F306768

General Info

Members Datasets Scaffolds Average Seq Length
200 124 400 195

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10149555|Ga0070692_101495552
Length 215
Sequence MDRSSNLRRALLIVSALACFTVAQHALPASADVPSYERVRVLEMPKPIADFTLTDQNGASFKLTDLKGKVAFMLFGFTNCPDACPLSMERLRELQHSGSLADENVAYVMISVDGERDTPAAMKAFVAKYSSDFIGLTADPSRVAPIAAQFSAMFFKGARNPHDGHYDVAHSPQIFVLDPAGRVRAEVYSASLEAMAGVATALLNEKNAASEGGTK

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
66 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
67 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
70 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
71 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
72 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
73 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
74 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
75 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
76 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
77 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
78 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
121 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 2
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10149555 3300005345 Bacteria 1329
2 rootH1_10097019 3300003323 Bacteria 1186
3 Ga0070670_100084844 3300005331 Bacteria 2721
4 Ga0070677_10116613 3300005333 Bacteria 1200
5 Ga0070682_100366748 3300005337 Unclassified 1078
6 Ga0070669_100066107 3300005353 Bacteria 2664
7 Ga0070669_100136916 3300005353 Bacteria 1884
8 Ga0070669_100609426 3300005353 Bacteria 915
9 Ga0070675_100008721 3300005354 Bacteria 7875
10 Ga0070675_100027599 3300005354 Bacteria 4562
11 Ga0070675_100351699 3300005354 Unclassified 1307
12 Ga0070675_100616167 3300005354 Bacteria 985
13 Ga0070674_100078717 3300005356 Bacteria 2349
14 Ga0070674_100427802 3300005356 Bacteria 1088
15 Ga0070673_100021471 3300005364 Bacteria 4682
16 Ga0070673_100098908 3300005364 Bacteria 2399
17 Ga0070673_100490308 3300005364 Bacteria 1110
18 Ga0070688_100734613 3300005365 Unclassified 767
19 Ga0070705_100127625 3300005440 Bacteria 1654
20 Ga0070700_100101098 3300005441 Bacteria 1900
21 Ga0070694_100157587 3300005444 Bacteria 1663
22 Ga0070678_100120385 3300005456 Bacteria 2069
23 Ga0070662_100364243 3300005457 Bacteria 1187
24 Ga0068867_100054711 3300005459 Bacteria 2948
25 Ga0068867_101296644 3300005459 Unclassified 672
26 Ga0070685_10111213 3300005466 Bacteria 1687
27 Ga0070672_100045679 3300005543 Bacteria 3390
28 Ga0070672_100076972 3300005543 Bacteria 2666
29 Ga0070672_100123633 3300005543 Bacteria 2121
30 Ga0070672_100144208 3300005543 Bacteria 1967
31 Ga0070695_100324637 3300005545 Bacteria 1145
32 Ga0070665_100006065 3300005548 Bacteria 12353
33 Ga0070664_100017417 3300005564 Bacteria 5899
34 Ga0068859_100439551 3300005617 Bacteria 1401
35 Ga0068861_100005138 3300005719 Bacteria 8826
36 Ga0068861_100828160 3300005719 Bacteria 871
37 Ga0068870_10073974 3300005840 Bacteria 1865
38 Ga0068863_100699534 3300005841 Bacteria 1007
39 Ga0068862_100018958 3300005844 Bacteria 5734
40 Ga0068862_100118213 3300005844 Bacteria 2333
41 Ga0068862_100132422 3300005844 Unclassified 2206
42 Ga0068862_100446535 3300005844 Bacteria 1218
43 Ga0068862_100912451 3300005844 Bacteria 864
44 Ga0081455_10608065 3300005937 Bacteria 711
45 Ga0075430_100174345 3300006846 Unclassified 1789
46 Ga0075433_10012367 3300006852 Bacteria 6891
47 Ga0075433_10057806 3300006852 Bacteria 3391
48 Ga0075434_100005921 3300006871 Bacteria 11188
49 Ga0068865_100026383 3300006881 Bacteria 3830
50 Ga0075436_100617540 3300006914 Bacteria 799
51 Ga0097620_100439575 3300006931 Bacteria 1401
52 Ga0111539_10052659 3300009094 Bacteria 4845
53 Ga0111539_11009797 3300009094 Bacteria 967
54 Ga0157375_10026327 3300013308 Bacteria 5418
55 Ga0163163_10083955 3300014325 Bacteria 3190
