F305870

General Info

Members Datasets Scaffolds Average Seq Length
199 136 199 144

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10326374|Ga0207657_103263742
Length 165
Sequence MESKAKECQAPANVEHSVSRSRLVGINHVALEVGDLDEALAFYGQVFEVHLRGRIPGMAFIDAGDQFIALSQGRGQAPDPDRHFGLVVDDKQAVRAALEAAGADIVPSRGLDFRDPWGNLVQVVEYGDVQFTKTPEVLRAMGLDGLGKTPAALGELREKGVEVAV

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
66 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
67 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
68 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
69 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
70 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
71 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
82 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.56
Rhizosphere 81.41
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10074400 3300003373 Archaea 847
2 Ga0070676_10394828 3300005328 Bacteria 961
3 Ga0070687_100534668 3300005343 Bacteria 795
4 Ga0070668_100812968 3300005347 Bacteria 831
5 Ga0070669_100298464 3300005353 Archaea 1295
6 Ga0068867_100849540 3300005459 Bacteria 818
7 Ga0070679_101296515 3300005530 Bacteria 674
8 Ga0070684_100030066 3300005535 Bacteria 4612
9 Ga0070684_100561542 3300005535 Bacteria 1060
10 Ga0070695_101450214 3300005545 Bacteria 570
11 Ga0070693_100662941 3300005547 Archaea 760
12 Ga0068855_101577232 3300005563 Bacteria 672
13 Ga0070664_100736033 3300005564 Bacteria 920
14 Ga0070664_100749234 3300005564 Bacteria 912
15 Ga0068856_101277133 3300005614 Unclassified 750
16 Ga0068852_101544269 3300005616 Archaea 686
17 Ga0068863_100974544 3300005841 Bacteria 850
18 Ga0081455_10217649 3300005937 Unclassified 1418
19 Ga0081455_10259104 3300005937 Bacteria 1267
20 Ga0081538_10000206 3300005981 Bacteria 65455
21 Ga0081538_10008148 3300005981 Bacteria 8942
22 Ga0081538_10036091 3300005981 Bacteria 3233
23 Ga0081540_1021419 3300005983 Bacteria 3849
24 Ga0081540_1166872 3300005983 Bacteria 845
25 Ga0081540_1181174 3300005983 Bacteria 788
26 Ga0081539_10025334 3300005985 Bacteria 3824
27 Ga0075428_100057005 3300006844 Bacteria 4278
28 Ga0075430_100001252 3300006846 Bacteria 20440
29 Ga0075430_100576831 3300006846 Bacteria 928
30 Ga0075431_100198292 3300006847 Bacteria 2055
31 Ga0105245_10164140 3300009098 Bacteria 2110
32 Ga0105245_10681365 3300009098 Bacteria 1060
33 Ga0114129_10052782 3300009147 Bacteria 5705
34 Ga0114129_10103593 3300009147 Bacteria 3934
35 Ga0105241_11514167 3300009174 Unclassified 646
36 Ga0105241_12194222 3300009174 Bacteria 547
37 Ga0105242_10856775 3300009176 Bacteria 905
38 Ga0105242_11624729 3300009176 Bacteria 681
39 Ga0105242_12081702 3300009176 Bacteria 611
40 Ga0105249_12746098 3300009553 Archaea 564
41 Ga0157378_11767774 3300013297 Bacteria 666
42 Ga0157378_13003343 3300013297 Bacteria 523
43 Ga0163163_11725805 3300014325 Bacteria 687
44 Ga0157380_10445704 3300014326 Bacteria 1242
45 Ga0206352_10155341 3300020078 Bacteria 623
