F306039

General Info

Members Datasets Scaffolds Average Seq Length
199 171 398 196

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0126699|Ga0316574_0126699_300_977
Length 225
Sequence MFLFMTRGGRGLPSEEEEQMTRSDRWAQDHCIQKAAVAALFLLAGSSAAGAHEATGIAGGLLSGFTHPLFGWDHVAAMVAVGLWGAFLGAPAIWFLPIVFPLVMAFGAVLGILGVPLPAVEMGIAASALVLGVMVAIAAQPPLWVAGIIVGVFAIFHGHAHGTELPAAASALPYAAGFVFGTGLLHLLGIAFGLTTRWSWGAPAVRMAGGVIAFAGVAFLVSGWP

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
101 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
104 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
105 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
106 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
156 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
162 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
163 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
164 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
165 2738541293 Rhizobium sp. GV031 Isolate Unclassified
166 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
167 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
168 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
169 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
170 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
171 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0
Isolates 5.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.08
Nodule 1.51
Rhizoplane 2.01
Rhizosphere 69.85
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0126699 3300035398 Bacteria 1642
2 JGI25152J39213_1008680 3300002773 Bacteria 2496
3 Ga0070690_100591969 3300005330 Bacteria 841
4 Ga0070670_100208544 3300005331 Bacteria 1699
5 Ga0068869_100039777 3300005334 Bacteria 3359
6 Ga0070680_100203897 3300005336 Bacteria 1668
7 Ga0070660_100454329 3300005339 Bacteria 1063
8 Ga0070689_100129021 3300005340 Bacteria 2026
9 Ga0070692_10318116 3300005345 Bacteria 956
10 Ga0070668_101045575 3300005347 Bacteria 735
11 Ga0070669_100162634 3300005353 Bacteria 1736
12 Ga0070671_100110517 3300005355 Bacteria 2309
13 Ga0070674_100193894 3300005356 Bacteria 1564
14 Ga0070659_100466720 3300005366 Bacteria 1073
15 Ga0070667_100063394 3300005367 Bacteria 3132
16 Ga0070700_100436548 3300005441 Bacteria 993
17 Ga0070678_100543753 3300005456 Bacteria 1030
18 Ga0070662_100160951 3300005457 Bacteria 1756
19 Ga0070707_100403547 3300005468 Bacteria 1327
20 Ga0070699_100128191 3300005518 Bacteria 2235
21 Ga0070679_100345188 3300005530 Bacteria 1437
22 Ga0068853_100273138 3300005539 Bacteria 1557
23 Ga0070693_100377925 3300005547 Bacteria 976
24 Ga0070665_100527416 3300005548 Bacteria 1193
25 Ga0068852_100961527 3300005616 Bacteria 872
26 Ga0068864_100153917 3300005618 Bacteria 2085
27 Ga0068863_100138515 3300005841 Bacteria 2325
28 Ga0068858_100136576 3300005842 Bacteria 2301
29 Ga0068860_100226820 3300005843 Bacteria 1815
30 Ga0075365_10051547 3300006038 Bacteria 2718
31 Ga0075363_100002535 3300006048 Bacteria 7496
32 Ga0075363_100032699 3300006048 Bacteria 2703
33 Ga0075364_10060657 3300006051 Bacteria 2480
34 Ga0075362_10006744 3300006177 Bacteria 4291
35 Ga0075367_10031593 3300006178 Bacteria 3041
36 Ga0075366_10001985 3300006195 Bacteria 10354
37 Ga0075366_10283433 3300006195 Bacteria 1012
38 Ga0075370_10115349 3300006353 Bacteria 1561
39 Ga0075370_10180824 3300006353 Bacteria 1241