56 Ga0157380_10000885 3300014326 Bacteria 18825
57 Ga0157380_10011297 3300014326 Bacteria 6449
58 Ga0157380_10030457 3300014326 Bacteria 4133
59 Ga0157380_10106471 3300014326 Bacteria 2347
60 Ga0157380_10132822 3300014326 Bacteria 2126
61 Ga0157380_10299530 3300014326 Bacteria 1480
62 Ga0157380_10637645 3300014326 Unclassified 1061
63 Ga0207643_10019834 3300025908 Bacteria 3686
64 Ga0207643_10335968 3300025908 Bacteria 946
65 Ga0207681_10036893 3300025923 Plasmid 3227
66 Ga0207681_10056149 3300025923 Bacteria 2685
67 Ga0207681_10222292 3300025923 Bacteria 1462
68 Ga0207681_10442797 3300025923 Bacteria 1056
69 Ga0207681_10695230 3300025923 Bacteria 845
70 Ga0207650_10262554 3300025925 Bacteria 1401
71 Ga0207659_10028961 3300025926 Bacteria 3768
72 Ga0207659_10060509 3300025926 Bacteria 2726
73 Ga0207659_10061368 3300025926 Bacteria 2710
74 Ga0207659_10311772 3300025926 Bacteria 1296
75 Ga0207659_10459066 3300025926 Bacteria 1074
76 Ga0207659_10545006 3300025926 Bacteria 986
77 Ga0207669_10001903 3300025937 Bacteria 8852
78 Ga0207669_10327296 3300025937 Bacteria 1175
79 Ga0207669_10437278 3300025937 Bacteria 1033
80 Ga0207704_10006103 3300025938 Bacteria 5588
81 Ga0207691_10011629 3300025940 Bacteria 8448
82 Ga0207691_10038223 3300025940 Bacteria 4441
83 Ga0207691_10090952 3300025940 Bacteria 2735
84 Ga0207691_10157719 3300025940 Unclassified 1992
85 Ga0207691_10644949 3300025940 Unclassified 895
86 Ga0207679_11007960 3300025945 Bacteria 763
87 Ga0207651_10050412 3300025960 Bacteria 2826
88 Ga0207651_10110922 3300025960 Bacteria 2059
89 Ga0207668_10984125 3300025972 Bacteria 753
90 Ga0207639_10130173 3300026041 Unclassified 2082
91 Ga0207708_10050820 3300026075 Bacteria 3156
92 Ga0207708_10079869 3300026075 Bacteria 2513
93 Ga0207641_10008245 3300026088 Bacteria 8614
94 Ga0207641_10680317 3300026088 Bacteria 1012
95 Ga0207675_100050811 3300026118 Bacteria 3869
96 Ga0207675_100652617 3300026118 Bacteria 1058
97 Ga0207675_100956891 3300026118 Bacteria 874
98 Ga0209983_1018060 3300027665 Bacteria 1463
99 Ga0209971_1034141 3300027682 Unclassified 1223
100 Ga0207428_10004710 3300027907 Bacteria 12903
101 Ga0268265_10147809 3300028380 Bacteria 1977
102 Ga0268265_10362639 3300028380 Bacteria 1327
103 Ga0268265_10455829 3300028380 Bacteria 1195
104 Ga0268265_11046539 3300028380 Bacteria 808
105 Ga0307513_10012114 3300031456 Bacteria 10666
106 Ga0307413_10003208 3300031824 Bacteria 6843
107 Ga0307413_10350937 3300031824 Bacteria 1138
108 Ga0307410_10001567 3300031852 Bacteria 10452
109 Ga0307410_10060971 3300031852 Bacteria 2580
110 Ga0307406_10169556 3300031901 Bacteria 1578
111 Ga0307407_10152216 3300031903 Bacteria 1504
112 Ga0307409_100017214 3300031995 Bacteria 4810
113 Ga0307409_100019303 3300031995 Bacteria 4611
114 Ga0307415_100226968 3300032126 Bacteria 1501
115 Ga0307415_100345918 3300032126 Bacteria 1250
116 Ga0451789_0507751 3300041443 Bacteria 935
117 Ga0451791_1660283 3300041451 Bacteria 820
118 Ga0451797_0892707 3300041453 Bacteria 998
119 Ga0451798_0292027 3300041458 Bacteria 1744
120 Ga0451833_0603528 3300041491 Bacteria 801
121 Ga0451837_0745171 3300041494 Bacteria 2557
122 Ga0450914_003325 3300042118 Bacteria 1228
123 Ga0450920_007440 3300042122 Bacteria 1986
124 Ga0450923_010396 3300042125 Bacteria 1651
125 Ga0450897_012955 3300042128 Bacteria 828
126 Ga0450894_001330 3300042131 Bacteria 3584
127 Ga0450896_001534 3300042133 Bacteria 2867
128 Ga0450899_010785 3300042135 Bacteria 1015
129 Ga0450910_020844 3300042147 Bacteria 990
130 Ga0450908_000556 3300042184 Bacteria 7154
131 Ga0450916_002704 3300042530 Bacteria 1904
132 Ga0495590_0003185 3300046457 Bacteria 6711
133 Ga0495629_0512849 3300046459 Unclassified 808
134 Ga0495616_0004598 3300046513 Bacteria 8674
135 Ga0495632_0191519 3300046519 Bacteria 934
136 Ga0495666_0084245 3300046526 Bacteria 1502
137 Ga0495640_0319380 3300046533 Unclassified 962