46 Ga0213874_10143966 3300021377 Bacteria 827
47 Ga0207642_10631358 3300025899 Bacteria 669
48 Ga0207710_10244912 3300025900 Bacteria 895
49 Ga0207671_10760931 3300025914 Bacteria 769
50 Ga0207657_10326374 3300025919 Bacteria 1213
51 Ga0207687_10147499 3300025927 Bacteria 1791
52 Ga0207690_11521568 3300025932 Bacteria 559
53 Ga0207686_10172233 3300025934 Bacteria 1528
54 Ga0207709_10700720 3300025935 Bacteria 810
55 Ga0207669_10102691 3300025937 Bacteria 1895
56 Ga0207711_10220379 3300025941 Bacteria 1735
57 Ga0207661_10096108 3300025944 Bacteria 2478
58 Ga0207679_10628475 3300025945 Bacteria 970
59 Ga0207679_10675567 3300025945 Bacteria 936
60 Ga0207679_11164226 3300025945 Unclassified 708
61 Ga0207667_12215905 3300025949 Bacteria 506
62 Ga0207712_12019965 3300025961 Bacteria 516
63 Ga0207702_10176355 3300026078 Bacteria 1964
64 Ga0207648_11366710 3300026089 Bacteria 666
65 Ga0207674_10217280 3300026116 Bacteria 1860
66 Ga0268266_11606813 3300028379 Bacteria 626
67 Ga0307408_100581959 3300031548 Bacteria 992
68 Ga0307407_10186557 3300031903 Bacteria 1379
69 Ga0307409_100200293 3300031995 Bacteria 1786
70 Ga0307409_100251800 3300031995 Bacteria 1615
71 Ga0307416_100048316 3300032002 Bacteria 3375
72 Ga0373943_0275373 3300035170 Archaea 950
73 Ga0373925_0181144 3300037068 Archaea 1668
74 Ga0395899_0006243 3300037312 Bacteria 9231
75 Ga0395899_0259687 3300037312 Unclassified 1189
76 Ga0395900_0744288 3300037418 Bacteria 911
77 Ga0395905_0078832 3300037471 Bacteria 3087
78 Ga0436364_0356927 3300037853 Unclassified 1946
79 Ga0436364_0563145 3300037853 Unclassified 966
80 Ga0395901_0085569 3300038443 Bacteria 3296
81 Ga0436365_0460883 3300039437 Archaea 900
82 Ga0436365_0498783 3300039437 Bacteria 936
83 Ga0436365_1632438 3300039437 Bacteria 1376
84 Ga0436363_0236964 3300039450 Archaea 518
85 Ga0439436_0085347 3300041404 Bacteria 879
86 Ga0439461_0014902 3300041410 Bacteria 1484
87 Ga0439431_0073510 3300041997 Bacteria 914
88 Ga0439437_003380 3300042000 Bacteria 1720
89 Ga0439463_081948 3300042016 Bacteria 830
90 Ga0439446_0015697 3300042156 Bacteria 2102
91 Ga0439434_0025682 3300042435 Bacteria 1778
92 Ga0439434_0087207 3300042435 Bacteria 995
93 Ga0439464_0262713 3300042439 Bacteria 559
94 Ga0466960_1049747 3300044901 Bacteria 502
95 Ga0451576_1172099 3300045051 Bacteria 803
96 Ga0466967_0174412 3300045976 Bacteria 2025
97 Ga0466967_0239152 3300045976 Bacteria 1731
98 Ga0466967_0398518 3300045976 Bacteria 1339
99 Ga0495627_209180 3300046453 Bacteria 537
100 Ga0495603_0120337 3300046455 Archaea 1530
101 Ga0495590_0299603 3300046457 Bacteria 605
102 Ga0495641_0049693 3300046461 Archaea 1919
103 Ga0495580_0462547 3300046472 Archaea 850
104 Ga0495605_0162708 3300046474 Bacteria 990
105 Ga0495605_0175481 3300046474 Archaea 945
106 Ga0495584_0221094 3300046491 Bacteria 963
107 Ga0495584_0427208 3300046491 Archaea 674
108 Ga0495596_0022788 3300046500 Bacteria 2547
109 Ga0495607_0528914 3300046501 Archaea 520
110 Ga0495616_0289601 3300046513 Bacteria 694
