F305627

General Info

Members Datasets Scaffolds Average Seq Length
199 111 398 250

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100016555|Ga0075363_1000165553
Length 286
Sequence MATAKPGSARRLRRLCPPSQTTTSPSTEVAHAVAKKSAKSDRQAVIDEIRKKQKGADRRRGFAIIGVCGLIAAVILVLAIYPIIKRNRDLAEFNGLKLDEIGAKASACEKVTTKPANGSSDHVDESQQVDYPDAPPAFGQHWNVAGLAPATFERKFYTSNDRPELESLVHNLEHGYTILWYDETAADDGDMMNTIEGIADKFASDDENFRLKFIAAPWTSDDESESGAFPKGQHIAFSHWSAGGNGETDTSKQEGVWQYCSEPSGAALKTFMDDYPYTDSPEPDAM

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
53 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
54 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
55 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
56 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
57 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
58 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
59 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
65 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
66 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
95 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
96 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
97 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
103 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
104 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
108 2643221576 Nocardioides sp. Root614 Isolate Unclassified
109 2643221590 Nocardioides sp. Root682 Isolate Unclassified
110 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
111 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 1.51
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.18
Nodule 0
Rhizoplane 1.01
Rhizosphere 59.8
Stem 0
Stem Tuber 0
Unclassified 5.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100016555 3300006048 Bacteria 3643
2 LJQas_1012299 3300000549 Bacteria 1013
3 Ga0070668_100041160 3300005347 Bacteria 3540
4 Ga0070667_100316182 3300005367 Bacteria 1408
5 Ga0068853_100780525 3300005539 Unclassified 914
6 Ga0070672_100251183 3300005543 Bacteria 1490
7 Ga0070704_100444721 3300005549 Unclassified 1115
8 Ga0068857_100277556 3300005577 Bacteria 1541
9 Ga0068854_100701179 3300005578 Unclassified 874
10 Ga0070702_100012266 3300005615 Bacteria 4288
11 Ga0068852_100226828 3300005616 Unclassified 1779
12 Ga0068861_100010263 3300005719 Bacteria 6501
13 Ga0068860_100037707 3300005843 Bacteria 4626
14 Ga0081455_10120581 3300005937 Bacteria 2067
15 Ga0075365_10007419 3300006038 Bacteria 6138
16 Ga0075365_10052137 3300006038 Bacteria 2705
17 Ga0075365_10099772 3300006038 Bacteria 1987
18 Ga0075365_10111361 3300006038 Bacteria 1881
19 Ga0075365_10181834 3300006038 Bacteria 1470
20 Ga0075365_10242925 3300006038 Bacteria 1265
21 Ga0075368_10007918 3300006042 Bacteria 3768
22 Ga0075368_10011238 3300006042 Bacteria 3254
23 Ga0075363_100005276 3300006048 Bacteria 5734
24 Ga0075363_100013481 3300006048 Bacteria 3964
25 Ga0075363_100143911 3300006048 Bacteria 1343