40 Ga0097620_100186790 3300006931 Bacteria 2156
41 Ga0075435_100078661 3300007076 Bacteria 2705
42 Ga0105244_10101756 3300009036 Bacteria 1405
43 Ga0111539_10089973 3300009094 Bacteria 3607
44 Ga0105245_10206816 3300009098 Bacteria 1887
45 Ga0105247_10035993 3300009101 Bacteria 3018
46 Ga0114129_10046606 3300009147 Bacteria 6091
47 Ga0105243_10158712 3300009148 Bacteria 1948
48 Ga0105242_10658307 3300009176 Bacteria 1019
49 Ga0099796_10007607 3300010159 Bacteria 2841
50 Ga0105246_10070185 3300011119 Bacteria 2463
51 Ga0157378_10069372 3300013297 Bacteria 3162
52 Ga0163163_10245239 3300014325 Bacteria 1842
53 Ga0157376_10087824 3300014969 Bacteria 2684
54 Ga0228598_1015147 3300024227 Unclassified 1523
55 Ga0209673_1006159 3300025273 Bacteria 5875
56 Ga0209025_1088814 3300025294 Bacteria 1018
57 Ga0209564_1039801 3300025295 Bacteria 1286
58 Ga0209256_1021013 3300025299 Bacteria 2020
59 Ga0207682_10000400 3300025893 Bacteria 19971
60 Ga0207645_10097398 3300025907 Bacteria 1896
61 Ga0207646_10452462 3300025922 Bacteria 1158
62 Ga0207681_10101926 3300025923 Bacteria 2072
63 Ga0207650_10106787 3300025925 Bacteria 2162
64 Ga0207650_10173103 3300025925 Bacteria 1717
65 Ga0207687_10252665 3300025927 Bacteria 1402
66 Ga0207690_10299902 3300025932 Bacteria 1257
67 Ga0207706_10236607 3300025933 Bacteria 1597
68 Ga0207709_10074676 3300025935 Bacteria 2164
69 Ga0207670_10189266 3300025936 Bacteria 1556
70 Ga0207704_10109222 3300025938 Bacteria 1865
71 Ga0207691_10146744 3300025940 Bacteria 2076
72 Ga0207689_10036157 3300025942 Bacteria 4101
73 Ga0207651_10294478 3300025960 Bacteria 1347
74 Ga0207668_10107206 3300025972 Bacteria 2089
75 Ga0207668_10296434 3300025972 Bacteria 1333
76 Ga0207668_11101980 3300025972 Bacteria 712
77 Ga0207703_10105094 3300026035 Bacteria 2400
78 Ga0207708_10120291 3300026075 Bacteria 2046
79 Ga0207641_10076957 3300026088 Bacteria 2886
80 Ga0207676_10034575 3300026095 Bacteria 3827
81 Ga0207674_10042715 3300026116 Bacteria 4679
82 Ga0207675_100289847 3300026118 Bacteria 1592
83 Ga0209813_10001943 3300027866 Bacteria 4673
84 Ga0268265_10414988 3300028380 Bacteria 1248
85 Ga0268264_10128385 3300028381 Bacteria 2244
86 Ga0265318_10008758 3300028577 Bacteria 4483
87 Ga0265330_10010680 3300031235 Bacteria 4321
88 Ga0265332_10006645 3300031238 Bacteria 5241
89 Ga0265320_10269821 3300031240 Bacteria 753
90 Ga0265325_10009000 3300031241 Bacteria 5861
91 Ga0265329_10006227 3300031242 Bacteria 4752
92 Ga0265340_10018490 3300031247 Bacteria 3593
93 Ga0265339_10029586 3300031249 Bacteria 3107
94 Ga0265331_10044907 3300031250 Bacteria 2135
95 Ga0265316_10038330 3300031344 Bacteria 3862
96 Ga0307513_10031555 3300031456 Bacteria 5997
97 Ga0265313_10032145 3300031595 Bacteria 2683
98 Ga0265314_10024262 3300031711 Bacteria 4600
99 Ga0265342_10010400 3300031712 Bacteria 6459
100 Ga0316576_10022899 3300031727 Bacteria 4345
101 Ga0316576_10070099 3300031727 Bacteria 2586
102 Ga0316578_10103795 3300031728 Bacteria 1705
103 Ga0316578_10188032 3300031728 Bacteria 1244
104 Ga0307405_10003445 3300031731 Bacteria 7264
105 Ga0307415_100614785 3300032126 Bacteria 969
106 Ga0316584_0055673 3300036712 Bacteria 2961
107 Ga0395905_0257376 3300037471 Bacteria 1630
108 Ga0400485_11311 3300038735 Bacteria 3203
109 Ga0400486_11969 3300038742 Bacteria 3934
110 Ga0400483_036464 3300039062 Bacteria 81870