111 Ga0495631_0086310 3300046518 Unclassified 1352
112 Ga0495598_0054243 3300046537 Unclassified 1217
113 Ga0495598_0217091 3300046537 Bacteria 697
114 Ga0495609_0073694 3300046538 Archaea 1498
115 Ga0495633_0481693 3300046558 Unclassified 560
116 Ga0495656_0711544 3300046615 Unclassified 541
117 Ga0495611_0286247 3300046648 Bacteria 761
118 Ga0495661_0070601 3300046665 Bacteria 2044
119 Ga0495661_0096391 3300046665 Bacteria 1673
120 Ga0495669_0322421 3300046684 Unclassified 746
121 Ga0495624_0534666 3300046690 Archaea 700
122 Ga0495589_0066994 3300046794 Bacteria 1758
123 Ga0495589_0081702 3300046794 Archaea 1572
124 Ga0495589_0127437 3300046794 Bacteria 1224
125 Ga0495676_0230692 3300047321 Archaea 1272
126 Ga0495686_0469373 3300047472 Archaea 666
127 Ga0495626_0273742 3300048091 Archaea 672
128 Ga0496100_0082870 3300048903 Bacteria 2170
129 Ga0496100_1015636 3300048903 Bacteria 653
130 Ga0496101_0153655 3300048904 Bacteria 1762
131 Ga0496103_0826476 3300048906 Bacteria 583
132 Ga0496104_0030436 3300048907 Bacteria 5016
133 Ga0496105_0172423 3300048908 Bacteria 1773
134 Ga0496107_0249091 3300048910 Bacteria 1322
135 Ga0496108_0000712 3300048911 Bacteria 25838
136 Ga0496108_0067696 3300048911 Bacteria 3012
137 Ga0496109_0001732 3300048912 Bacteria 18212
138 Ga0496109_0034045 3300048912 Bacteria 4585
139 Ga0496110_0002009 3300048913 Bacteria 15145
140 Ga0496110_0057070 3300048913 Bacteria 3436
141 Ga0496110_0147785 3300048913 Bacteria 2127
142 Ga0496110_0275820 3300048913 Bacteria 1531
143 Ga0496111_0004528 3300048914 Bacteria 8794
144 Ga0496111_0019439 3300048914 Bacteria 4718
145 Ga0496111_0275054 3300048914 Bacteria 1249
146 Ga0496112_0016833 3300048915 Bacteria 6859
147 Ga0496112_0081275 3300048915 Bacteria 3205
148 Ga0496112_0461153 3300048915 Bacteria 1208
149 Ga0496112_0919677 3300048915 Bacteria 796
150 Ga0496113_0033906 3300048916 Bacteria 3721
151 Ga0496113_0060505 3300048916 Bacteria 2855
152 Ga0496113_0401197 3300048916 Bacteria 1101
153 Ga0496117_0474043 3300048920 Archaea 613
154 Ga0496118_0032547 3300048921 Bacteria 4292
155 Ga0496121_0004578 3300048924 Bacteria 18441
156 Ga0496121_0169426 3300048924 Bacteria 1588
157 Ga0496125_0020290 3300048928 Bacteria 6239
158 Ga0501031_0194651 3300049568 Archaea 1323
159 Ga0501036_0051241 3300049572 Archaea 3495
160 Ga0501038_0339445 3300049574 Archaea 1172
161 Ga0501040_0079059 3300049576 Archaea 2276
162 Ga0501040_0492041 3300049576 Bacteria 884
163 Ga0501040_1179658 3300049576 Unclassified 556
164 Ga0501042_0105450 3300049578 Unclassified 2029
165 Ga0501042_0266900 3300049578 Bacteria 1236
166 Ga0501067_0200541 3300049583 Bacteria 1111
167 Ga0501070_0992018 3300049586 Unclassified 652
168 Ga0501071_0252127 3300049587 Archaea 1332
169 Ga0501072_0012194 3300049588 Bacteria 6569
170 Ga0501072_0119903 3300049588 Bacteria 2096
171 Ga0501072_1082846 3300049588 Unclassified 624
172 Ga0501072_1103645 3300049588 Bacteria 617
173 Ga0501074_1033237 3300049590 Archaea 578
174 Ga0501074_1126294 3300049590 Unclassified 551