26 Ga0075363_100150417 3300006048 Bacteria 1314
27 Ga0075363_100158621 3300006048 Bacteria 1280
28 Ga0075363_100245672 3300006048 Bacteria 1030
29 Ga0075363_100264070 3300006048 Bacteria 993
30 Ga0075364_10009624 3300006051 Bacteria 5805
31 Ga0075364_10016118 3300006051 Bacteria 4645
32 Ga0075364_10022240 3300006051 Bacteria 4002
33 Ga0075364_10027627 3300006051 Bacteria 3626
34 Ga0075364_10041800 3300006051 Bacteria 2978
35 Ga0075364_10059685 3300006051 Bacteria 2500
36 Ga0075364_10073369 3300006051 Bacteria 2256
37 Ga0075364_10101973 3300006051 Bacteria 1911
38 Ga0075364_10149676 3300006051 Bacteria 1573
39 Ga0075364_10155999 3300006051 Bacteria 1540
40 Ga0075367_10005738 3300006178 Bacteria 6202
41 Ga0075367_10007770 3300006178 Bacteria 5515
42 Ga0075367_10051242 3300006178 Bacteria 2439
43 Ga0075367_10088934 3300006178 Bacteria 1877
44 Ga0075370_10005906 3300006353 Bacteria 6123
45 Ga0075370_10082547 3300006353 Bacteria 1848
46 Ga0075370_10112655 3300006353 Bacteria 1580
47 Ga0075370_10119630 3300006353 Bacteria 1532
48 Ga0075370_10133046 3300006353 Bacteria 1452
49 Ga0105245_10393779 3300009098 Bacteria 1383
50 Ga0105238_10126567 3300009551 Bacteria 2533
51 Ga0105249_10157817 3300009553 Bacteria 2190
52 Ga0105239_10487122 3300010375 Bacteria 1401
53 Ga0105246_10646506 3300011119 Unclassified 920
54 Ga0157378_10334606 3300013297 Bacteria 1475
55 Ga0163162_10132561 3300013306 Bacteria 2601
56 Ga0157375_10036525 3300013308 Bacteria 4701
57 Ga0163163_10407522 3300014325 Bacteria 1418
58 Ga0163161_10141163 3300017792 Bacteria 1824
59 Ga0207688_10136824 3300025901 Bacteria 1439
60 Ga0207669_10630795 3300025937 Unclassified 874
61 Ga0207640_10425724 3300025981 Unclassified 1088
62 Ga0207639_10346491 3300026041 Unclassified 1326
63 Ga0207708_10124598 3300026075 Bacteria 2010
64 Ga0207675_100025421 3300026118 Bacteria 5512
65 Ga0209813_10002735 3300027866 Bacteria 4067
66 Ga0209813_10005801 3300027866 Bacteria 3018
67 Ga0209813_10045954 3300027866 Bacteria 1347
68 Ga0268264_10000552 3300028381 Bacteria 46800
69 Ga0307408_100366862 3300031548 Bacteria 1227
70 Ga0307405_10093462 3300031731 Bacteria 1998
71 Ga0307410_10489321 3300031852 Bacteria 1010
72 Ga0307410_10653386 3300031852 Bacteria 882
73 Ga0307406_10282730 3300031901 Bacteria 1266
74 Ga0307407_10078421 3300031903 Bacteria 1990
75 Ga0307412_10343513 3300031911 Bacteria 1195
76 Ga0307409_100012651 3300031995 Bacteria 5388
77 Ga0307409_100036002 3300031995 Bacteria 3633
78 Ga0307409_100259276 3300031995 Bacteria 1594
79 Ga0307409_100545365 3300031995 Bacteria 1137
80 Ga0307416_100287189 3300032002 Bacteria 1626
81 Ga0307416_100315189 3300032002 Bacteria 1563
82 Ga0307411_10227682 3300032005 Bacteria 1451
83 Ga0307415_100068437 3300032126 Bacteria 2485
84 Ga0307415_100124504 3300032126 Bacteria 1940
85 Ga0395899_0307030 3300037312 Bacteria 1072
86 Ga0395898_0081243 3300037466 Bacteria 3126
87 Ga0395905_0616687 3300037471 Bacteria 987