111 Ga0400483_109164 3300039062 Bacteria 13550
112 Ga0400489_27663 3300039093 Bacteria 1020
113 Ga0400487_18228 3300039110 Bacteria 2567
114 Ga0439466_0206320 3300041411 Bacteria 597
115 Ga0439465_0019462 3300041413 Bacteria 2122
116 Ga0439434_0063144 3300042435 Bacteria 1160
117 Ga0451577_0226696 3300042876 Bacteria 1689
118 Ga0451576_0202465 3300045051 Bacteria 2073
119 Ga0495594_0092764 3300046499 Bacteria 1693
120 Ga0495666_0026782 3300046526 Bacteria 2839
121 Ga0495665_0064009 3300046531 Bacteria 1941
122 Ga0495656_0264558 3300046615 Bacteria 872
123 Ga0495624_0063839 3300046690 Bacteria 2302
124 Ga0495604_0027537 3300047317 Bacteria 4519
125 Ga0496101_0074397 3300048904 Unclassified 2498
126 Ga0496102_0127053 3300048905 Bacteria 2384
127 Ga0496104_0482987 3300048907 Bacteria 1150
128 Ga0496113_0629318 3300048916 Bacteria 859
129 Ga0496116_0000982 3300048919 Bacteria 35052
130 Ga0496117_0008461 3300048920 Bacteria 9767
131 Ga0496118_0006205 3300048921 Bacteria 13237
132 Ga0496121_0303082 3300048924 Bacteria 1083
133 Ga0496122_0003492 3300048925 Bacteria 20667
134 Ga0496123_0013610 3300048926 Bacteria 6811
135 Ga0496124_0000285 3300048927 Bacteria 95893
136 Ga0496125_0000078 3300048928 Bacteria 230157
137 Ga0496125_0289348 3300048928 Bacteria 1010
138 Ga0496126_0265930 3300048929 Bacteria 1425
139 Ga0501034_0132394 3300049571 Bacteria 2476
140 Ga0501040_0160603 3300049576 Bacteria 1589
141 Ga0501041_0168004 3300049577 Bacteria 1372
142 Ga0501041_0489074 3300049577 Bacteria 782
143 Ga0501042_0135056 3300049578 Unclassified 1779
144 Ga0501043_0406717 3300049579 Bacteria 1028
145 Ga0501043_0489520 3300049579 Bacteria 920
146 Ga0501048_0064669 3300049582 Unclassified 2587
147 Ga0501071_0219307 3300049587 Bacteria 1431
148 Ga0501072_0677825 3300049588 Unclassified 811
149 Ga0501072_0686983 3300049588 Bacteria 805
150 Ga0501073_0010114 3300049589 Bacteria 6934
151 Ga0501073_0013917 3300049589 Bacteria 5847
152 Ga0501074_0199547 3300049590 Bacteria 1426
153 Ga0501075_0267019 3300049591 Unclassified 1304
154 Ga0501075_0376819 3300049591 Bacteria 1082
155 Ga0501076_0072791 3300049592 Bacteria 2751
156 Ga0501076_0767524 3300049592 Bacteria 796
157 Ga0501077_0230461 3300049593 Unclassified 1177
158 Ga0501079_0039990 3300049741 Bacteria 3618
159 Ga0501081_0033027 3300049743 Bacteria 3514
160 Ga0501081_0907870 3300049743 Bacteria 664
161 Ga0501045_0383224 3300049824 Bacteria 1047
162 Ga0501045_0386996 3300049824 Bacteria 1041
163 nmdc:mga03683_371372_c1 3300050489 Bacteria 680
164 nmdc:mga03683_71123_c1 3300050489 Bacteria 1488
165 nmdc:mga03n38_180939_c1 3300050490 Bacteria 1080
166 nmdc:mga00v17_188212_c1 3300050491 Bacteria 1333
167 nmdc:mga00v17_246353_c1 3300050491 Bacteria 1159
168 nmdc:mga0yw44_219595_c1 3300050492 Bacteria 1259
169 nmdc:mga0yw44_314047_c1 3300050492 Bacteria 1052
170 nmdc:mga0yw44_575581_c1 3300050492 Bacteria 765
171 nmdc:mga0k408_19038_c1 3300050493 Bacteria 3834
172 nmdc:mga0k408_223813_c1 3300050493 Bacteria 1123
173 nmdc:mga06z11_3482_c1 3300050494 Bacteria 6096
174 nmdc:mga04h51_10198_c1 3300050495 Bacteria 2574
175 nmdc:mga05p37_3177_c1 3300050507 Bacteria 19113
176 nmdc:mga0n895_16198_c1 3300050512 Bacteria 6835
177 nmdc:mga0rr50_5735_c1 3300050513 Bacteria 7446
178 Ga0500595_171295 3300053119 Bacteria 603
179 Ga0500597_094774 3300053120 Bacteria 1297