175 Ga0501075_0029141 3300049591 Bacteria 4081
176 Ga0501075_0111759 3300049591 Archaea 2078
177 Ga0501076_0090892 3300049592 Archaea 2455
178 Ga0501076_0424461 3300049592 Unclassified 1094
179 Ga0501076_1461612 3300049592 Archaea 561
180 Ga0501077_0825991 3300049593 Archaea 596
181 Ga0501079_0171711 3300049741 Archaea 1691
182 Ga0501081_0052103 3300049743 Archaea 2823
183 Ga0501081_0248931 3300049743 Bacteria 1297
184 Ga0501081_1004386 3300049743 Archaea 630
185 Ga0501045_0093116 3300049824 Bacteria 2229
186 Ga0501045_0161612 3300049824 Archaea 1667
187 Ga0501045_0318683 3300049824 Bacteria 1157
188 Ga0501045_0405268 3300049824 Bacteria 1015
189 Ga0501045_0459094 3300049824 Unclassified 947
190 nmdc:mga05p37_1075750_c1 3300050507 Bacteria 845
191 nmdc:mga05p37_241980_c1 3300050507 Bacteria 2169
192 nmdc:mga09592_838624_c1 3300050508 Bacteria 776
193 nmdc:mga0qj67_26424_c1 3300050509 Bacteria 4494
194 nmdc:mga06r32_15725_c1 3300050510 Bacteria 6876
195 Ga0495655_0124486 3300053083 Archaea 788
196 Ga0501084_0216494 3300054114 Archaea 1616
197 Ga0501084_0225607 3300054114 Bacteria 1581
198 Ga0501084_0258960 3300054114 Bacteria 1469
199 Ga0501082_0431667 3300060353 Archaea 1151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_1461612 Ga0501076_1461612_89_493 134
2 3300049741 Ga0501079_0171711 Ga0501079_0171711_1241_1645 134
3 3300049743 Ga0501081_1004386 Ga0501081_1004386_65_469 134
4 3300005347 Ga0070668_100812968 Ga0070668_1008129681 137
5 3300005937 Ga0081455_10217649 Ga0081455_102176492 139
6 3300009176 Ga0105242_12081702 Ga0105242_120817022 139
7 3300028379 Ga0268266_11606813 Ga0268266_116068132 139
8 3300054114 Ga0501084_0258960 Ga0501084_0258960_891_1325 139
9 3300005459 Ga0068867_100849540 Ga0068867_1008495401 140
10 3300005530 Ga0070679_101296515 Ga0070679_1012965151 140
11 3300005564 Ga0070664_100749234 Ga0070664_1007492342 140
12 3300009098 Ga0105245_10164140 Ga0105245_101641402 140
13 3300009176 Ga0105242_10856775 Ga0105242_108567752 140
14 3300013297 Ga0157378_13003343 Ga0157378_130033431 140
15 3300014325 Ga0163163_11725805 Ga0163163_117258052 140
16 3300014326 Ga0157380_10445704 Ga0157380_104457042 140
17 3300025899 Ga0207642_10631358 Ga0207642_106313582 140
18 3300025934 Ga0207686_10172233 Ga0207686_101722334 140
19 3300025935 Ga0207709_10700720 Ga0207709_107007202 140
20 3300025937 Ga0207669_10102691 Ga0207669_101026912 140
21 3300025945 Ga0207679_10675567 Ga0207679_106755672 140
22 3300026089 Ga0207648_11366710 Ga0207648_113667102 140
23 3300031548 Ga0307408_100581959 Ga0307408_1005819592 140
24 3300031903 Ga0307407_10186557 Ga0307407_101865572 140
25 3300031995 Ga0307409_100200293 Ga0307409_1002002932 140
26 3300031995 Ga0307409_100251800 Ga0307409_1002518002 140
27 3300032002 Ga0307416_100048316 Ga0307416_1000483163 140
28 3300041404 Ga0439436_0085347 Ga0439436_0085347_218_640 140
29 3300041410 Ga0439461_0014902 Ga0439461_0014902_181_603 140
30 3300041997 Ga0439431_0073510 Ga0439431_0073510_166_588 140