88 Ga0395901_0069758 3300038443 Bacteria 3661
89 Ga0439447_043441 3300041407 Bacteria 1089
90 Ga0451837_0013956 3300041494 Bacteria 2779
91 Ga0451843_0314892 3300041509 Bacteria 1752
92 Ga0451853_1611370 3300041512 Bacteria 1358
93 Ga0451853_3075502 3300041512 Bacteria 1492
94 Ga0439431_0004229 3300041997 Bacteria 3151
95 Ga0439442_014504 3300042002 Bacteria 1622
96 Ga0439457_015503 3300042014 Bacteria 1701
97 Ga0439434_0018973 3300042435 Bacteria 2061
98 Ga0466966_0259272 3300044684 Bacteria 1047
99 Ga0466971_0083016 3300044719 Bacteria 1463
100 Ga0466970_0007256 3300044765 Bacteria 5552
101 Ga0466970_0055948 3300044765 Bacteria 2108
102 Ga0466959_0128795 3300045049 Bacteria 1795
103 Ga0496110_0333839 3300048913 Bacteria 1381
104 Ga0496111_0197371 3300048914 Bacteria 1496
105 Ga0501306_016182 3300049127 Bacteria 999
106 Ga0501311_011767 3300049527 Bacteria 1083
107 Ga0501317_010613 3300049533 Bacteria 1104
108 Ga0501031_0318610 3300049568 Bacteria 1007
109 Ga0501031_0488939 3300049568 Bacteria 794
110 Ga0501032_0191075 3300049569 Unclassified 1338
111 Ga0501032_0280326 3300049569 Bacteria 1079
112 Ga0501034_0200170 3300049571 Bacteria 1956
113 Ga0501036_0001492 3300049572 Bacteria 18029
114 Ga0501036_0066389 3300049572 Bacteria 3052
115 Ga0501036_0130641 3300049572 Bacteria 2121
116 Ga0501037_0005299 3300049573 Bacteria 9381
117 Ga0501037_0027812 3300049573 Bacteria 4179
118 Ga0501039_0326320 3300049575 Bacteria 1206
119 Ga0501040_0014737 3300049576 Bacteria 5157
120 Ga0501040_0062053 3300049576 Bacteria 2571
121 Ga0501040_0104863 3300049576 Bacteria 1975
122 Ga0501041_0010138 3300049577 Bacteria 5552
123 Ga0501041_0176995 3300049577 Bacteria 1335
124 Ga0501042_0051962 3300049578 Bacteria 2923
125 Ga0501048_0002026 3300049582 Bacteria 15389
126 Ga0501048_0046519 3300049582 Bacteria 3097
127 Ga0501048_0546263 3300049582 Bacteria 831
128 Ga0501067_0038017 3300049583 Bacteria 2673
129 Ga0501067_0085223 3300049583 Bacteria 1753
130 Ga0501068_0107418 3300049584 Bacteria 1733
131 Ga0501068_0204457 3300049584 Bacteria 1253
132 Ga0501069_0123297 3300049585 Bacteria 1481
133 Ga0501070_0085637 3300049586 Bacteria 2609
134 Ga0501070_0099908 3300049586 Unclassified 2401
135 Ga0501070_0316484 3300049586 Bacteria 1270
136 Ga0501071_0017740 3300049587 Bacteria 4915
137 Ga0501071_0047731 3300049587 Unclassified 3076
138 Ga0501071_0353107 3300049587 Bacteria 1119
139 Ga0501072_0010558 3300049588 Bacteria 7031
140 Ga0501072_0435680 3300049588 Bacteria 1038
141 Ga0501073_0193068 3300049589 Bacteria 1409
142 Ga0501074_0063947 3300049590 Bacteria 2650
143 Ga0501076_0003614 3300049592 Bacteria 10863
144 Ga0501076_0102970 3300049592 Bacteria 2302
145 Ga0501076_0420657 3300049592 Bacteria 1099
146 Ga0501077_0022918 3300049593 Bacteria 3958
147 Ga0501077_0158995 3300049593 Bacteria 1434
148 Ga0501079_0033630 3300049741 Bacteria 3944
149 Ga0501079_0475938 3300049741 Bacteria 981
150 Ga0501081_0046306 3300049743 Bacteria 2989