138 Ga0495634_0356038 3300046642 Bacteria 876
139 Ga0495625_0066218 3300046660 Bacteria 2545
140 Ga0495613_0272439 3300046689 Bacteria 1177
141 Ga0495670_0253862 3300046691 Bacteria 938
142 Ga0495672_0269009 3300047320 Bacteria 819
143 Ga0495680_0305136 3300047322 Unclassified 1117
144 Ga0495593_0247703 3300047673 Bacteria 892
145 Ga0501032_0016832 3300049569 Bacteria 5138
146 Ga0501036_0014838 3300049572 Bacteria 6499
147 Ga0501036_0243887 3300049572 Bacteria 1507
148 Ga0501036_0245010 3300049572 Bacteria 1503
149 Ga0501037_0659726 3300049573 Bacteria 699
150 Ga0501038_0158740 3300049574 Bacteria 1840
151 Ga0501038_0190803 3300049574 Unclassified 1649
152 Ga0501038_0248110 3300049574 Bacteria 1411
153 Ga0501040_0021107 3300049576 Bacteria 4343
154 Ga0501040_0050930 3300049576 Bacteria 2833
155 Ga0501040_0253233 3300049576 Bacteria 1256
156 Ga0501041_0040342 3300049577 Bacteria 2833
157 Ga0501042_0261426 3300049578 Bacteria 1249
158 Ga0501042_0267042 3300049578 Bacteria 1235
159 Ga0501042_0541790 3300049578 Bacteria 846
160 Ga0501048_0005926 3300049582 Bacteria 9303
161 Ga0501067_0051410 3300049583 Bacteria 2284
162 Ga0501068_0016868 3300049584 Bacteria 4216
163 Ga0501069_0121000 3300049585 Bacteria 1495
164 Ga0501070_0126674 3300049586 Bacteria 2110
165 Ga0501071_0000735 3300049587 Bacteria 17319
166 Ga0501071_0019442 3300049587 Bacteria 4713
167 Ga0501071_0194553 3300049587 Bacteria 1522
168 Ga0501071_0524353 3300049587 Bacteria 909
169 Ga0501071_0938561 3300049587 Bacteria 668
170 Ga0501072_0034461 3300049588 Bacteria 3968
171 Ga0501075_0271731 3300049591 Bacteria 1292
172 Ga0501076_0036667 3300049592 Bacteria 3842
173 Ga0501076_0158684 3300049592 Bacteria 1842
174 Ga0501077_0123426 3300049593 Bacteria 1642
175 Ga0501079_0003169 3300049741 Bacteria 12049
176 Ga0501079_0138558 3300049741 Bacteria 1895
177 Ga0501079_0213944 3300049741 Bacteria 1506
178 Ga0501080_0009866 3300049742 Bacteria 8722
179 Ga0501080_0384967 3300049742 Bacteria 1263
180 Ga0501081_0002031 3300049743 Bacteria 12615
181 Ga0501081_0409913 3300049743 Bacteria 1004
182 Ga0501083_0012264 3300049744 Bacteria 5998
183 Ga0501035_0494048 3300049822 Bacteria 1008
184 Ga0501045_0010776 3300049824 Bacteria 6407
185 nmdc:mga06r32_904059_c1 3300050510 Unclassified 839
186 nmdc:mga08y16_304879_c1 3300050511 Unclassified 1641
187 nmdc:mga08y16_90979_c1 3300050511 Bacteria 3180
188 nmdc:mga08y16_964086_c1 3300050511 Bacteria 835
189 nmdc:mga0rr50_432798_c1 3300050513 Unclassified 1114
190 nmdc:mga08x19_445601_c1 3300050514 Bacteria 911
191 nmdc:mga0a205_227363_c1 3300050515 Bacteria 1219
192 nmdc:mga0a205_24534_c2 3300050515 Bacteria 3763
193 Ga0495612_0239535 3300053078 Bacteria 806
194 Ga0500641_0012485 3300053096 Bacteria 3103
195 Ga0500616_0000073 3300053153 Bacteria 231290
196 Ga0501082_0030354 3300060353 Bacteria 4659
197 Ga0501082_0263820 3300060353 Bacteria 1498
198 Ga0501082_0586707 3300060353 Bacteria 975
199 Ga0530510_0701944 3300061734 Bacteria 771
200 Ga0530510_0728646 3300061734 Bacteria 756
201 Ga0070692_10149555
202 rootH1_10097019
203 Ga0070670_100084844
204 Ga0070677_10116613
205 Ga0070682_100366748
206 Ga0070669_100066107
207 Ga0070669_100136916
208 Ga0070669_100609426
209 Ga0070675_100008721
210 Ga0070675_100027599
211 Ga0070675_100351699
212 Ga0070675_100616167
213 Ga0070674_100078717
214 Ga0070674_100427802
215 Ga0070673_100021471
216 Ga0070673_100098908
217 Ga0070673_100490308
218 Ga0070688_100734613
219 Ga0070705_100127625
220 Ga0070700_100101098
221 Ga0070694_100157587
222 Ga0070678_100120385
223 Ga0070662_100364243
224 Ga0068867_100054711
225 Ga0068867_101296644
226 Ga0070685_10111213
227 Ga0070672_100045679
228 Ga0070672_100076972
229 Ga0070672_100123633
230 Ga0070672_100144208
231 Ga0070695_100324637
232 Ga0070665_100006065
233 Ga0070664_100017417
234 Ga0068859_100439551
