F306145

General Info

Members Datasets Scaffolds Average Seq Length
199 143 398 153

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0045500|Ga0466965_0045500_137_754
Length 185
Sequence MSAATGGRGPAGHAHRPGHRRRWVTLTLLVLFVVVPLVEIYVLIQVGQVIGAWWTVLLLVLDSLLGAWLVRREGARAWRALREALGSGRMPAAELADGALVLIGGTLMLAPGFVTDVVAFFMILPLTRPVFRRLLGYLVARRVTTLAVGPFGAAFGPGYPGGPSRRRPGPGPEGPVVRGEVVDED

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
73 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
76 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
77 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
138 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
139 2643221711 Terrabacter sp. Root85 Isolate Unclassified
140 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
141 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
142 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
143 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.46
Metatranscriptomes 4.02
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.52
Nodule 0
Rhizoplane 10.05
Rhizosphere 81.41
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0045500 3300044683 Bacteria 2171
2 Ga0070683_100059433 3300005329 Bacteria 3551
3 Ga0070680_100409767 3300005336 Bacteria 1156
4 Ga0070660_100348540 3300005339 Bacteria 1219
5 Ga0070687_100292019 3300005343 Bacteria 1031
6 Ga0070692_10072186 3300005345 Bacteria 1841
7 Ga0070668_100053390 3300005347 Bacteria 3116
8 Ga0070668_101026597 3300005347 Bacteria 742
9 Ga0070669_101018368 3300005353 Bacteria 711
10 Ga0070675_100312451 3300005354 Bacteria 1387
11 Ga0070674_100191220 3300005356 Bacteria 1575
12 Ga0070700_100424335 3300005441 Bacteria 1006
13 Ga0070663_100214169 3300005455 Bacteria 1510
14 Ga0070678_100199990 3300005456 Bacteria 1649
15 Ga0070681_10315875 3300005458 Bacteria 1472
16 Ga0068867_100203816 3300005459 Bacteria 1585
17 Ga0070685_10067234 3300005466 Bacteria 2114
18 Ga0070672_100222806 3300005543 Bacteria 1582
19 Ga0070686_100500060 3300005544 Bacteria 943
20 Ga0070693_101236747 3300005547 Bacteria 575
21 Ga0070665_101519328 3300005548 Bacteria 678
22 Ga0068854_100511123 3300005578 Bacteria 1013
23 Ga0070702_100030245 3300005615 Bacteria 2951
24 Ga0068852_100235979 3300005616 Bacteria 1746
25 Ga0068861_100131260 3300005719 Bacteria 2034
26 Ga0068861_100632533 3300005719 Bacteria 986
27 Ga0068870_10088846 3300005840 Bacteria 1724
28 Ga0068863_101583085 3300005841 Bacteria 664
29 Ga0068858_100633161 3300005842 Bacteria 1039
30 Ga0075365_10028809 3300006038 Bacteria 3543
31 Ga0075365_10091710 3300006038 Bacteria 2070
32 Ga0075363_100005297 3300006048 Bacteria 5725
33 Ga0075367_10137476 3300006178 Bacteria 1512
34 Ga0097621_100661780 3300006237 Bacteria 959
35 Ga0105240_11134931 3300009093 Bacteria 830
36 Ga0111539_10955192 3300009094 Bacteria 997
37 Ga0105243_10411649 3300009148 Bacteria 1259
38 Ga0105249_10033079 3300009553 Bacteria 4681
39 Ga0105246_10039592 3300011119 Bacteria 3176
40 Ga0157378_10056581 3300013297 Bacteria 3495