180 Ga0500616_0043579 3300053153 Bacteria 2398
181 Ga0500616_0078327 3300053153 Unclassified 1667
182 Ga0501084_0119483 3300054114 Bacteria 2215
183 Ga0501084_0814577 3300054114 Bacteria 786
184 Ga0501082_0051463 3300060353 Bacteria 3550
185 Ga0501082_0757418 3300060353 Unclassified 850
186 Ga0530510_0230240 3300061734 Bacteria 1378
187 Ga0530510_0483459 3300061734 Unclassified 938
188 Ga0530510_0588573 3300061734 Bacteria 846
189 2514591341 2513237351 Bacteria 6968952
190 2585391332 2582581865 Bacteria 6644329
191 2585842939 2585427594 Bacteria 6180594
192 2644240986 2643221643 Bacteria 5749658
193 2738801556 2738541293 Bacteria 7065685
194 2834641733 2834641062 Bacteria 5559922
195 2838024795 2838022645 Bacteria 6494267
196 2842200100 2842198810 Bacteria 6608673
197 2923562726 2923556063 Bacteria 6793593
198 2941505400 2941499720 Bacteria 7599444
199 8003402783 8003400568 Bacteria 5535898
200 Ga0316574_0126699
201 JGI25152J39213_1008680
202 Ga0070690_100591969
203 Ga0070670_100208544
204 Ga0068869_100039777
205 Ga0070680_100203897
206 Ga0070660_100454329
207 Ga0070689_100129021
208 Ga0070692_10318116
209 Ga0070668_101045575
210 Ga0070669_100162634
211 Ga0070671_100110517
212 Ga0070674_100193894
213 Ga0070659_100466720
214 Ga0070667_100063394
215 Ga0070700_100436548
216 Ga0070678_100543753
217 Ga0070662_100160951
218 Ga0070707_100403547
219 Ga0070699_100128191
220 Ga0070679_100345188
221 Ga0068853_100273138
222 Ga0070693_100377925
223 Ga0070665_100527416
224 Ga0068852_100961527
225 Ga0068864_100153917
226 Ga0068863_100138515
227 Ga0068858_100136576
228 Ga0068860_100226820
229 Ga0075365_10051547
230 Ga0075363_100002535
231 Ga0075363_100032699
232 Ga0075364_10060657
233 Ga0075362_10006744
234 Ga0075367_10031593
235 Ga0075366_10001985
236 Ga0075366_10283433
237 Ga0075370_10115349
238 Ga0075370_10180824
239 Ga0097620_100186790
240 Ga0075435_100078661
241 Ga0105244_10101756
242 Ga0111539_10089973
243 Ga0105245_10206816
244 Ga0105247_10035993
245 Ga0114129_10046606
246 Ga0105243_10158712
247 Ga0105242_10658307
248 Ga0099796_10007607
249 Ga0105246_10070185
250 Ga0157378_10069372
251 Ga0163163_10245239
252 Ga0157376_10087824
253 Ga0228598_1015147
254 Ga0209673_1006159
255 Ga0209025_1088814
256 Ga0209564_1039801
257 Ga0209256_1021013
258 Ga0207682_10000400
259 Ga0207645_10097398
260 Ga0207646_10452462
261 Ga0207681_10101926
262 Ga0207650_10106787
263 Ga0207650_10173103
264 Ga0207687_10252665
265 Ga0207690_10299902
266 Ga0207706_10236607
267 Ga0207709_10074676
268 Ga0207670_10189266
269 Ga0207704_10109222
270 Ga0207691_10146744
271 Ga0207689_10036157
272 Ga0207651_10294478
273 Ga0207668_10107206
274 Ga0207668_10296434
275 Ga0207668_11101980
276 Ga0207703_10105094
277 Ga0207708_10120291
278 Ga0207641_10076957
279 Ga0207676_10034575
280 Ga0207674_10042715
281 Ga0207675_100289847
282 Ga0209813_10001943
283 Ga0268265_10414988
284 Ga0268264_10128385
285 Ga0265318_10008758
286 Ga0265330_10010680
287 Ga0265332_10006645
288 Ga0265320_10269821
289 Ga0265325_10009000
290 Ga0265329_10006227
291 Ga0265340_10018490
292 Ga0265339_10029586
293 Ga0265331_10044907
294 Ga0265316_10038330
295 Ga0307513_10031555
296 Ga0265313_10032145
297 Ga0265314_10024262
298 Ga0265342_10010400
299 Ga0316576_10022899
300 Ga0316576_10070099
301 Ga0316578_10103795
302 Ga0316578_10188032
303 Ga0307405_10003445
304 Ga0307415_100614785