151 Ga0501081_0102161 3300049743 Bacteria 2028
152 Ga0501083_0237005 3300049744 Bacteria 1188
153 Ga0501035_0039199 3300049822 Bacteria 4288
154 Ga0501044_0665869 3300049823 Bacteria 929
155 Ga0501045_0042077 3300049824 Bacteria 3326
156 Ga0501045_0473792 3300049824 Bacteria 930
157 Ga0501045_0560172 3300049824 Bacteria 847
158 nmdc:mga03n38_168790_c1 3300050490 Bacteria 1113
159 nmdc:mga03n38_25578_c1 3300050490 Bacteria 2427
160 nmdc:mga03n38_2834_c1 3300050490 Bacteria 5456
161 nmdc:mga03n38_88393_c1 3300050490 Bacteria 1470
162 nmdc:mga00v17_237412_c1 3300050491 Bacteria 1181
163 nmdc:mga00v17_28140_c1 3300050491 Bacteria 3290
164 nmdc:mga00v17_30277_c1 3300050491 Bacteria 3184
165 nmdc:mga00v17_367055_c1 3300050491 Bacteria 936
166 nmdc:mga00v17_38655_c1 3300050491 Bacteria 2854
167 nmdc:mga00v17_42469_c1 3300050491 Bacteria 2735
168 nmdc:mga00v17_64690_c1 3300050491 Bacteria 2254
169 nmdc:mga00v17_74776_c1 3300050491 Bacteria 2106
170 nmdc:mga0yw44_115006_c1 3300050492 Bacteria 1727
171 nmdc:mga0yw44_121335_c1 3300050492 Bacteria 1684
172 nmdc:mga0yw44_139368_c1 3300050492 Bacteria 1576
173 nmdc:mga0yw44_156243_c1 3300050492 Bacteria 1491
174 nmdc:mga0yw44_238919_c1 3300050492 Bacteria 1207
175 nmdc:mga0yw44_361656_c1 3300050492 Bacteria 978
176 nmdc:mga0yw44_36181_c1 3300050492 Bacteria 2908
177 nmdc:mga0yw44_411313_c1 3300050492 Bacteria 915
178 nmdc:mga0yw44_78401_c1 3300050492 Bacteria 2066
179 nmdc:mga06z11_150963_c1 3300050494 Bacteria 1321
180 nmdc:mga06z11_59103_c1 3300050494 Bacteria 1992
181 nmdc:mga04h51_44802_c1 3300050495 Bacteria 1461
182 nmdc:mga04h51_66351_c1 3300050495 Bacteria 1250
183 nmdc:mga04h51_77029_c1 3300050495 Bacteria 1176
184 nmdc:mga07m45_15596_c1 3300050496 Bacteria 4058
185 nmdc:mga07m45_200426_c1 3300050496 Bacteria 1161
186 nmdc:mga07m45_53503_c1 3300050496 Bacteria 2281
187 nmdc:mga08y16_524208_c1 3300050511 Bacteria 1201
188 Ga0495655_0049556 3300053083 Bacteria 1106
189 Ga0500644_0000177 3300053088 Bacteria 40984
190 Ga0500644_0020621 3300053088 Bacteria 1962
191 Ga0500593_090222 3300053117 Bacteria 1297
192 Ga0501084_0033624 3300054114 Bacteria 4289
193 Ga0501084_0096594 3300054114 Bacteria 2481
194 Ga0501082_0155892 3300060353 Bacteria 1984
195 Ga0530510_0076515 3300061734 Bacteria 2431
196 2643892555 2643221576 Bacteria 5214352
197 2643961607 2643221590 Bacteria 5214697
198 2855389173 2855386786 Bacteria 4752232
199 2857486372 2857481737 Bacteria 4761446
200 Ga0075363_100016555
201 LJQas_1012299
202 Ga0070668_100041160
203 Ga0070667_100316182
204 Ga0068853_100780525
205 Ga0070672_100251183
206 Ga0070704_100444721
207 Ga0068857_100277556
208 Ga0068854_100701179
209 Ga0070702_100012266
210 Ga0068852_100226828
211 Ga0068861_100010263
212 Ga0068860_100037707
213 Ga0081455_10120581
214 Ga0075365_10007419
215 Ga0075365_10052137
216 Ga0075365_10099772
217 Ga0075365_10111361
218 Ga0075365_10181834
219 Ga0075365_10242925
220 Ga0075368_10007918