31 3300042000 Ga0439437_003380 Ga0439437_003380_883_1305 140
32 3300042156 Ga0439446_0015697 Ga0439446_0015697_1527_1949 140
33 3300042435 Ga0439434_0025682 Ga0439434_0025682_308_730 140
34 3300042435 Ga0439434_0087207 Ga0439434_0087207_245_667 140
35 3300042439 Ga0439464_0262713 Ga0439464_0262713_10_432 140
36 3300045051 Ga0451576_1172099 Ga0451576_1172099_261_683 140
37 3300046453 Ga0495627_209180 Ga0495627_209180_99_521 140
38 3300046457 Ga0495590_0299603 Ga0495590_0299603_82_504 140
39 3300046474 Ga0495605_0162708 Ga0495605_0162708_354_776 140
40 3300046500 Ga0495596_0022788 Ga0495596_0022788_1350_1772 140
41 3300046518 Ga0495631_0086310 Ga0495631_0086310_814_1236 140
42 3300046537 Ga0495598_0054243 Ga0495598_0054243_394_816 140
43 3300046558 Ga0495633_0481693 Ga0495633_0481693_83_505 140
44 3300046648 Ga0495611_0286247 Ga0495611_0286247_82_504 140
45 3300046665 Ga0495661_0070601 Ga0495661_0070601_1369_1791 140
46 3300046684 Ga0495669_0322421 Ga0495669_0322421_196_618 140
47 3300046794 Ga0495589_0066994 Ga0495589_0066994_739_1161 140
48 3300049576 Ga0501040_0492041 Ga0501040_0492041_215_637 140
49 3300049578 Ga0501042_0105450 Ga0501042_0105450_1251_1676 140
50 3300049588 Ga0501072_1082846 Ga0501072_1082846_78_500 140
51 3300049588 Ga0501072_1103645 Ga0501072_1103645_183_605 140
52 3300049590 Ga0501074_1033237 Ga0501074_1033237_132_554 140
53 3300049590 Ga0501074_1126294 Ga0501074_1126294_29_451 140
54 3300049591 Ga0501075_0111759 Ga0501075_0111759_74_496 140
55 3300049593 Ga0501077_0825991 Ga0501077_0825991_94_516 140
56 3300049824 Ga0501045_0318683 Ga0501045_0318683_88_510 140
57 3300050507 nmdc:mga05p37_1075750_c1 nmdc:mga05p37_1075750_c1_13_435 140
58 3300054114 Ga0501084_0216494 Ga0501084_0216494_349_771 140
59 3300060353 Ga0501082_0431667 Ga0501082_0431667_583_1005 140
60 3300005328 Ga0070676_10394828 Ga0070676_103948281 141
61 3300005983 Ga0081540_1021419 Ga0081540_10214194 142
62 3300006846 Ga0075430_100576831 Ga0075430_1005768312 142
63 3300046474 Ga0495605_0175481 Ga0495605_0175481_251_685 142
64 3300046491 Ga0495584_0221094 Ga0495584_0221094_77_511 142
65 3300046538 Ga0495609_0073694 Ga0495609_0073694_969_1403 142
66 3300046794 Ga0495589_0081702 Ga0495589_0081702_504_938 142
67 3300006844 Ga0075428_100057005 Ga0075428_1000570056 143
68 3300006846 Ga0075430_100001252 Ga0075430_1000012527 143
69 3300009147 Ga0114129_10103593 Ga0114129_101035934 143
70 3300021377 Ga0213874_10143966 Ga0213874_101439662 143
71 3300037312 Ga0395899_0259687 Ga0395899_0259687_13_444 143
72 3300037418 Ga0395900_0744288 Ga0395900_0744288_129_560 143
73 3300037471 Ga0395905_0078832 Ga0395905_0078832_87_518 143
74 3300037853 Ga0436364_0356927 Ga0436364_0356927_610_1047 143
75 3300038443 Ga0395901_0085569 Ga0395901_0085569_347_778 143
76 3300039450 Ga0436363_0236964 Ga0436363_0236964_68_505 143
77 3300042016 Ga0439463_081948 Ga0439463_081948_127_558 143
78 3300046794 Ga0495589_0127437 Ga0495589_0127437_290_730 143
79 3300048910 Ga0496107_0249091 Ga0496107_0249091_306_746 143
