F305615

General Info

Members Datasets Scaffolds Average Seq Length
199 114 185 256

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10440870|Ga0070717_104408701
Length 264
Sequence MSEIISIHSFRGGTGKSNVTSNLAALIARSGKRVGIVDTDIQSPGIHVLFGLEQERIRYTLNDYLWGRCQIEEAVYDVSAILKQKQTFFGRQGSVHLIPSSIKMSDISRILREGYDARRLNDGLHNLVRRLKLDYLLIDTHPGINEETLLSIILSDVLVLILRPDKQDYQGTAVAIDVARKLEVPKMLIVINKALPSLDFKELGKRVENTYKTPVAGILPVCEEMFELGSGGIFCLQYPDHSWTQKISAIAKQITGSGVRLFAR

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2831426010 Nostoc sp. 106C Isolate Unclassified
3 2841760612 Bosea sp. Tri-49 Isolate Nodule
4 2844104063 Bosea sp. Tri-39 Isolate Nodule
5 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
6 2851182111 Bosea sp. Tri-44 Isolate Nodule
7 2851246043 Bosea sp. Tri-54 Isolate Nodule
8 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
9 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
55 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
114 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.96
Metatranscriptomes 1.01
Isolates 6.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 2.01
Rhizoplane 0.5
Rhizosphere 89.45
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1035119 3300003354 Bacteria 1234
2 JGI25407J50210_10004870 3300003373 Bacteria 3277
3 Ga0058863_10007382 3300004799 Bacteria 5188
4 Ga0065704_10093456 3300005289 Bacteria 2596
5 Ga0070676_10181303 3300005328 Unclassified 1369
6 Ga0070669_100110202 3300005353 Bacteria 2088
7 Ga0070675_100415456 3300005354 Bacteria 1202
8 Ga0070688_100053216 3300005365 Bacteria 2531
9 Ga0070708_100207717 3300005445 Bacteria 1834
10 Ga0070685_10222841 3300005466 Bacteria 1236
11 Ga0070706_100237903 3300005467 Unclassified 1700
12 Ga0070698_100155927 3300005471 Bacteria 2229
13 Ga0070698_100233366 3300005471 Bacteria 1773
14 Ga0070698_100800896 3300005471 Bacteria 886
15 Ga0070699_100026187 3300005518 Bacteria 5031
16 Ga0070695_100275263 3300005545 Bacteria 1235
17 Ga0070696_100019580 3300005546 Bacteria 4585
18 Ga0068859_100551172 3300005617 Bacteria 1247
19 Ga0068860_100674895 3300005843 Bacteria 1042
20 Ga0068862_100173742 3300005844 Bacteria 1930
21 Ga0068862_100212588 3300005844 Bacteria 1748
22 Ga0068862_100608583 3300005844 Bacteria 1050
23 Ga0081455_10060354 3300005937 Bacteria 3197
24 Ga0081538_10003630 3300005981 Bacteria 14506
25 Ga0081538_10009191 3300005981 Bacteria 8284
26 Ga0081538_10052152 3300005981 Bacteria 2447
27 Ga0070717_10440870 3300006028 Bacteria 1173
28 Ga0075365_10287837 3300006038 Bacteria 1156
29 Ga0075428_100008078 3300006844 Bacteria 11685
30 Ga0075428_100497142 3300006844 Bacteria 1305
31 Ga0075430_100112647 3300006846 Bacteria 2268
32 Ga0075431_100016934 3300006847 Bacteria 7401
33 Ga0075431_100208368 3300006847 Bacteria 1998
34 Ga0075431_100485883 3300006847 Unclassified 1227
35 Ga0075433_10027695 3300006852 Bacteria 4809
36 Ga0075433_10130673 3300006852 Bacteria 2231
37 Ga0075429_100035959 3300006880 Bacteria 4307
38 Ga0075429_100302688 3300006880 Bacteria 1400