41 Ga0163162_10517991 3300013306 Bacteria 1322
42 Ga0163162_10583771 3300013306 Bacteria 1244
43 Ga0157372_10387434 3300013307 Bacteria 1628
44 Ga0157375_10054734 3300013308 Bacteria 3931
45 Ga0157375_10081849 3300013308 Bacteria 3269
46 Ga0157375_10461897 3300013308 Bacteria 1435
47 Ga0157380_10271575 3300014326 Bacteria 1546
48 Ga0157380_10395087 3300014326 Bacteria 1310
49 Ga0163161_10017819 3300017792 Bacteria 4976
50 Ga0197907_10629559 3300020069 Bacteria 1170
51 Ga0197907_11280932 3300020069 Bacteria 1178
52 Ga0206356_10395282 3300020070 Bacteria 849
53 Ga0206353_10680877 3300020082 Bacteria 2771
54 Ga0224712_10066398 3300022467 Bacteria 1452
55 Ga0224712_10133593 3300022467 Bacteria 1086
56 Ga0224712_10298428 3300022467 Bacteria 753
57 Ga0224712_10363962 3300022467 Bacteria 685
58 Ga0207642_10013316 3300025899 Bacteria 2999
59 Ga0207688_10195110 3300025901 Bacteria 1212
60 Ga0207643_10062303 3300025908 Bacteria 2131
61 Ga0207705_10348208 3300025909 Bacteria 1141
62 Ga0207695_11024506 3300025913 Bacteria 705
63 Ga0207652_10309252 3300025921 Bacteria 1426
64 Ga0207650_10290823 3300025925 Bacteria 1332
65 Ga0207690_10998891 3300025932 Bacteria 696
66 Ga0207686_10759721 3300025934 Bacteria 774
67 Ga0207709_10019571 3300025935 Bacteria 3810
68 Ga0207704_10898709 3300025938 Bacteria 745
69 Ga0207691_10044222 3300025940 Bacteria 4100
70 Ga0207679_10133516 3300025945 Bacteria 1995
71 Ga0207668_10147780 3300025972 Bacteria 1816
72 Ga0207640_11138043 3300025981 Bacteria 692
73 Ga0207708_10034815 3300026075 Bacteria 3831
74 Ga0207648_10038123 3300026089 Bacteria 4230
75 Ga0207648_10375151 3300026089 Bacteria 1285
76 Ga0207674_10478386 3300026116 Bacteria 1204
77 Ga0207683_10236692 3300026121 Bacteria 1665
78 Ga0207683_10265047 3300026121 Bacteria 1569
79 Ga0207698_10079622 3300026142 Bacteria 2636
80 Ga0265327_10001628 3300031251 Bacteria 27077
81 Ga0307413_10508702 3300031824 Bacteria 969
82 Ga0307409_100031787 3300031995 Bacteria 3816
83 Ga0307409_100334688 3300031995 Bacteria 1422
84 Ga0307409_101575303 3300031995 Bacteria 685
85 Ga0307416_100569052 3300032002 Bacteria 1209
86 Ga0307416_100594388 3300032002 Bacteria 1186
87 Ga0307416_100657900 3300032002 Bacteria 1133
88 Ga0307416_101416868 3300032002 Bacteria 801
89 Ga0307414_10521391 3300032004 Bacteria 1055
90 Ga0307414_11237102 3300032004 Bacteria 692
91 Ga0373938_0019378 3300034957 Bacteria 1361
92 Ga0373941_0033809 3300035115 Bacteria 1539
93 Ga0395898_0018140 3300037466 Bacteria 7182
94 Ga0451797_0385806 3300041453 Bacteria 1035
95 Ga0451795_0232900 3300041456 Bacteria 754
96 Ga0451841_0488411 3300041498 Bacteria 911
97 Ga0451853_3391297 3300041512 Bacteria 1076
98 Ga0466972_0030370 3300044658 Bacteria 2660
99 Ga0466972_0039203 3300044658 Bacteria 2313
100 Ga0466965_0003991 3300044683 Bacteria 6539
101 Ga0466966_0029848 3300044684 Bacteria 3545
102 Ga0466963_0065163 3300044694 Bacteria 2442
103 Ga0466963_0085521 3300044694 Bacteria 2141
104 Ga0466963_1035802 3300044694 Bacteria 578