235 Ga0068861_100005138
236 Ga0068861_100828160
237 Ga0068870_10073974
238 Ga0068863_100699534
239 Ga0068862_100018958
240 Ga0068862_100118213
241 Ga0068862_100132422
242 Ga0068862_100446535
243 Ga0068862_100912451
244 Ga0081455_10608065
245 Ga0075430_100174345
246 Ga0075433_10012367
247 Ga0075433_10057806
248 Ga0075434_100005921
249 Ga0068865_100026383
250 Ga0075436_100617540
251 Ga0097620_100439575
252 Ga0111539_10052659
253 Ga0111539_11009797
254 Ga0157375_10026327
255 Ga0163163_10083955
256 Ga0157380_10000885
257 Ga0157380_10011297
258 Ga0157380_10030457
259 Ga0157380_10106471
260 Ga0157380_10132822
261 Ga0157380_10299530
262 Ga0157380_10637645
263 Ga0207643_10019834
264 Ga0207643_10335968
265 Ga0207681_10036893
266 Ga0207681_10056149
267 Ga0207681_10222292
268 Ga0207681_10442797
269 Ga0207681_10695230
270 Ga0207650_10262554
271 Ga0207659_10028961
272 Ga0207659_10060509
273 Ga0207659_10061368
274 Ga0207659_10311772
275 Ga0207659_10459066
276 Ga0207659_10545006
277 Ga0207669_10001903
278 Ga0207669_10327296
279 Ga0207669_10437278
280 Ga0207704_10006103
281 Ga0207691_10011629
282 Ga0207691_10038223
283 Ga0207691_10090952
284 Ga0207691_10157719
285 Ga0207691_10644949
286 Ga0207679_11007960
287 Ga0207651_10050412
288 Ga0207651_10110922
289 Ga0207668_10984125
290 Ga0207639_10130173
291 Ga0207708_10050820
292 Ga0207708_10079869
293 Ga0207641_10008245
294 Ga0207641_10680317
295 Ga0207675_100050811
296 Ga0207675_100652617
297 Ga0207675_100956891
298 Ga0209983_1018060
299 Ga0209971_1034141
300 Ga0207428_10004710
301 Ga0268265_10147809
302 Ga0268265_10362639
303 Ga0268265_10455829
304 Ga0268265_11046539
305 Ga0307513_10012114
306 Ga0307413_10003208
307 Ga0307413_10350937
308 Ga0307410_10001567
309 Ga0307410_10060971
310 Ga0307406_10169556
311 Ga0307407_10152216
312 Ga0307409_100017214
313 Ga0307409_100019303
314 Ga0307415_100226968
315 Ga0307415_100345918
316 Ga0451789_0507751
317 Ga0451791_1660283
318 Ga0451797_0892707
319 Ga0451798_0292027
320 Ga0451833_0603528
321 Ga0451837_0745171
322 Ga0450914_003325
323 Ga0450920_007440
324 Ga0450923_010396
325 Ga0450897_012955
326 Ga0450894_001330
327 Ga0450896_001534
328 Ga0450899_010785
329 Ga0450910_020844
330 Ga0450908_000556
331 Ga0450916_002704
332 Ga0495590_0003185
333 Ga0495629_0512849
334 Ga0495616_0004598
335 Ga0495632_0191519
336 Ga0495666_0084245
337 Ga0495640_0319380
338 Ga0495634_0356038
339 Ga0495625_0066218
340 Ga0495613_0272439
341 Ga0495670_0253862
342 Ga0495672_0269009
343 Ga0495680_0305136
344 Ga0495593_0247703
345 Ga0501032_0016832
346 Ga0501036_0014838
347 Ga0501036_0243887
348 Ga0501036_0245010
349 Ga0501037_0659726
350 Ga0501038_0158740
351 Ga0501038_0190803
352 Ga0501038_0248110
353 Ga0501040_0021107
354 Ga0501040_0050930
355 Ga0501040_0253233
356 Ga0501041_0040342
357 Ga0501042_0261426
358 Ga0501042_0267042
359 Ga0501042_0541790
360 Ga0501048_0005926
361 Ga0501067_0051410
362 Ga0501068_0016868
363 Ga0501069_0121000
364 Ga0501070_0126674
365 Ga0501071_0000735
366 Ga0501071_0019442
367 Ga0501071_0194553
368 Ga0501071_0524353
369 Ga0501071_0938561
370 Ga0501072_0034461
371 Ga0501075_0271731
372 Ga0501076_0036667
373 Ga0501076_0158684
374 Ga0501077_0123426
375 Ga0501079_0003169
376 Ga0501079_0138558
377 Ga0501079_0213944
378 Ga0501080_0009866
379 Ga0501080_0384967
380 Ga0501081_0002031
381 Ga0501081_0409913
382 Ga0501083_0012264
383 Ga0501035_0494048
384 Ga0501045_0010776
385 nmdc:mga06r32_904059_c1
386 nmdc:mga08y16_304879_c1
387 nmdc:mga08y16_90979_c1
388 nmdc:mga08y16_964086_c1
389 nmdc:mga0rr50_432798_c1
390 nmdc:mga08x19_445601_c1
391 nmdc:mga0a205_227363_c1
392 nmdc:mga0a205_24534_c2
393 Ga0495612_0239535
394 Ga0500641_0012485
395 Ga0500616_0000073
396 Ga0501082_0030354
397 Ga0501082_0263820
398 Ga0501082_0586707
399 Ga0530510_0701944
400 Ga0530510_0728646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