80 3300049583 Ga0501067_0200541 Ga0501067_0200541_121_552 143
81 3300050507 nmdc:mga05p37_241980_c1 nmdc:mga05p37_241980_c1_1486_1920 143
82 3300050508 nmdc:mga09592_838624_c1 nmdc:mga09592_838624_c1_70_504 143
83 3300050509 nmdc:mga0qj67_26424_c1 nmdc:mga0qj67_26424_c1_3890_4324 143
84 3300050510 nmdc:mga06r32_15725_c1 nmdc:mga06r32_15725_c1_3748_4182 143
85 3300005343 Ga0070687_100534668 Ga0070687_1005346681 144
86 3300005353 Ga0070669_100298464 Ga0070669_1002984642 144
87 3300005535 Ga0070684_100030066 Ga0070684_1000300662 144
88 3300005535 Ga0070684_100561542 Ga0070684_1005615422 144
89 3300005545 Ga0070695_101450214 Ga0070695_1014502141 144
90 3300005547 Ga0070693_100662941 Ga0070693_1006629411 144
91 3300005563 Ga0068855_101577232 Ga0068855_1015772321 144
92 3300005564 Ga0070664_100736033 Ga0070664_1007360332 144
93 3300005614 Ga0068856_101277133 Ga0068856_1012771331 144
94 3300005616 Ga0068852_101544269 Ga0068852_1015442691 144
95 3300005841 Ga0068863_100974544 Ga0068863_1009745441 144
96 3300005937 Ga0081455_10259104 Ga0081455_102591042 144
97 3300005983 Ga0081540_1166872 Ga0081540_11668722 144
98 3300005983 Ga0081540_1181174 Ga0081540_11811742 144
99 3300009147 Ga0114129_10052782 Ga0114129_100527824 144
100 3300009174 Ga0105241_11514167 Ga0105241_115141671 144
101 3300009174 Ga0105241_12194222 Ga0105241_121942222 144
102 3300009176 Ga0105242_11624729 Ga0105242_116247291 144
103 3300009553 Ga0105249_12746098 Ga0105249_127460981 144
104 3300013297 Ga0157378_11767774 Ga0157378_117677742 144
105 3300020078 Ga0206352_10155341 Ga0206352_101553412 144
106 3300025900 Ga0207710_10244912 Ga0207710_102449122 144
107 3300025914 Ga0207671_10760931 Ga0207671_107609312 144
108 3300025927 Ga0207687_10147499 Ga0207687_101474992 144
109 3300025932 Ga0207690_11521568 Ga0207690_115215681 144
110 3300025941 Ga0207711_10220379 Ga0207711_102203792 144
111 3300025944 Ga0207661_10096108 Ga0207661_100961082 144
112 3300025945 Ga0207679_10628475 Ga0207679_106284752 144
113 3300025949 Ga0207667_12215905 Ga0207667_122159051 144
114 3300025961 Ga0207712_12019965 Ga0207712_120199651 144
115 3300026078 Ga0207702_10176355 Ga0207702_101763551 144
116 3300026116 Ga0207674_10217280 Ga0207674_102172802 144
117 3300035170 Ga0373943_0275373 Ga0373943_0275373_465_908 144
118 3300037068 Ga0373925_0181144 Ga0373925_0181144_708_1151 144
119 3300045976 Ga0466967_0174412 Ga0466967_0174412_651_1085 144
120 3300046461 Ga0495641_0049693 Ga0495641_0049693_344_787 144
121 3300046472 Ga0495580_0462547 Ga0495580_0462547_340_783 144
122 3300046491 Ga0495584_0427208 Ga0495584_0427208_196_639 144
123 3300046501 Ga0495607_0528914 Ga0495607_0528914_52_495 144
124 3300046537 Ga0495598_0217091 Ga0495598_0217091_99_542 144
125 3300046615 Ga0495656_0711544 Ga0495656_0711544_55_489 144
126 3300046690 Ga0495624_0534666 Ga0495624_0534666_224_667 144
127 3300047321 Ga0495676_0230692 Ga0495676_0230692_136_579 144
128 3300048091 Ga0495626_0273742 Ga0495626_0273742_184_627 144