105 Ga0466964_0005234 3300044706 Bacteria 4810
106 Ga0466970_0027356 3300044765 Bacteria 2993
107 Ga0466970_0058718 3300044765 Bacteria 2059
108 Ga0466970_0288312 3300044765 Bacteria 924
109 Ga0466957_0129292 3300044842 Bacteria 1616
110 Ga0466960_0003052 3300044901 Bacteria 6402
111 Ga0466960_0046490 3300044901 Bacteria 2078
112 Ga0466960_0213793 3300044901 Bacteria 1058
113 Ga0466958_0167234 3300045836 Bacteria 1392
114 Ga0466967_0256681 3300045976 Bacteria 1671
115 Ga0495628_0484342 3300046516 Bacteria 895
116 Ga0495645_0577147 3300046543 Bacteria 694
117 Ga0495667_0678677 3300046559 Bacteria 639
118 Ga0495635_0096292 3300046663 Bacteria 2023
119 Ga0496100_0003295 3300048903 Bacteria 8401
120 Ga0496101_0028076 3300048904 Bacteria 3926
121 Ga0496102_0033982 3300048905 Bacteria 4585
122 Ga0496102_0440109 3300048905 Bacteria 1223
123 Ga0496103_0003620 3300048906 Bacteria 9420
124 Ga0496105_0001817 3300048908 Bacteria 15279
125 Ga0496105_0268055 3300048908 Bacteria 1379
126 Ga0496105_0606912 3300048908 Bacteria 849
127 Ga0496106_0430791 3300048909 Bacteria 1060
128 Ga0496108_0229457 3300048911 Bacteria 1614
129 Ga0496109_0696796 3300048912 Bacteria 953
130 Ga0496110_0164308 3300048913 Bacteria 2013
131 Ga0496110_0255126 3300048913 Bacteria 1596
132 Ga0496110_0751538 3300048913 Bacteria 878
133 Ga0496113_0226701 3300048916 Bacteria 1490
134 Ga0496113_0293628 3300048916 Bacteria 1301
135 Ga0496114_0026364 3300048917 Bacteria 4757
136 Ga0496114_0045058 3300048917 Bacteria 3662
137 Ga0501031_0000693 3300049568 Bacteria 20105
138 Ga0501031_0003288 3300049568 Bacteria 10375
139 Ga0501031_0369703 3300049568 Unclassified 928
140 Ga0501031_0592576 3300049568 Bacteria 713
141 Ga0501032_0144231 3300049569 Bacteria 1568
142 Ga0501033_0038425 3300049570 Bacteria 3578
143 Ga0501033_0040461 3300049570 Bacteria 3479
144 Ga0501036_0001833 3300049572 Bacteria 16501
145 Ga0501036_0003085 3300049572 Bacteria 13292
146 Ga0501036_1220223 3300049572 Bacteria 613
147 Ga0501037_0050916 3300049573 Bacteria 3030
148 Ga0501038_0009008 3300049574 Bacteria 9159
149 Ga0501039_0004558 3300049575 Bacteria 10467
150 Ga0501039_0020860 3300049575 Bacteria 5022
151 Ga0501039_0126993 3300049575 Bacteria 2001
152 Ga0501040_0002442 3300049576 Bacteria 11969
153 Ga0501040_0004768 3300049576 Bacteria 8795
154 Ga0501041_0054114 3300049577 Bacteria 2448
155 Ga0501042_0004218 3300049578 Bacteria 9152
156 Ga0501042_0166868 3300049578 Bacteria 1588
157 Ga0501043_0515116 3300049579 Bacteria 892
158 Ga0501046_0005754 3300049580 Bacteria 11064
159 Ga0501048_0001355 3300049582 Bacteria 18560
160 Ga0501048_0004155 3300049582 Bacteria 11039
161 Ga0501068_0036655 3300049584 Bacteria 2934
162 Ga0501070_0143517 3300049586 Bacteria 1971
163 Ga0501071_0001717 3300049587 Bacteria 12856
164 Ga0501071_0002819 3300049587 Bacteria 10704
165 Ga0501072_0005844 3300049588 Bacteria 9375
166 Ga0501072_0029706 3300049588 Bacteria 4271
167 Ga0501073_0188645 3300049589 Bacteria 1426
168 Ga0501074_0058140 3300049590 Bacteria 2785
