F306016

General Info

Members Datasets Scaffolds Average Seq Length
199 119 398 137

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0039268|Ga0373926_0039268_997_1464
Length 155
Sequence MLSFLDPLITIYSNRFEETQNMVQMDVVYEGKLRCKAKHGPSGNEIATDAPKDNQGRGEAFSPTDLVGAALGTCMLTIMGIYAQRHNLDLVGSSVRVEKEMVTEPIRRIGKLTVKFSVRGVPEPQRATLERAALTCPVHQSLHPDVKIVTEFKYE

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
71 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.01
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 0.5
Rhizosphere 94.97
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0039268 3300035083 Unclassified 1687
2 rootL2_10147591 3300003322 Unclassified 1895
3 rootH1_10149544 3300003323 Bacteria 3127
4 Ga0070658_10000004 3300005327 Bacteria 402230
5 Ga0070683_100006021 3300005329 Bacteria 10165
6 Ga0068869_100000091 3300005334 Bacteria 41599
7 Ga0068868_100054272 3300005338 Bacteria 3158
8 Ga0068868_100839169 3300005338 Bacteria 832
9 Ga0070660_100893949 3300005339 Bacteria 749
10 Ga0070660_101064097 3300005339 Unclassified 684
11 Ga0070687_100835767 3300005343 Bacteria 655
12 Ga0070713_100005680 3300005436 Bacteria 8561
13 Ga0070713_101257630 3300005436 Unclassified 717
14 Ga0070663_100497696 3300005455 Bacteria 1012
15 Ga0068867_100010767 3300005459 Bacteria 6450
16 Ga0070706_100488659 3300005467 Unclassified 1145
17 Ga0070679_100074591 3300005530 Bacteria 3383
18 Ga0070679_100246439 3300005530 Unclassified 1743
19 Ga0068855_100020500 3300005563 Bacteria 7927
20 Ga0068855_100614163 3300005563 Bacteria 1171
21 Ga0068855_101010263 3300005563 Bacteria 873
22 Ga0068856_100305940 3300005614 Bacteria 1607
23 Ga0068852_100293356 3300005616 Bacteria 1572
24 Ga0070717_10475934 3300006028 Bacteria 1127
25 Ga0075364_10004479 3300006051 Bacteria 8046
26 Ga0075362_10000014 3300006177 Bacteria 98315
27 Ga0097621_100011733 3300006237 Bacteria 6471
28 Ga0097621_101432152 3300006237 Bacteria 655
29 Ga0068871_100141014 3300006358 Bacteria 2050
30 Ga0068865_100000512 3300006881 Bacteria 21691
31 Ga0105240_11469038 3300009093 Bacteria 715
32 Ga0105247_10128382 3300009101 Bacteria 1650
33 Ga0105238_10679081 3300009551 Unclassified 1041
34 Ga0105239_11468268 3300010375 Unclassified 788
35 Ga0157370_10028905 3300013104 Bacteria 5449
36 Ga0157370_10740102 3300013104 Unclassified 896
37 Ga0157370_10921919 3300013104 Bacteria 792
38 Ga0157369_10104683 3300013105 Bacteria 3013
39 Ga0157369_11429408 3300013105 Bacteria 704
40 Ga0157372_10078190 3300013307 Bacteria 3738
41 Ga0157372_10130259 3300013307 Bacteria 2894
42 Ga0163163_12422623 3300014325 Unclassified 583
43 Ga0157379_11700721 3300014968 Unclassified 618
44 Ga0157376_10552751 3300014969 Bacteria 1139
45 Ga0207710_10086118 3300025900 Bacteria 1464
46 Ga0207705_10000077 3300025909 Bacteria 122309
47 Ga0207693_10182090 3300025915 Bacteria 1653
48 Ga0207662_10349706 3300025918 Bacteria 992
49 Ga0207652_10088718 3300025921 Bacteria 2714
50 Ga0207652_10986129 3300025921 Bacteria 741
51 Ga0207700_10013674 3300025928 Bacteria 5291
52 Ga0207700_11220412 3300025928 Unclassified 671
53 Ga0207704_10004335 3300025938 Bacteria 6487
54 Ga0207689_10000202 3300025942 Bacteria 52492