39 Ga0097620_100551185 3300006931 Bacteria 1247
40 Ga0075435_100093143 3300007076 Bacteria 2489
41 Ga0111539_10005460 3300009094 Bacteria 16444
42 Ga0114129_10136318 3300009147 Bacteria 3368
43 Ga0114129_10379682 3300009147 Unclassified 1866
44 Ga0114129_10397765 3300009147 Bacteria 1816
45 Ga0105248_10631160 3300009177 Bacteria 1209
46 Ga0105249_10052359 3300009553 Bacteria 3727
47 Ga0105249_10553787 3300009553 Bacteria 1201
48 Ga0157378_10367564 3300013297 Unclassified 1409
49 Ga0163162_10584336 3300013306 Bacteria 1244
50 Ga0157380_10156893 3300014326 Unclassified 1973
51 Ga0213875_10020274 3300021388 Bacteria 3190
52 Ga0209025_1001277 3300025294 Bacteria 34636
53 Ga0207426_1000399 3300025302 Bacteria 73628
54 Ga0207645_10235981 3300025907 Unclassified 1208
55 Ga0207684_10381963 3300025910 Unclassified 1211
56 Ga0207712_10086907 3300025961 Bacteria 2291
57 Ga0207428_10012439 3300027907 Bacteria 7477
58 Ga0268265_10050702 3300028380 Bacteria 3129
59 Ga0268265_10433916 3300028380 Bacteria 1223
60 Ga0265319_1015639 3300028563 Bacteria 2935
61 Ga0265323_10014986 3300028653 Bacteria 3055
62 Ga0265332_10006182 3300031238 Bacteria 5457
63 Ga0265339_10000600 3300031249 Bacteria 28069
64 Ga0265331_10009278 3300031250 Bacteria 5536
65 Ga0307408_100324056 3300031548 Unclassified 1299
66 Ga0265313_10107684 3300031595 Bacteria 1229
67 Ga0316575_10015161 3300031665 Bacteria 2903
68 Ga0265314_10000189 3300031711 Bacteria 91501
69 Ga0265342_10008396 3300031712 Bacteria 7405
70 Ga0316578_10019284 3300031728 Unclassified 3750
71 Ga0316577_10083243 3300031733 Bacteria 1790
72 Ga0316577_10247247 3300031733 Unclassified 1009
73 Ga0373923_0013797 3300035111 Bacteria 3019
74 Ga0373946_0020888 3300035171 Bacteria 2535
75 Ga0316574_0131383 3300035398 Bacteria 1611
76 Ga0316574_0216430 3300035398 Unclassified 1228
77 Ga0373937_0238992 3300036401 Bacteria 1711
78 Ga0373937_0268312 3300036401 Bacteria 1610
79 Ga0316582_0050781 3300036647 Bacteria 2629
80 Ga0316582_0140099 3300036647 Bacteria 1630
81 Ga0316582_0166630 3300036647 Bacteria 1494
82 Ga0316584_0023288 3300036712 Unclassified 4524
83 Ga0316584_0107199 3300036712 Bacteria 2091
84 Ga0316584_0363643 3300036712 Bacteria 1037
85 Ga0316581_0021149 3300037588 Unclassified 1910
86 Ga0436364_1201379 3300037853 Unclassified 3720
87 Ga0436360_0614344 3300039438 Bacteria 2855
88 Ga0451807_2635587 3300041486 Bacteria 747
89 Ga0451577_0006425 3300042876 Bacteria 11726
90 Ga0451577_0011725 3300042876 Bacteria 8273
91 Ga0451577_0029155 3300042876 Bacteria 4988
92 Ga0451577_0045872 3300042876 Bacteria 3911
93 Ga0451577_0121013 3300042876 Unclassified 2345
94 Ga0451577_0270205 3300042876 Bacteria 1540
95 Ga0451577_0338963 3300042876 Bacteria 1364
96 Ga0451577_0357064 3300042876 Bacteria 1326
97 Ga0451577_0376765 3300042876 Unclassified 1287
98 Ga0451577_0820939 3300042876 Unclassified 839
99 Ga0453683_0009519 3300044673 Bacteria 6486
100 Ga0453683_0009528 3300044673 Bacteria 6484
101 Ga0453683_0015509 3300044673 Unclassified 4934