48

183

0.94

PF00578

AhpC-TSA

AhpC/TSA family

44

186

0.88

PF08534

Redoxin

Redoxin

43

202

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n5u-assembly3.cif.gz_C crystal structure of arabidopsis thaliana scoi with copper bound 0.8894 60 208
2b7j-assembly4.cif.gz_D crystal structure of yeast sco1 with copper bound 0.884 56 201
2b7k-assembly4.cif.gz_D crystal structure of yeast sco1 0.8811 58 201
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.8764 60 208
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.8744 58 207
ID Description Score Start End Superfamily
af_Q17557_120_303_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8986 57 205 3.40.30.10
af_Q4CYL4_166_345_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8859 54 208 3.40.30.10
af_P38072_102_285_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8857 57 208 3.40.30.10
af_Q4D9Q9_96_284_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.879 57 201 3.40.30.10
af_B4FLA5_101_276_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8762 53 208 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1G0HB20-F1-model_v4 Thioredoxin domain-containing protein 0.9328 50 208 GO:0046872
AF-A0A6I5RQG0-F1-model_v4 SCO family protein 0.9273 49 207 GO:0046872
AF-A0A534A362-F1-model_v4 SCO family protein 0.9257 42 206 GO:0046872
AF-A0A4R1F0B4-F1-model_v4 Protein SCO1/2 0.9185 57 208 GO:0046872
AF-A0A7S2AUV9-F1-model_v4 Thioredoxin domain-containing protein 0.9138 57 209 GO:0005739
GO:0033617
GO:0046872

Map