55 Ga0207661_10012685 3300025944 Bacteria 6135
56 Ga0207667_10001492 3300025949 Bacteria 29378
57 Ga0207667_10824389 3300025949 Bacteria 923
58 Ga0207677_10814147 3300026023 Bacteria 837
59 Ga0207678_10008531 3300026067 Bacteria 9029
60 Ga0207698_10121487 3300026142 Unclassified 2212
61 Ga0265337_1006353 3300028556 Bacteria 4570
62 Ga0265337_1064058 3300028556 Unclassified 1015
63 Ga0265319_1000206 3300028563 Bacteria 44786
64 Ga0265319_1001124 3300028563 Bacteria 16624
65 Ga0265319_1003422 3300028563 Bacteria 8277
66 Ga0265319_1009328 3300028563 Bacteria 4190
67 Ga0265319_1020187 3300028563 Bacteria 2475
68 Ga0265319_1024286 3300028563 Bacteria 2184
69 Ga0265319_1026512 3300028563 Bacteria 2063
70 Ga0265319_1041247 3300028563 Bacteria 1558
71 Ga0265319_1073743 3300028563 Unclassified 1091
72 Ga0265334_10008869 3300028573 Bacteria 4270
73 Ga0265318_10000485 3300028577 Bacteria 29338
74 Ga0265318_10007215 3300028577 Bacteria 5046
75 Ga0265318_10007874 3300028577 Bacteria 4784
76 Ga0265318_10013545 3300028577 Bacteria 3441
77 Ga0265318_10021307 3300028577 Bacteria 2603
78 Ga0265323_10000024 3300028653 Bacteria 82291
79 Ga0265322_10001034 3300028654 Bacteria 9648
80 Ga0265322_10022727 3300028654 Unclassified 1794
81 Ga0265336_10023553 3300028666 Bacteria 1951
82 Ga0265338_10001187 3300028800 Bacteria 42989
83 Ga0265338_10006954 3300028800 Bacteria 14227
84 Ga0265338_10065509 3300028800 Bacteria 3150
85 Ga0265338_10264284 3300028800 Unclassified 1264
86 Ga0265338_10427012 3300028800 Bacteria 941
87 Ga0265324_10002395 3300029957 Bacteria 9652
88 Ga0265324_10004224 3300029957 Bacteria 6568
89 Ga0265324_10155398 3300029957 Unclassified 777
90 Ga0265770_1003552 3300030878 Bacteria 2119
91 Ga0265765_1006355 3300030879 Bacteria 1255
92 Ga0265332_10079850 3300031238 Bacteria 1388
93 Ga0265320_10000113 3300031240 Bacteria 70098
94 Ga0265320_10000116 3300031240 Bacteria 69236
95 Ga0265320_10000301 3300031240 Bacteria 40337
96 Ga0265320_10000968 3300031240 Bacteria 21363
97 Ga0265320_10001760 3300031240 Bacteria 15347
98 Ga0265320_10004525 3300031240 Bacteria 9103
99 Ga0265320_10009995 3300031240 Bacteria 5675
100 Ga0265320_10022412 3300031240 Bacteria 3379
101 Ga0265320_10029036 3300031240 Bacteria 2865
102 Ga0265320_10033085 3300031240 Unclassified 2642
103 Ga0265320_10039260 3300031240 Bacteria 2369
104 Ga0265320_10051520 3300031240 Bacteria 1996
105 Ga0265320_10069316 3300031240 Bacteria 1665
106 Ga0265325_10010579 3300031241 Bacteria 5338
107 Ga0265325_10027791 3300031241 Bacteria 3055
108 Ga0265339_10016532 3300031249 Unclassified 4396
109 Ga0265339_10044530 3300031249 Bacteria 2448
110 Ga0265339_10110588 3300031249 Bacteria 1422
111 Ga0265331_10019726 3300031250 Bacteria 3476
112 Ga0265327_10064952 3300031251 Bacteria 1848
113 Ga0265316_10005701 3300031344 Bacteria 12041
114 Ga0265316_10008507 3300031344 Bacteria 9515
115 Ga0265316_10069239 3300031344 Bacteria 2723
116 Ga0265316_10101951 3300031344 Bacteria 2180
117 Ga0265316_10188149 3300031344 Bacteria 1535
118 Ga0265316_10927777 3300031344 Unclassified 607
119 Ga0307509_10721016 3300031507 Bacteria 663
120 Ga0265313_10001621 3300031595 Bacteria 20889
121 Ga0265313_10004375 3300031595 Bacteria 10901