221 Ga0075368_10011238
222 Ga0075363_100005276
223 Ga0075363_100013481
224 Ga0075363_100143911
225 Ga0075363_100150417
226 Ga0075363_100158621
227 Ga0075363_100245672
228 Ga0075363_100264070
229 Ga0075364_10009624
230 Ga0075364_10016118
231 Ga0075364_10022240
232 Ga0075364_10027627
233 Ga0075364_10041800
234 Ga0075364_10059685
235 Ga0075364_10073369
236 Ga0075364_10101973
237 Ga0075364_10149676
238 Ga0075364_10155999
239 Ga0075367_10005738
240 Ga0075367_10007770
241 Ga0075367_10051242
242 Ga0075367_10088934
243 Ga0075370_10005906
244 Ga0075370_10082547
245 Ga0075370_10112655
246 Ga0075370_10119630
247 Ga0075370_10133046
248 Ga0105245_10393779
249 Ga0105238_10126567
250 Ga0105249_10157817
251 Ga0105239_10487122
252 Ga0105246_10646506
253 Ga0157378_10334606
254 Ga0163162_10132561
255 Ga0157375_10036525
256 Ga0163163_10407522
257 Ga0163161_10141163
258 Ga0207688_10136824
259 Ga0207669_10630795
260 Ga0207640_10425724
261 Ga0207639_10346491
262 Ga0207708_10124598
263 Ga0207675_100025421
264 Ga0209813_10002735
265 Ga0209813_10005801
266 Ga0209813_10045954
267 Ga0268264_10000552
268 Ga0307408_100366862
269 Ga0307405_10093462
270 Ga0307410_10489321
271 Ga0307410_10653386
272 Ga0307406_10282730
273 Ga0307407_10078421
274 Ga0307412_10343513
275 Ga0307409_100012651
276 Ga0307409_100036002
277 Ga0307409_100259276
278 Ga0307409_100545365
279 Ga0307416_100287189
280 Ga0307416_100315189
281 Ga0307411_10227682
282 Ga0307415_100068437
283 Ga0307415_100124504
284 Ga0395899_0307030
285 Ga0395898_0081243
286 Ga0395905_0616687
287 Ga0395901_0069758
288 Ga0439447_043441
289 Ga0451837_0013956
290 Ga0451843_0314892
291 Ga0451853_1611370
292 Ga0451853_3075502
293 Ga0439431_0004229
294 Ga0439442_014504
295 Ga0439457_015503
296 Ga0439434_0018973
297 Ga0466966_0259272
298 Ga0466971_0083016
299 Ga0466970_0007256
300 Ga0466970_0055948
301 Ga0466959_0128795
302 Ga0496110_0333839
303 Ga0496111_0197371
304 Ga0501306_016182
305 Ga0501311_011767
306 Ga0501317_010613
307 Ga0501031_0318610
308 Ga0501031_0488939
309 Ga0501032_0191075
310 Ga0501032_0280326
311 Ga0501034_0200170
312 Ga0501036_0001492
313 Ga0501036_0066389
314 Ga0501036_0130641
315 Ga0501037_0005299
316 Ga0501037_0027812
317 Ga0501039_0326320
318 Ga0501040_0014737
319 Ga0501040_0062053
320 Ga0501040_0104863
321 Ga0501041_0010138
322 Ga0501041_0176995
323 Ga0501042_0051962
324 Ga0501048_0002026
325 Ga0501048_0046519
326 Ga0501048_0546263
327 Ga0501067_0038017
328 Ga0501067_0085223
329 Ga0501068_0107418
330 Ga0501068_0204457
331 Ga0501069_0123297
332 Ga0501070_0085637
333 Ga0501070_0099908
334 Ga0501070_0316484
335 Ga0501071_0017740
336 Ga0501071_0047731
337 Ga0501071_0353107
338 Ga0501072_0010558
339 Ga0501072_0435680
340 Ga0501073_0193068
341 Ga0501074_0063947
342 Ga0501076_0003614
343 Ga0501076_0102970
344 Ga0501076_0420657
345 Ga0501077_0022918
346 Ga0501077_0158995
347 Ga0501079_0033630
348 Ga0501079_0475938
349 Ga0501081_0046306
350 Ga0501081_0102161
351 Ga0501083_0237005