102 Ga0453683_0020033 3300044673 Unclassified 4277
103 Ga0453683_0020725 3300044673 Unclassified 4200
104 Ga0453683_0021593 3300044673 Unclassified 4109
105 Ga0453683_0048064 3300044673 Bacteria 2676
106 Ga0453683_0071542 3300044673 Unclassified 2170
107 Ga0453683_0080564 3300044673 Bacteria 2039
108 Ga0453684_0000003 3300044712 Bacteria 1481694
109 Ga0453684_0000074 3300044712 Bacteria 438364
110 Ga0453684_0000106 3300044712 Bacteria 364365
111 Ga0453684_0000748 3300044712 Bacteria 113352
112 Ga0453684_0000958 3300044712 Bacteria 94987
113 Ga0453684_0001419 3300044712 Bacteria 68999
114 Ga0453684_0002081 3300044712 Bacteria 50801
115 Ga0453684_0002792 3300044712 Bacteria 41284
116 Ga0453684_0004013 3300044712 Bacteria 32067
117 Ga0453684_0006288 3300044712 Bacteria 22720
118 Ga0453684_0007562 3300044712 Bacteria 19923
119 Ga0453684_0022774 3300044712 Bacteria 9276
120 Ga0453684_0040447 3300044712 Bacteria 6330
121 Ga0453684_0043114 3300044712 Bacteria 6070
122 Ga0453684_0059998 3300044712 Bacteria 4898
123 Ga0453684_0066586 3300044712 Unclassified 4586
124 Ga0453684_0067744 3300044712 Bacteria 4538
125 Ga0453684_0071859 3300044712 Unclassified 4372
126 Ga0453684_0214412 3300044712 Unclassified 2235
127 Ga0453684_0291902 3300044712 Unclassified 1856
128 Ga0453684_0303561 3300044712 Bacteria 1814
129 Ga0453684_0322462 3300044712 Bacteria 1749
130 Ga0453684_0327700 3300044712 Bacteria 1732
131 Ga0453684_0423586 3300044712 Bacteria 1486
132 Ga0453684_0500344 3300044712 Bacteria 1346
133 Ga0453684_0771133 3300044712 Unclassified 1039
134 Ga0451576_0000073 3300045051 Bacteria 253094
135 Ga0451576_0008561 3300045051 Bacteria 11999
136 Ga0451576_0009049 3300045051 Bacteria 11595
137 Ga0451576_0041134 3300045051 Bacteria 4887
138 Ga0451576_0061949 3300045051 Unclassified 3900
139 Ga0451576_0076137 3300045051 Bacteria 3492
140 Ga0451576_0197996 3300045051 Unclassified 2098
141 Ga0451576_0322692 3300045051 Bacteria 1616
142 Ga0451576_0407977 3300045051 Bacteria 1425
143 Ga0451576_0847314 3300045051 Unclassified 960
144 Ga0466967_0032683 3300045976 Bacteria 4397
145 Ga0466967_0217312 3300045976 Bacteria 1815
146 Ga0495620_0001226 3300046515 Bacteria 15673
147 Ga0495625_0051419 3300046660 Bacteria 2954
148 Ga0495687_006440 3300047443 Bacteria 7195
149 Ga0501031_0023408 3300049568 Bacteria 4027
150 Ga0501034_0022751 3300049571 Bacteria 6385
151 Ga0501037_0204369 3300049573 Bacteria 1395
152 Ga0501039_0077747 3300049575 Bacteria 2581
153 Ga0501041_0031002 3300049577 Unclassified 3228
154 Ga0501041_0189131 3300049577 Bacteria 1289
155 Ga0501042_0037186 3300049578 Bacteria 3455
156 Ga0501048_0034946 3300049582 Bacteria 3622
157 Ga0501048_0048489 3300049582 Bacteria 3029
158 Ga0501071_0056315 3300049587 Bacteria 2839
159 Ga0501072_0123402 3300049588 Unclassified 2063
160 Ga0501073_0041390 3300049589 Bacteria 3256
161 Ga0501073_0045519 3300049589 Bacteria 3090
162 Ga0501074_0208803 3300049590 Bacteria 1391
163 Ga0501075_0002865 3300049591 Bacteria 11562
164 Ga0501075_0101050 3300049591 Bacteria 2190