122 Ga0265313_10036843 3300031595 Bacteria 2452
123 Ga0265313_10339166 3300031595 Bacteria 597
124 Ga0265314_10005423 3300031711 Bacteria 11523
125 Ga0265314_10083031 3300031711 Bacteria 2107
126 Ga0265314_10189756 3300031711 Unclassified 1224
127 Ga0265314_10694747 3300031711 Bacteria 515
128 Ga0265342_10003401 3300031712 Bacteria 13099
129 Ga0265342_10014315 3300031712 Bacteria 5270
130 Ga0307405_11239480 3300031731 Unclassified 647
131 Ga0373934_0180788 3300035086 Bacteria 867
132 Ga0373939_0164685 3300035114 Unclassified 816
133 Ga0373943_0194210 3300035170 Bacteria 1121
134 Ga0373935_0067576 3300035692 Bacteria 2298
135 Ga0373927_0004566 3300035695 Bacteria 9671
136 Ga0373933_0438190 3300035724 Bacteria 854
137 Ga0373937_0253838 3300036401 Bacteria 1658
138 Ga0373937_1226510 3300036401 Bacteria 698
139 Ga0373925_0000443 3300037068 Bacteria 41822
140 Ga0395900_0875271 3300037418 Bacteria 823
141 Ga0395905_0000010 3300037471 Bacteria 460729
142 Ga0395905_0721137 3300037471 Bacteria 899
143 Ga0466966_0108531 3300044684 Bacteria 1712
144 Ga0466961_0054688 3300044693 Bacteria 2546
145 Ga0466963_0492747 3300044694 Bacteria 865
146 Ga0453684_0015722 3300044712 Bacteria 11920
147 Ga0466970_0193053 3300044765 Bacteria 1132
148 Ga0451576_0000864 3300045051 Bacteria 58408
149 Ga0495592_0201665 3300046454 Bacteria 1342
150 Ga0495651_0273132 3300046462 Bacteria 1145
151 Ga0495628_0199772 3300046516 Bacteria 1507
152 Ga0495666_0034649 3300046526 Bacteria 2462
153 Ga0495587_0054097 3300046536 Bacteria 2366
154 Ga0495645_0004055 3300046543 Bacteria 10000
155 Ga0495645_0486366 3300046543 Bacteria 773
156 Ga0495635_0128057 3300046663 Bacteria 1731
157 Ga0495604_0185142 3300047317 Bacteria 1455
158 Ga0495684_0039396 3300047471 Bacteria 3622
159 Ga0496107_0954210 3300048910 Unclassified 624
160 Ga0501031_0233876 3300049568 Bacteria 1195
161 Ga0501032_0015349 3300049569 Bacteria 5406
162 Ga0501032_0306801 3300049569 Bacteria 1026
163 Ga0501032_0418001 3300049569 Bacteria 860
164 Ga0501033_0000585 3300049570 Bacteria 33747
165 Ga0501033_0140825 3300049570 Bacteria 1743
166 Ga0501033_0252813 3300049570 Bacteria 1248
167 Ga0501034_0034546 3300049571 Bacteria 5126
168 Ga0501036_0181743 3300049572 Bacteria 1770
169 Ga0501036_1015913 3300049572 Bacteria 679
170 Ga0501037_0000637 3300049573 Bacteria 27146
171 Ga0501037_0002017 3300049573 Bacteria 14717
172 Ga0501038_0005300 3300049574 Bacteria 11979
173 Ga0501038_0592954 3300049574 Bacteria 839
174 Ga0501038_0884939 3300049574 Bacteria 660
175 Ga0501042_0025878 3300049578 Bacteria 4124
176 Ga0501043_0048642 3300049579 Bacteria 3333
177 Ga0501043_0226217 3300049579 Bacteria 1446
178 Ga0501046_0016781 3300049580 Bacteria 6121
179 Ga0501046_0098101 3300049580 Bacteria 2250
180 Ga0501046_0156456 3300049580 Bacteria 1716
181 Ga0501047_0134966 3300049581 Bacteria 2348
182 Ga0501047_0386876 3300049581 Bacteria 1232
183 Ga0501048_0010423 3300049582 Bacteria 6941
184 Ga0501048_0751388 3300049582 Bacteria 701
185 Ga0501080_1022537 3300049742 Bacteria 716
186 Ga0501081_0274630 3300049743 Bacteria 1233
187 Ga0501035_0018597 3300049822 Bacteria 6399
188 Ga0501035_0021664 3300049822 Bacteria 5910
