ga0213873_10156594 Ga0213873_101565941 73
87 3300021377 Ga0213874_10025232 Ga0213874_100252323 73
88 3300021384 Ga0213876_10053518 Ga0213876_100535182 73
89 3300021384 Ga0213876_10157007 Ga0213876_101570073 73
90 3300021384 Ga0213876_10557080 Ga0213876_105570801 73
91 3300021388 Ga0213875_10024412 Ga0213875_100244122 73
92 3300021388 Ga0213875_10139674 Ga0213875_101396743 73
93 3300021388 Ga0213875_10183839 Ga0213875_101838391 73
94 3300021388 Ga0213875_10335085 Ga0213875_103350852 73
95 3300025928 Ga0207700_11176777 Ga0207700_111767771 73
96 3300025929 Ga0207664_10532063 Ga0207664_105320633 73
97 3300025929 Ga0207664_10994804 Ga0207664_109948042 73
98 3300037853 Ga0436364_0233658 Ga0436364_0233658_2729_2950 73
99 3300037853 Ga0436364_0409804 Ga0436364_0409804_658_888 73
100 3300037853 Ga0436364_0907275 Ga0436364_0907275_421_648 73
101 3300037853 Ga0436364_1215003 Ga0436364_1215003_134_361 73
102 3300037853 Ga0436364_1241683 Ga0436364_1241683_661_891 73
103 3300037853 Ga0436364_1246908 Ga0436364_1246908_315_545 73
104 3300037853 Ga0436364_1349313 Ga0436364_1349313_1482_1712 73
105 3300037853 Ga0436364_1376779 Ga0436364_1376779_149_382 73
106 3300039437 Ga0436365_0249881 Ga0436365_0249881_12770_12991 73
107 3300039437 Ga0436365_0415891 Ga0436365_0415891_620_841 73
108 3300039437 Ga0436365_0424484 Ga0436365_0424484_3668_3895 73
109 3300039437 Ga0436365_1259851 Ga0436365_1259851_606_833 73
110 3300039437 Ga0436365_1363530 Ga0436365_1363530_90_320 73
111 3300039437 Ga0436365_1925032 Ga0436365_1925032_3426_3647 73
112 3300039450 Ga0436363_0089653 Ga0436363_0089653_631_858 73
113 3300039450 Ga0436363_0443584 Ga0436363_0443584_94_318 73
114 3300039450 Ga0436363_0607622 Ga0436363_0607622_103_324 73
115 3300039453 Ga0436362_0232241 Ga0436362_0232241_263_484 73
116 3300039453 Ga0436362_0347864 Ga0436362_0347864_238_465 73
117 3300039453 Ga0436362_0396615 Ga0436362_0396615_1869_2090 73
118 3300044656 Ga0466969_0154087 Ga0466969_0154087_559_780 73
119 3300044683 Ga0466965_0375278 Ga0466965_0375278_364_585 73
120 3300044684 Ga0466966_0162346 Ga0466966_0162346_98_319 73
121 3300044684 Ga0466966_0204666 Ga0466966_0204666_146_376 73
122 3300044693 Ga0466961_0007430 Ga0466961_0007430_3903_4124 73
123 3300044694 Ga0466963_0000745 Ga0466963_0000745_1486_1707 73
124 3300044694 Ga0466963_0044047 Ga0466963_0044047_139_360 73
125 3300044694 Ga0466963_0178221 Ga0466963_0178221_113_334 73
126 3300044719 Ga0466971_0013703 Ga0466971_0013703_2493_2714 73
127 3300044719 Ga0466971_0219731 Ga0466971_0219731_160_381 73
128 3300044719 Ga0466971_0239690 Ga0466971_0239690_119_340 73
129 3300044735 Ga0466968_0185515 Ga0466968_0185515_263_484 73
130 3300044735 Ga0466968_0334082 Ga0466968_0334082_134_355 73
131 3300044735 Ga0466968_0413825 Ga0466968_0413825_190_420 73
132 3300044735 Ga0466968_0627683 Ga0466968_0627683_124_354 73
133 3300044765 Ga0466970_0002492 Ga0466970_0002492_7300_7521 73
134 3300044765 Ga0466970_0070745 Ga0466970_0070745_1111_1332 73
135 3300044842 Ga0466957_0011323 Ga0466957_0011323_1816_2037 73
136 3300044842 Ga0466957_0026729 Ga0466957_0026729_461_682 73
137 3300044842 Ga0466957_0189769 Ga0466957_0189769_876_1097 73
138 3300044842 Ga0466957_0977839 Ga0466957_0977839_240_461 73
139 3300045049 Ga0466959_0039105 Ga0466959_0039105_1198_1419 73
140 3300045049 Ga0466959_0154360 Ga0466959_0154360_933_1154 73
141 3300045049 Ga0466959_0195984 Ga0466959_0195984_726_956 73
142 3300045836 Ga0466958_0041143 Ga0466958_0041143_2125_2346 73
143 3300045836 Ga0466958_0057222 Ga0466958_0057222_2094_2315 73
144 3300045836 Ga0466958_0059929 Ga0466958_0059929_1163_1384 73
145 3300045836 Ga0466958_0071667 Ga0466958_0071667_105_326 73
146 3300045836 Ga0466958_0218764 Ga0466958_0218764_204_425 73
147 3300045836 Ga0466958_0698663 Ga0466958_0698663_154_375 73
148 3300045976 Ga0466967_0371744 Ga0466967_0371744_393_623 73
149 3300045976 Ga0466967_0427703 Ga0466967_0427703_652_873 73
150 3300045976 Ga0466967_2096842 Ga0466967_2096842_129_350 73
151 3300045976 Ga0466967_2203420 Ga0466967_2203420_91_312 73
152 3300050513 nmdc:mga0rr50_1272367_c1 nmdc:mga0rr50_1272367_c1_93_314 73
153 3300061719 Ga0466962_0016513 Ga0466962_0016513_1019_1240 73
154 3300061719 Ga0466962_0413849 Ga0466962_0413849_441_662 73