165 Ga0501076_0034564 3300049592 Bacteria 3952
166 Ga0501076_0086389 3300049592 Bacteria 2521
167 Ga0501079_0030014 3300049741 Bacteria 4177
168 Ga0501083_0130601 3300049744 Bacteria 1646
169 Ga0501035_0219702 3300049822 Bacteria 1623
170 Ga0501045_0031239 3300049824 Bacteria 3857
171 nmdc:mga0yw44_260102_c1 3300050492 Bacteria 1156
172 nmdc:mga06z11_82851_c1 3300050494 Bacteria 1725
173 nmdc:mga05p37_18200_c1 3300050507 Bacteria 8489
174 nmdc:mga05p37_533935_c1 3300050507 Unclassified 1339
175 nmdc:mga05p37_90492_c1 3300050507 Bacteria 3771
176 nmdc:mga09592_12295_c1 3300050508 Bacteria 6969
177 nmdc:mga0qj67_100930_c1 3300050509 Bacteria 2326
178 nmdc:mga06r32_6809_c1 3300050510 Bacteria 10272
179 nmdc:mga08y16_11212_c2 3300050511 Bacteria 5734
180 nmdc:mga0n895_72570_c1 3300050512 Bacteria 3415
181 nmdc:mga0rr50_29728_c1 3300050513 Unclassified 3858
182 nmdc:mga08x19_253989_c1 3300050514 Bacteria 1214
183 nmdc:mga0a205_21724_c2 3300050515 Unclassified 4135
184 Ga0587101_012062 3300059623 Unclassified 1117
185 Ga0530510_0180957 3300061734 Bacteria 1563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_2635587 Ga0451807_2635587_20_640 203
2 3300028563 Ga0265319_1015639 Ga0265319_10156393 213
3 3300042876 Ga0451577_0820939 Ga0451577_0820939_40_735 222
4 3300021388 Ga0213875_10020274 Ga0213875_100202741 246
5 3300037853 Ga0436364_1201379 Ga0436364_1201379_2336_3100 246
6 3300044673 Ga0453683_0009528 Ga0453683_0009528_4521_5276 246
7 3300045051 Ga0451576_0009049 Ga0451576_0009049_10826_11581 246
8 iso_pu_bacteria 2841760612 2841763057 246
9 iso_pu_bacteria 2844104063 2844109073 246
10 iso_pu_bacteria 2851182111 2851182321 246
11 iso_pu_bacteria 2851246043 2851251180 246
12 3300005328 Ga0070676_10181303 Ga0070676_101813031 247
13 3300005353 Ga0070669_100110202 Ga0070669_1001102022 247
14 3300005843 Ga0068860_100674895 Ga0068860_1006748952 247
15 3300005844 Ga0068862_100212588 Ga0068862_1002125882 247
16 3300005844 Ga0068862_100608583 Ga0068862_1006085832 247
17 3300013297 Ga0157378_10367564 Ga0157378_103675641 247
18 3300025907 Ga0207645_10235981 Ga0207645_102359812 247
19 3300028380 Ga0268265_10433916 Ga0268265_104339162 247
20 3300028653 Ga0265323_10014986 Ga0265323_100149862 247
21 3300046515 Ga0495620_0001226 Ga0495620_0001226_12940_13707 247
22 3300046660 Ga0495625_0051419 Ga0495625_0051419_268_1035 247
23 3300047443 Ga0495687_006440 Ga0495687_006440_6131_6898 247
24 3300003373 JGI25407J50210_10004870 JGI25407J50210_100048701 248
25 3300004799 Ga0058863_10007382 Ga0058863_100073825 248
26 3300005289 Ga0065704_10093456 Ga0065704_100934562 248
27 3300005354 Ga0070675_100415456 Ga0070675_1004154562 248
28 3300005365 Ga0070688_100053216 Ga0070688_1000532162 248
29 3300005445 Ga0070708_100207717 Ga0070708_1002077172 248
30 3300005466 Ga0070685_10222841 Ga0070685_102228412 248
31 3300005471 Ga0070698_100155927 Ga0070698_1001559273 248
32 3300005471 Ga0070698_100800896 Ga0070698_1008008961 248
33 3300005844 Ga0068862_100173742 Ga0068862_1001737422 248