189 Ga0501044_0021623 3300049823 Bacteria 6859
190 Ga0501044_0022559 3300049823 Bacteria 6707
191 Ga0501044_0297817 3300049823 Bacteria 1542
192 Ga0501045_0244732 3300049824 Bacteria 1335
193 nmdc:mga03683_9_c1 3300050489 Bacteria 137145
194 nmdc:mga00v17_212_c1 3300050491 Bacteria 34966
195 nmdc:mga05p37_1632360_c1 3300050507 Bacteria 633
196 nmdc:mga0n895_934241_c1 3300050512 Bacteria 851
197 Ga0500651_0227883 3300053093 Bacteria 1090
198 Ga0501082_0436420 3300060353 Bacteria 1144
199 2788435937 2786546940 Bacteria 6396474
200 Ga0373926_0039268
201 rootL2_10147591
202 rootH1_10149544
203 Ga0070658_10000004
204 Ga0070683_100006021
205 Ga0068869_100000091
206 Ga0068868_100054272
207 Ga0068868_100839169
208 Ga0070660_100893949
209 Ga0070660_101064097
210 Ga0070687_100835767
211 Ga0070713_100005680
212 Ga0070713_101257630
213 Ga0070663_100497696
214 Ga0068867_100010767
215 Ga0070706_100488659
216 Ga0070679_100074591
217 Ga0070679_100246439
218 Ga0068855_100020500
219 Ga0068855_100614163
220 Ga0068855_101010263
221 Ga0068856_100305940
222 Ga0068852_100293356
223 Ga0070717_10475934
224 Ga0075364_10004479
225 Ga0075362_10000014
226 Ga0097621_100011733
227 Ga0097621_101432152
228 Ga0068871_100141014
229 Ga0068865_100000512
230 Ga0105240_11469038
231 Ga0105247_10128382
232 Ga0105238_10679081
233 Ga0105239_11468268
234 Ga0157370_10028905
235 Ga0157370_10740102
236 Ga0157370_10921919
237 Ga0157369_10104683
238 Ga0157369_11429408
239 Ga0157372_10078190
240 Ga0157372_10130259
241 Ga0163163_12422623
242 Ga0157379_11700721
243 Ga0157376_10552751
244 Ga0207710_10086118
245 Ga0207705_10000077
246 Ga0207693_10182090
247 Ga0207662_10349706
248 Ga0207652_10088718
249 Ga0207652_10986129
250 Ga0207700_10013674
251 Ga0207700_11220412
252 Ga0207704_10004335
253 Ga0207689_10000202
254 Ga0207661_10012685
255 Ga0207667_10001492
256 Ga0207667_10824389
257 Ga0207677_10814147
258 Ga0207678_10008531
259 Ga0207698_10121487
260 Ga0265337_1006353
261 Ga0265337_1064058
262 Ga0265319_1000206
263 Ga0265319_1001124
264 Ga0265319_1003422
265 Ga0265319_1009328
266 Ga0265319_1020187
267 Ga0265319_1024286
268 Ga0265319_1026512
269 Ga0265319_1041247
270 Ga0265319_1073743
271 Ga0265334_10008869
272 Ga0265318_10000485
273 Ga0265318_10007215
274 Ga0265318_10007874
275 Ga0265318_10013545
276 Ga0265318_10021307
277 Ga0265323_10000024
278 Ga0265322_10001034
279 Ga0265322_10022727
280 Ga0265336_10023553
281 Ga0265338_10001187
282 Ga0265338_10006954
283 Ga0265338_10065509
284 Ga0265338_10264284
285 Ga0265338_10427012
286 Ga0265324_10002395
287 Ga0265324_10004224
288 Ga0265324_10155398
289 Ga0265770_1003552
290 Ga0265765_1006355
291 Ga0265332_10079850
292 Ga0265320_10000113
293 Ga0265320_10000116
294 Ga0265320_10000301
295 Ga0265320_10000968
296 Ga0265320_10001760
297 Ga0265320_10004525
298 Ga0265320_10009995
299 Ga0265320_10022412
300 Ga0265320_10029036
301 Ga0265320_10033085
302 Ga0265320_10039260
303 Ga0265320_10051520
304 Ga0265320_10069316
305 Ga0265325_10010579
306 Ga0265325_10027791
307 Ga0265339_10016532
308 Ga0265339_10044530
309 Ga0265339_10110588
310 Ga0265331_10019726
311 Ga0265327_10064952
312 Ga0265316_10005701
313 Ga0265316_10008507