129 3300048903 Ga0496100_0082870 Ga0496100_0082870_730_1173 144
130 3300048903 Ga0496100_1015636 Ga0496100_1015636_209_643 144
131 3300048904 Ga0496101_0153655 Ga0496101_0153655_1280_1723 144
132 3300048906 Ga0496103_0826476 Ga0496103_0826476_41_484 144
133 3300048907 Ga0496104_0030436 Ga0496104_0030436_4483_4926 144
134 3300048908 Ga0496105_0172423 Ga0496105_0172423_758_1201 144
135 3300048911 Ga0496108_0000712 Ga0496108_0000712_8515_8958 144
136 3300048911 Ga0496108_0067696 Ga0496108_0067696_959_1402 144
137 3300048912 Ga0496109_0001732 Ga0496109_0001732_9750_10193 144
138 3300048912 Ga0496109_0034045 Ga0496109_0034045_2211_2654 144
139 3300048913 Ga0496110_0002009 Ga0496110_0002009_6206_6649 144
140 3300048913 Ga0496110_0057070 Ga0496110_0057070_1719_2162 144
141 3300048913 Ga0496110_0147785 Ga0496110_0147785_1516_1950 144
142 3300048914 Ga0496111_0004528 Ga0496111_0004528_1595_2038 144
143 3300048914 Ga0496111_0019439 Ga0496111_0019439_3421_3864 144
144 3300048915 Ga0496112_0016833 Ga0496112_0016833_856_1299 144
145 3300048915 Ga0496112_0081275 Ga0496112_0081275_2572_3015 144
146 3300048915 Ga0496112_0461153 Ga0496112_0461153_223_657 144
147 3300048915 Ga0496112_0919677 Ga0496112_0919677_204_638 144
148 3300048916 Ga0496113_0033906 Ga0496113_0033906_1242_1685 144
149 3300048916 Ga0496113_0060505 Ga0496113_0060505_2221_2664 144
150 3300048916 Ga0496113_0401197 Ga0496113_0401197_550_984 144
151 3300049824 Ga0501045_0405268 Ga0501045_0405268_540_977 144
152 3300053083 Ga0495655_0124486 Ga0495655_0124486_166_609 144
153 3300005981 Ga0081538_10036091 Ga0081538_100360914 145
154 3300006847 Ga0075431_100198292 Ga0075431_1001982922 145
155 3300009098 Ga0105245_10681365 Ga0105245_106813652 145
156 3300037312 Ga0395899_0006243 Ga0395899_0006243_8522_8965 145
157 3300046455 Ga0495603_0120337 Ga0495603_0120337_120_566 145
158 3300046665 Ga0495661_0096391 Ga0495661_0096391_250_696 145
159 3300048913 Ga0496110_0275820 Ga0496110_0275820_99_545 145
160 3300048914 Ga0496111_0275054 Ga0496111_0275054_576_1022 145
161 3300003373 JGI25407J50210_10074400 JGI25407J50210_100744002 146
162 3300005981 Ga0081538_10000206 Ga0081538_1000020662 146
163 3300005981 Ga0081538_10008148 Ga0081538_100081488 146
164 3300005985 Ga0081539_10025334 Ga0081539_100253342 146
165 3300025919 Ga0207657_10326374 Ga0207657_103263742 146
166 3300025945 Ga0207679_11164226 Ga0207679_111642261 146
167 3300037853 Ga0436364_0563145 Ga0436364_0563145_186_632 146
168 3300039437 Ga0436365_0460883 Ga0436365_0460883_304_750 146
169 3300039437 Ga0436365_0498783 Ga0436365_0498783_161_607 146
170 3300039437 Ga0436365_1632438 Ga0436365_1632438_507_959 146
171 3300044901 Ga0466960_1049747 Ga0466960_1049747_30_476 146
172 3300045976 Ga0466967_0239152 Ga0466967_0239152_969_1412 146
173 3300045976 Ga0466967_0398518 Ga0466967_0398518_147_590 146
174 3300046513 Ga0495616_0289601 Ga0495616_0289601_28_498 146
175 3300047472 Ga0495686_0469373 Ga0495686_0469373_186_629 146
176 3300048920 Ga0496117_0474043 Ga0496117_0474043_112_555 146