34 3300005937 Ga0081455_10060354 Ga0081455_100603543 248
35 3300005981 Ga0081538_10003630 Ga0081538_100036303 248
36 3300005981 Ga0081538_10052152 Ga0081538_100521522 248
37 3300006844 Ga0075428_100008078 Ga0075428_10000807811 248
38 3300006844 Ga0075428_100497142 Ga0075428_1004971422 248
39 3300006846 Ga0075430_100112647 Ga0075430_1001126472 248
40 3300006847 Ga0075431_100208368 Ga0075431_1002083682 248
41 3300006847 Ga0075431_100485883 Ga0075431_1004858832 248
42 3300006852 Ga0075433_10027695 Ga0075433_100276952 248
43 3300006852 Ga0075433_10130673 Ga0075433_101306733 248
44 3300006880 Ga0075429_100035959 Ga0075429_1000359594 248
45 3300006880 Ga0075429_100302688 Ga0075429_1003026881 248
46 3300007076 Ga0075435_100093143 Ga0075435_1000931432 248
47 3300009094 Ga0111539_10005460 Ga0111539_100054608 248
48 3300009147 Ga0114129_10136318 Ga0114129_101363182 248
49 3300009147 Ga0114129_10379682 Ga0114129_103796822 248
50 3300009177 Ga0105248_10631160 Ga0105248_106311601 248
51 3300009553 Ga0105249_10052359 Ga0105249_100523594 248
52 3300013306 Ga0163162_10584336 Ga0163162_105843362 248
53 3300014326 Ga0157380_10156893 Ga0157380_101568932 248
54 3300025961 Ga0207712_10086907 Ga0207712_100869072 248
55 3300027907 Ga0207428_10012439 Ga0207428_100124394 248
56 3300028380 Ga0268265_10050702 Ga0268265_100507022 248
57 3300031238 Ga0265332_10006182 Ga0265332_100061825 248
58 3300031249 Ga0265339_10000600 Ga0265339_1000060017 248
59 3300031250 Ga0265331_10009278 Ga0265331_100092785 248
60 3300031548 Ga0307408_100324056 Ga0307408_1003240562 248
61 3300031595 Ga0265313_10107684 Ga0265313_101076842 248
62 3300031711 Ga0265314_10000189 Ga0265314_1000018945 248
63 3300031712 Ga0265342_10008396 Ga0265342_100083965 248
64 3300036712 Ga0316584_0023288 Ga0316584_0023288_693_1472 248
65 3300037588 Ga0316581_0021149 Ga0316581_0021149_194_973 248
66 3300042876 Ga0451577_0376765 Ga0451577_0376765_82_837 248
67 3300044712 Ga0453684_0000748 Ga0453684_0000748_89860_90615 248
68 3300044712 Ga0453684_0303561 Ga0453684_0303561_786_1541 248
69 3300045051 Ga0451576_0000073 Ga0451576_0000073_240627_241382 248
70 3300045051 Ga0451576_0197996 Ga0451576_0197996_512_1267 248
71 3300045976 Ga0466967_0032683 Ga0466967_0032683_1170_1943 248
72 3300049568 Ga0501031_0023408 Ga0501031_0023408_1971_2741 248
73 3300049571 Ga0501034_0022751 Ga0501034_0022751_1730_2491 248
74 3300049577 Ga0501041_0031002 Ga0501041_0031002_1997_2767 248
75 3300049578 Ga0501042_0037186 Ga0501042_0037186_1446_2216 248
76 3300049582 Ga0501048_0034946 Ga0501048_0034946_1684_2454 248
77 3300049589 Ga0501073_0045519 Ga0501073_0045519_1339_2100 248
78 3300049591 Ga0501075_0101050 Ga0501075_0101050_130_900 248
79 3300049592 Ga0501076_0086389 Ga0501076_0086389_588_1358 248
80 3300049744 Ga0501083_0130601 Ga0501083_0130601_739_1500 248
81 3300050494 nmdc:mga06z11_82851_c1 nmdc:mga06z11_82851_c1_271_1041 248
82 3300050507 nmdc:mga05p37_18200_c1 nmdc:mga05p37_18200_c1_480_1235 248