314 Ga0265316_10069239
315 Ga0265316_10101951
316 Ga0265316_10188149
317 Ga0265316_10927777
318 Ga0307509_10721016
319 Ga0265313_10001621
320 Ga0265313_10004375
321 Ga0265313_10036843
322 Ga0265313_10339166
323 Ga0265314_10005423
324 Ga0265314_10083031
325 Ga0265314_10189756
326 Ga0265314_10694747
327 Ga0265342_10003401
328 Ga0265342_10014315
329 Ga0307405_11239480
330 Ga0373934_0180788
331 Ga0373939_0164685
332 Ga0373943_0194210
333 Ga0373935_0067576
334 Ga0373927_0004566
335 Ga0373933_0438190
336 Ga0373937_0253838
337 Ga0373937_1226510
338 Ga0373925_0000443
339 Ga0395900_0875271
340 Ga0395905_0000010
341 Ga0395905_0721137
342 Ga0466966_0108531
343 Ga0466961_0054688
344 Ga0466963_0492747
345 Ga0453684_0015722
346 Ga0466970_0193053
347 Ga0451576_0000864
348 Ga0495592_0201665
349 Ga0495651_0273132
350 Ga0495628_0199772
351 Ga0495666_0034649
352 Ga0495587_0054097
353 Ga0495645_0004055
354 Ga0495645_0486366
355 Ga0495635_0128057
356 Ga0495604_0185142
357 Ga0495684_0039396
358 Ga0496107_0954210
359 Ga0501031_0233876
360 Ga0501032_0015349
361 Ga0501032_0306801
362 Ga0501032_0418001
363 Ga0501033_0000585
364 Ga0501033_0140825
365 Ga0501033_0252813
366 Ga0501034_0034546
367 Ga0501036_0181743
368 Ga0501036_1015913
369 Ga0501037_0000637
370 Ga0501037_0002017
371 Ga0501038_0005300
372 Ga0501038_0592954
373 Ga0501038_0884939
374 Ga0501042_0025878
375 Ga0501043_0048642
376 Ga0501043_0226217
377 Ga0501046_0016781
378 Ga0501046_0098101
379 Ga0501046_0156456
380 Ga0501047_0134966
381 Ga0501047_0386876
382 Ga0501048_0010423
383 Ga0501048_0751388
384 Ga0501080_1022537
385 Ga0501081_0274630
386 Ga0501035_0018597
387 Ga0501035_0021664
388 Ga0501044_0021623
389 Ga0501044_0022559
390 Ga0501044_0297817
391 Ga0501045_0244732
392 nmdc:mga03683_9_c1
393 nmdc:mga00v17_212_c1
394 nmdc:mga05p37_1632360_c1
395 nmdc:mga0n895_934241_c1
396 Ga0500651_0227883
397 Ga0501082_0436420
398 2788435937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

56

151

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yby-assembly1.cif.gz_B conserved hypothetical protein cth-95 from clostridium thermocellum 0.7104 3 31
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.695 1 133
6g6i-assembly1.cif.gz_A-2 mamm ctd w247a 0.6944 41 134
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.6856 4 134
1otg-assembly1.cif.gz_C 5-carboxymethyl-2-hydroxymuconate isomerase 0.6722 90 134
ID Description Score Start End Superfamily
af_O80603_51_399_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8356 3 27 2.130.10.10
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.806 41 134 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8 41 134 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7968 41 135 3.30.300.20
5znkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.7952 13 28 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A348NP85-F1-model_v4 Osmotically inducible protein OsmC 0.9786 71 134
AF-A0A2V6HGE4-F1-model_v4 Osmotically inducible protein OsmC 0.9684 40 136
AF-T0PRH9-F1-model_v4 deleted 0.9558 55 135
AF-A0A2V5NMI5-F1-model_v4 Osmotically inducible protein OsmC 0.9541 55 136
AF-A0A382KG31-F1-model_v4 OsmC family protein 0.9537 40 133 GO:0016020

Map