155 3300061719 Ga0466962_0591044 Ga0466962_0591044_75_296 73
156 3300005337 Ga0070682_101491499 Ga0070682_1014914992 74
157 3300005439 Ga0070711_101216692 Ga0070711_1012166922 74
158 3300006028 Ga0070717_10770780 Ga0070717_107707801 74
159 3300006175 Ga0070712_100491026 Ga0070712_1004910262 74
160 3300006175 Ga0070712_101736672 Ga0070712_1017366722 74
161 3300021388 Ga0213875_10100674 Ga0213875_101006742 74
162 3300025915 Ga0207693_11092584 Ga0207693_110925842 74
163 3300025929 Ga0207664_10355270 Ga0207664_103552702 74
164 3300037068 Ga0373925_0625904 Ga0373925_0625904_508_732 74
165 3300037853 Ga0436364_0385881 Ga0436364_0385881_316_540 74
166 3300037853 Ga0436364_0568939 Ga0436364_0568939_16305_16529 74
167 3300037853 Ga0436364_1089096 Ga0436364_1089096_20_244 74
168 3300037853 Ga0436364_1448129 Ga0436364_1448129_841_1065 74
169 3300039437 Ga0436365_0183110 Ga0436365_0183110_546_770 74
170 3300039437 Ga0436365_0669087 Ga0436365_0669087_568_792 74
171 3300039437 Ga0436365_1877005 Ga0436365_1877005_578_802 74
172 3300039450 Ga0436363_0078075 Ga0436363_0078075_1019_1246 74
173 3300039450 Ga0436363_1337790 Ga0436363_1337790_746_973 74
174 3300039453 Ga0436362_0238775 Ga0436362_0238775_2953_3177 74
175 3300044656 Ga0466969_0301150 Ga0466969_0301150_296_526 74
176 3300044656 Ga0466969_0452505 Ga0466969_0452505_190_414 74
177 3300044684 Ga0466966_0113383 Ga0466966_0113383_861_1085 74
178 3300044684 Ga0466966_0208670 Ga0466966_0208670_158_388 74
179 3300044684 Ga0466966_0819342 Ga0466966_0819342_187_411 74
180 3300044693 Ga0466961_0753568 Ga0466961_0753568_162_386 74
181 3300044694 Ga0466963_0215699 Ga0466963_0215699_769_1002 74
182 3300044719 Ga0466971_0570252 Ga0466971_0570252_265_489 74
183 3300044735 Ga0466968_0019172 Ga0466968_0019172_1475_1699 74
184 3300044735 Ga0466968_0033166 Ga0466968_0033166_633_857 74
185 3300044735 Ga0466968_0084414 Ga0466968_0084414_314_538 74
186 3300045049 Ga0466959_0058346 Ga0466959_0058346_383_607 74
187 3300045049 Ga0466959_0371668 Ga0466959_0371668_405_635 74
188 3300045049 Ga0466959_0554472 Ga0466959_0554472_126_356 74
189 3300045049 Ga0466959_0572316 Ga0466959_0572316_430_654 74
190 3300045049 Ga0466959_0604917 Ga0466959_0604917_197_427 74
191 3300045836 Ga0466958_0100146 Ga0466958_0100146_268_492 74
192 3300045836 Ga0466958_0211023 Ga0466958_0211023_699_932 74
193 3300045976 Ga0466967_0162250 Ga0466967_0162250_1528_1761 74
194 3300045976 Ga0466967_1376089 Ga0466967_1376089_409_633 74
195 3300045976 Ga0466967_2291539 Ga0466967_2291539_28_252 74
196 3300047321 Ga0495676_0376095 Ga0495676_0376095_201_425 74
197 3300048911 Ga0496108_0580586 Ga0496108_0580586_320_544 74
198 3300048916 Ga0496113_1293239 Ga0496113_1293239_213_437 74
199 3300048917 Ga0496114_1415750 Ga0496114_1415750_68_292 74
200 3300061719 Ga0466962_0754041 Ga0466962_0754041_243_467 74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4noy-assembly1.cif.gz_D-2 crystal structure of listeria monocytogenes hfq f43w 0.74 8 64
6gwk-assembly3.cif.gz_O the crystal structure of hfq from caulobacter crescentus 0.7305 7 63
3ahu-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.73 7 64
6gwk-assembly2.cif.gz_G the crystal structure of hfq from caulobacter crescentus 0.7272 8 63
6gwk-assembly1.cif.gz_C the crystal structure of hfq from caulobacter crescentus 0.7262 7 63
ID Description Score Start End Superfamily
af_Q9UM54_463_623_1.20.58.530 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.802 41 56 1.20.58.530
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.7483 8 64 2.30.30.100
3kygB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7259 5 25 2.30.110.10
4nl2F00 Mainly Beta;Roll;SH3 type barrels.; 0.7206 8 64 2.30.30.100
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.7186 9 63 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A7V9HBB3-F1-model_v4 Uncharacterized protein 0.9638 6 72
AF-A0A6J4S525-F1-model_v4 Uncharacterized protein 0.9545 5 72
AF-A0A640Y943-F1-model_v4 Uncharacterized protein 0.9373 7 72
AF-A0A2W6C552-F1-model_v4 Uncharacterized protein 0.9295 1 74
AF-A5N2D3-F1-model_v4 HTH LytTR-type domain-containing protein 0.9233 8 64

Feature Viewer

pLDDT pTM Quality
83.46 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map