169 Ga0501075_0002567 3300049591 Bacteria 12107
170 Ga0501076_0000957 3300049592 Bacteria 18872
171 Ga0501076_0008238 3300049592 Bacteria 7636
172 Ga0501076_0234717 3300049592 Bacteria 1500
173 Ga0501077_0002148 3300049593 Bacteria 11910
174 Ga0501077_0014312 3300049593 Bacteria 4984
175 Ga0501079_0114668 3300049741 Bacteria 2094
176 Ga0501035_0112448 3300049822 Bacteria 2386
177 Ga0501044_0139417 3300049823 Bacteria 2414
178 Ga0501045_0011079 3300049824 Bacteria 6317
179 Ga0501045_0091930 3300049824 Bacteria 2243
180 nmdc:mga03683_391033_c1 3300050489 Bacteria 663
181 nmdc:mga03n38_734970_c1 3300050490 Bacteria 571
182 nmdc:mga0yw44_152086_c1 3300050492 Bacteria 1510
183 nmdc:mga0yw44_38746_c1 3300050492 Bacteria 2822
184 Ga0495601_0032459 3300053077 Bacteria 3251
185 Ga0500593_000014 3300053117 Bacteria 58730
186 Ga0501084_0007270 3300054114 Bacteria 9126
187 Ga0501084_0019762 3300054114 Bacteria 5613
188 Ga0501084_1050195 3300054114 Unclassified 684
189 Ga0501082_0021382 3300060353 Bacteria 5581
190 Ga0501082_0097829 3300060353 Bacteria 2537
191 Ga0466962_0064604 3300061719 Bacteria 1747
192 Ga0466962_0326633 3300061719 Bacteria 761
193 2643849905 2643221567 Bacteria 4163945
194 2644135907 2643221624 Bacteria 4384879
195 2644609765 2643221711 Bacteria 4865335
196 2808874240 2808606365 Bacteria 4301966
197 2812374919 2811994882 Bacteria 4688362
198 2819666521 2818991458 Bacteria 4794049
199 2857482575 2857481737 Bacteria 4761446
200 Ga0466965_0045500
201 Ga0070683_100059433
202 Ga0070680_100409767
203 Ga0070660_100348540
204 Ga0070687_100292019
205 Ga0070692_10072186
206 Ga0070668_100053390
207 Ga0070668_101026597
208 Ga0070669_101018368
209 Ga0070675_100312451
210 Ga0070674_100191220
211 Ga0070700_100424335
212 Ga0070663_100214169
213 Ga0070678_100199990
214 Ga0070681_10315875
215 Ga0068867_100203816
216 Ga0070685_10067234
217 Ga0070672_100222806
218 Ga0070686_100500060
219 Ga0070693_101236747
220 Ga0070665_101519328
221 Ga0068854_100511123
222 Ga0070702_100030245
223 Ga0068852_100235979
224 Ga0068861_100131260
225 Ga0068861_100632533
226 Ga0068870_10088846
227 Ga0068863_101583085
228 Ga0068858_100633161
229 Ga0075365_10028809
230 Ga0075365_10091710
231 Ga0075363_100005297
232 Ga0075367_10137476
233 Ga0097621_100661780
234 Ga0105240_11134931
235 Ga0111539_10955192
236 Ga0105243_10411649
237 Ga0105249_10033079
238 Ga0105246_10039592
239 Ga0157378_10056581
240 Ga0163162_10517991
241 Ga0163162_10583771
242 Ga0157372_10387434
243 Ga0157375_10054734
244 Ga0157375_10081849
245 Ga0157375_10461897
246 Ga0157380_10271575
247 Ga0157380_10395087
248 Ga0163161_10017819
249 Ga0197907_10629559
250 Ga0197907_11280932
251 Ga0206356_10395282
252 Ga0206353_10680877
253 Ga0224712_10066398
254 Ga0224712_10133593
255 Ga0224712_10298428
256 Ga0224712_10363962
257 Ga0207642_10013316
258 Ga0207688_10195110
259 Ga0207643_10062303
260 Ga0207705_10348208
261 Ga0207695_11024506
262 Ga0207652_10309252
263 Ga0207650_10290823
264 Ga0207690_10998891
265 Ga0207686_10759721
266 Ga0207709_10019571
267 Ga0207704_10898709