305 Ga0316584_0055673
306 Ga0395905_0257376
307 Ga0400485_11311
308 Ga0400486_11969
309 Ga0400483_036464
310 Ga0400483_109164
311 Ga0400489_27663
312 Ga0400487_18228
313 Ga0439466_0206320
314 Ga0439465_0019462
315 Ga0439434_0063144
316 Ga0451577_0226696
317 Ga0451576_0202465
318 Ga0495594_0092764
319 Ga0495666_0026782
320 Ga0495665_0064009
321 Ga0495656_0264558
322 Ga0495624_0063839
323 Ga0495604_0027537
324 Ga0496101_0074397
325 Ga0496102_0127053
326 Ga0496104_0482987
327 Ga0496113_0629318
328 Ga0496116_0000982
329 Ga0496117_0008461
330 Ga0496118_0006205
331 Ga0496121_0303082
332 Ga0496122_0003492
333 Ga0496123_0013610
334 Ga0496124_0000285
335 Ga0496125_0000078
336 Ga0496125_0289348
337 Ga0496126_0265930
338 Ga0501034_0132394
339 Ga0501040_0160603
340 Ga0501041_0168004
341 Ga0501041_0489074
342 Ga0501042_0135056
343 Ga0501043_0406717
344 Ga0501043_0489520
345 Ga0501048_0064669
346 Ga0501071_0219307
347 Ga0501072_0677825
348 Ga0501072_0686983
349 Ga0501073_0010114
350 Ga0501073_0013917
351 Ga0501074_0199547
352 Ga0501075_0267019
353 Ga0501075_0376819
354 Ga0501076_0072791
355 Ga0501076_0767524
356 Ga0501077_0230461
357 Ga0501079_0039990
358 Ga0501081_0033027
359 Ga0501081_0907870
360 Ga0501045_0383224
361 Ga0501045_0386996
362 nmdc:mga03683_371372_c1
363 nmdc:mga03683_71123_c1
364 nmdc:mga03n38_180939_c1
365 nmdc:mga00v17_188212_c1
366 nmdc:mga00v17_246353_c1
367 nmdc:mga0yw44_219595_c1
368 nmdc:mga0yw44_314047_c1
369 nmdc:mga0yw44_575581_c1
370 nmdc:mga0k408_19038_c1
371 nmdc:mga0k408_223813_c1
372 nmdc:mga06z11_3482_c1
373 nmdc:mga04h51_10198_c1
374 nmdc:mga05p37_3177_c1
375 nmdc:mga0n895_16198_c1
376 nmdc:mga0rr50_5735_c1
377 Ga0500595_171295
378 Ga0500597_094774
379 Ga0500616_0043579
380 Ga0500616_0078327
381 Ga0501084_0119483
382 Ga0501084_0814577
383 Ga0501082_0051463
384 Ga0501082_0757418
385 Ga0530510_0230240
386 Ga0530510_0483459
387 Ga0530510_0588573
388 2514591341
389 2585391332
390 2585842939
391 2644240986
392 2738801556
393 2834641733
394 2838024795
395 2842200100
396 2923562726
397 2941505400
398 8003402783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04955

HupE_UreJ

HupE / UreJ protein

39

219

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.5133 39 188
4ikx-assembly1.cif.gz_A crystal structure of peptide transporter pot (e310q mutant) 0.4668 2 190
4ikx-assembly1.cif.gz_A crystal structure of peptide transporter pot (e310q mutant) 0.4579 2 190
4ybq-assembly1.cif.gz_A rat glut5 with fv in the outward-open form 0.4468 27 190
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.4386 39 190
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.626 38 191 1.20.1250.20
af_Q58955_3_381_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5685 39 190 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5314 38 191 1.20.1250.20
af_Q2FVN1_5_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.531 41 190 1.20.1250.20
af_Q9P6J7_45_305_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5286 39 193 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4P9UW31-F1-model_v4 TonB-dependent receptor 0.9869 34 161 GO:0009279
AF-A5E9C0-F1-model_v4 deleted 0.9865 34 193
AF-A0A3B8SS91-F1-model_v4 Ni/Fe hydrogenase 0.9798 34 190 GO:0016020
AF-A0A386USN2-F1-model_v4 Ni/Fe hydrogenase 0.9756 45 190 GO:0016020
AF-A0A3D2CX62-F1-model_v4 deleted 0.9727 45 190

Map