177 3300048921 Ga0496118_0032547 Ga0496118_0032547_3605_4048 146
178 3300048924 Ga0496121_0004578 Ga0496121_0004578_17654_18097 146
179 3300048924 Ga0496121_0169426 Ga0496121_0169426_1020_1463 146
180 3300048928 Ga0496125_0020290 Ga0496125_0020290_3650_4093 146
181 3300049568 Ga0501031_0194651 Ga0501031_0194651_824_1264 146
182 3300049572 Ga0501036_0051241 Ga0501036_0051241_1759_2199 146
183 3300049574 Ga0501038_0339445 Ga0501038_0339445_689_1129 146
184 3300049576 Ga0501040_0079059 Ga0501040_0079059_1515_1955 146
185 3300049576 Ga0501040_1179658 Ga0501040_1179658_27_467 146
186 3300049578 Ga0501042_0266900 Ga0501042_0266900_37_477 146
187 3300049586 Ga0501070_0992018 Ga0501070_0992018_199_639 146
188 3300049587 Ga0501071_0252127 Ga0501071_0252127_85_525 146
189 3300049588 Ga0501072_0012194 Ga0501072_0012194_2351_2791 146
190 3300049588 Ga0501072_0119903 Ga0501072_0119903_505_945 146
191 3300049591 Ga0501075_0029141 Ga0501075_0029141_1987_2427 146
192 3300049592 Ga0501076_0090892 Ga0501076_0090892_1192_1632 146
193 3300049592 Ga0501076_0424461 Ga0501076_0424461_259_699 146
194 3300049743 Ga0501081_0052103 Ga0501081_0052103_604_1044 146
195 3300049743 Ga0501081_0248931 Ga0501081_0248931_609_1049 146
196 3300049824 Ga0501045_0093116 Ga0501045_0093116_1683_2123 146
197 3300049824 Ga0501045_0161612 Ga0501045_0161612_263_703 146
198 3300049824 Ga0501045_0459094 Ga0501045_0459094_358_798 146
199 3300054114 Ga0501084_0225607 Ga0501084_0225607_442_882 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

28

124

0.85

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

123

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p7q-assembly4.cif.gz_D-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.7977 9 107
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.7956 9 109
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.7919 9 107
3kol-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/dioxygenase from nostoc punctiforme 0.7897 12 109
1r9c-assembly1.cif.gz_A crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.7867 9 107
ID Description Score Start End Superfamily
af_Q5AGZ8_1_149_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.804 13 108 3.10.180.10
af_Q0D8H0_68_188_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7989 8 109 3.10.180.10
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7978 14 57 3.30.720.120
af_C6T374_10_137_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7931 13 110 3.10.180.10
af_C6KSP5_186_307_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7901 13 109 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W0S4D1-F1-model_v4 VOC family protein 0.9649 69 146
AF-A0A537T7B1-F1-model_v4 VOC family protein 0.9337 80 146
AF-A0A7W0S4D1-F1-model_v4 VOC family protein 0.9079 69 146
AF-A0A0T9TEE9-F1-model_v4 deleted 0.9047 8 146
AF-A0A6G8DEW3-F1-model_v4 VOC family protein 0.9037 7 146

Feature Viewer

pLDDT pTM Quality
90.6 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map