352 Ga0501035_0039199
353 Ga0501044_0665869
354 Ga0501045_0042077
355 Ga0501045_0473792
356 Ga0501045_0560172
357 nmdc:mga03n38_168790_c1
358 nmdc:mga03n38_25578_c1
359 nmdc:mga03n38_2834_c1
360 nmdc:mga03n38_88393_c1
361 nmdc:mga00v17_237412_c1
362 nmdc:mga00v17_28140_c1
363 nmdc:mga00v17_30277_c1
364 nmdc:mga00v17_367055_c1
365 nmdc:mga00v17_38655_c1
366 nmdc:mga00v17_42469_c1
367 nmdc:mga00v17_64690_c1
368 nmdc:mga00v17_74776_c1
369 nmdc:mga0yw44_115006_c1
370 nmdc:mga0yw44_121335_c1
371 nmdc:mga0yw44_139368_c1
372 nmdc:mga0yw44_156243_c1
373 nmdc:mga0yw44_238919_c1
374 nmdc:mga0yw44_361656_c1
375 nmdc:mga0yw44_36181_c1
376 nmdc:mga0yw44_411313_c1
377 nmdc:mga0yw44_78401_c1
378 nmdc:mga06z11_150963_c1
379 nmdc:mga06z11_59103_c1
380 nmdc:mga04h51_44802_c1
381 nmdc:mga04h51_66351_c1
382 nmdc:mga04h51_77029_c1
383 nmdc:mga07m45_15596_c1
384 nmdc:mga07m45_200426_c1
385 nmdc:mga07m45_53503_c1
386 nmdc:mga08y16_524208_c1
387 Ga0495655_0049556
388 Ga0500644_0000177
389 Ga0500644_0020621
390 Ga0500593_090222
391 Ga0501084_0033624
392 Ga0501084_0096594
393 Ga0501082_0155892
394 Ga0530510_0076515
395 2643892555
396 2643961607
397 2855389173
398 2857486372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11303

DUF3105

Protein of unknown function (DUF3105)

122

286

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rue-assembly1.cif.gz_A solution structure of the a' domain of thermophilic fungal protein disulfide (oxidized form, 303k) 0.5573 117 243
2rue-assembly1.cif.gz_A solution structure of the a' domain of thermophilic fungal protein disulfide (oxidized form, 303k) 0.5312 117 243
7pla-assembly1.cif.gz_A cryo-em structure of shcas12k in complex with a sgrna and a dsdna target 0.5182 195 225
6owv-assembly1.cif.gz_A crystal structure of a human cardiac calsequestrin filament 0.4822 115 199
6i7s-assembly2.cif.gz_B microsomal triglyceride transfer protein 0.468 116 243
ID Description Score Start End Superfamily
af_Q8BJW7_246_308_3.40.1620.30 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;ERCC4, Mus81-Eme1 complex, nuclease domain, subdomain 1 0.6259 136 212 3.40.1620.30
af_Q57638_253_347_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.5979 134 184 3.30.1330.30
af_Q8BJW7_246_308_3.40.1620.30 Alpha Beta;3-Layer(aba) Sandwich;YefM-like fold;ERCC4, Mus81-Eme1 complex, nuclease domain, subdomain 1 0.5763 136 212 3.40.1620.30
3agjH03 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.5576 142 184 3.30.1330.30
2rueA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.5573 117 243 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6J6QG36-F1-model_v4 Unannotated protein 0.9628 45 249
AF-A0A2W6ET24-F1-model_v4 DUF3105 domain-containing protein 0.9526 75 249
AF-A0A6J6QG36-F1-model_v4 Unannotated protein 0.9403 45 249
AF-A0A838HD76-F1-model_v4 DUF3105 domain-containing protein 0.9348 76 249
AF-A0A1I1A9L1-F1-model_v4 DUF3105 domain-containing protein 0.9316 1 249 GO:0016020

Map