268 Ga0207691_10044222
269 Ga0207679_10133516
270 Ga0207668_10147780
271 Ga0207640_11138043
272 Ga0207708_10034815
273 Ga0207648_10038123
274 Ga0207648_10375151
275 Ga0207674_10478386
276 Ga0207683_10236692
277 Ga0207683_10265047
278 Ga0207698_10079622
279 Ga0265327_10001628
280 Ga0307413_10508702
281 Ga0307409_100031787
282 Ga0307409_100334688
283 Ga0307409_101575303
284 Ga0307416_100569052
285 Ga0307416_100594388
286 Ga0307416_100657900
287 Ga0307416_101416868
288 Ga0307414_10521391
289 Ga0307414_11237102
290 Ga0373938_0019378
291 Ga0373941_0033809
292 Ga0395898_0018140
293 Ga0451797_0385806
294 Ga0451795_0232900
295 Ga0451841_0488411
296 Ga0451853_3391297
297 Ga0466972_0030370
298 Ga0466972_0039203
299 Ga0466965_0003991
300 Ga0466966_0029848
301 Ga0466963_0065163
302 Ga0466963_0085521
303 Ga0466963_1035802
304 Ga0466964_0005234
305 Ga0466970_0027356
306 Ga0466970_0058718
307 Ga0466970_0288312
308 Ga0466957_0129292
309 Ga0466960_0003052
310 Ga0466960_0046490
311 Ga0466960_0213793
312 Ga0466958_0167234
313 Ga0466967_0256681
314 Ga0495628_0484342
315 Ga0495645_0577147
316 Ga0495667_0678677
317 Ga0495635_0096292
318 Ga0496100_0003295
319 Ga0496101_0028076
320 Ga0496102_0033982
321 Ga0496102_0440109
322 Ga0496103_0003620
323 Ga0496105_0001817
324 Ga0496105_0268055
325 Ga0496105_0606912
326 Ga0496106_0430791
327 Ga0496108_0229457
328 Ga0496109_0696796
329 Ga0496110_0164308
330 Ga0496110_0255126
331 Ga0496110_0751538
332 Ga0496113_0226701
333 Ga0496113_0293628
334 Ga0496114_0026364
335 Ga0496114_0045058
336 Ga0501031_0000693
337 Ga0501031_0003288
338 Ga0501031_0369703
339 Ga0501031_0592576
340 Ga0501032_0144231
341 Ga0501033_0038425
342 Ga0501033_0040461
343 Ga0501036_0001833
344 Ga0501036_0003085
345 Ga0501036_1220223
346 Ga0501037_0050916
347 Ga0501038_0009008
348 Ga0501039_0004558
349 Ga0501039_0020860
350 Ga0501039_0126993
351 Ga0501040_0002442
352 Ga0501040_0004768
353 Ga0501041_0054114
354 Ga0501042_0004218
355 Ga0501042_0166868
356 Ga0501043_0515116
357 Ga0501046_0005754
358 Ga0501048_0001355
359 Ga0501048_0004155
360 Ga0501068_0036655
361 Ga0501070_0143517
362 Ga0501071_0001717
363 Ga0501071_0002819
364 Ga0501072_0005844
365 Ga0501072_0029706
366 Ga0501073_0188645
367 Ga0501074_0058140
368 Ga0501075_0002567
369 Ga0501076_0000957
370 Ga0501076_0008238
371 Ga0501076_0234717
372 Ga0501077_0002148
373 Ga0501077_0014312
374 Ga0501079_0114668
375 Ga0501035_0112448
376 Ga0501044_0139417
377 Ga0501045_0011079
378 Ga0501045_0091930
379 nmdc:mga03683_391033_c1
380 nmdc:mga03n38_734970_c1
381 nmdc:mga0yw44_152086_c1
382 nmdc:mga0yw44_38746_c1
383 Ga0495601_0032459
384 Ga0500593_000014
385 Ga0501084_0007270
386 Ga0501084_0019762
387 Ga0501084_1050195
388 Ga0501082_0021382
389 Ga0501082_0097829
390 Ga0466962_0064604
391 Ga0466962_0326633
392 2643849905
393 2644135907
394 2644609765
395 2808874240
396 2812374919
397 2819666521
398 2857482575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04186

FxsA

FxsA cytoplasmic membrane protein

30

138

0.98

Map