83 3300050507 nmdc:mga05p37_533935_c1 nmdc:mga05p37_533935_c1_353_1126 248
84 3300050508 nmdc:mga09592_12295_c1 nmdc:mga09592_12295_c1_5822_6586 248
85 3300050509 nmdc:mga0qj67_100930_c1 nmdc:mga0qj67_100930_c1_914_1687 248
86 3300050511 nmdc:mga08y16_11212_c2 nmdc:mga08y16_11212_c2_762_1526 248
87 3300050512 nmdc:mga0n895_72570_c1 nmdc:mga0n895_72570_c1_1672_2427 248
88 3300050513 nmdc:mga0rr50_29728_c1 nmdc:mga0rr50_29728_c1_2085_2840 248
89 3300050515 nmdc:mga0a205_21724_c2 nmdc:mga0a205_21724_c2_1626_2381 248
90 3300059623 Ga0587101_012062 Ga0587101_012062_309_1064 248
91 3300005617 Ga0068859_100551172 Ga0068859_1005511722 249
92 3300005981 Ga0081538_10009191 Ga0081538_100091913 249
93 3300006847 Ga0075431_100016934 Ga0075431_1000169347 249
94 3300006931 Ga0097620_100551185 Ga0097620_1005511852 249
95 3300009553 Ga0105249_10553787 Ga0105249_105537872 249
96 3300031665 Ga0316575_10015161 Ga0316575_100151612 249
97 3300031733 Ga0316577_10083243 Ga0316577_100832431 249
98 3300031733 Ga0316577_10247247 Ga0316577_102472471 249
99 3300035398 Ga0316574_0131383 Ga0316574_0131383_241_999 249
100 3300036647 Ga0316582_0166630 Ga0316582_0166630_138_917 249
101 3300036712 Ga0316584_0363643 Ga0316584_0363643_255_1013 249
102 3300042876 Ga0451577_0357064 Ga0451577_0357064_343_1125 249
103 3300044712 Ga0453684_0006288 Ga0453684_0006288_11038_11814 249
104 3300044712 Ga0453684_0066586 Ga0453684_0066586_713_1495 249
105 3300044712 Ga0453684_0327700 Ga0453684_0327700_875_1657 249
106 3300050510 nmdc:mga06r32_6809_c1 nmdc:mga06r32_6809_c1_4547_5329 249
107 iso_pu_bacteria 2617270889 2617917912 249
108 iso_pu_bacteria 2831426010 2831432717 249
109 iso_pu_bacteria 2848694841 2848700836 249
110 iso_pu_bacteria 2913912277 2913912444 249
111 iso_pu_bacteria 642555144 642605923 249
112 3300005467 Ga0070706_100237903 Ga0070706_1002379032 250
113 3300005545 Ga0070695_100275263 Ga0070695_1002752633 250
114 3300009147 Ga0114129_10397765 Ga0114129_103977652 250
115 3300025910 Ga0207684_10381963 Ga0207684_103819631 250
116 3300031728 Ga0316578_10019284 Ga0316578_100192843 250
117 3300036647 Ga0316582_0050781 Ga0316582_0050781_831_1601 250
118 3300036647 Ga0316582_0140099 Ga0316582_0140099_120_890 250
119 3300036712 Ga0316584_0107199 Ga0316584_0107199_723_1493 250
120 3300042876 Ga0451577_0006425 Ga0451577_0006425_1746_2525 250
121 3300042876 Ga0451577_0011725 Ga0451577_0011725_3651_4430 250
122 3300042876 Ga0451577_0029155 Ga0451577_0029155_3760_4539 250
123 3300042876 Ga0451577_0045872 Ga0451577_0045872_2361_3152 250
124 3300042876 Ga0451577_0121013 Ga0451577_0121013_359_1144 250
125 3300042876 Ga0451577_0270205 Ga0451577_0270205_701_1480 250
126 3300042876 Ga0451577_0338963 Ga0451577_0338963_430_1212 250
127 3300044673 Ga0453683_0009519 Ga0453683_0009519_4644_5423 250
128 3300044673 Ga0453683_0015509 Ga0453683_0015509_255_1040 250
129 3300044673 Ga0453683_0020033 Ga0453683_0020033_750_1529 250
130 3300044673 Ga0453683_0020725 Ga0453683_0020725_1368_2150 250
131 3300044673 Ga0453683_0021593 Ga0453683_0021593_690_1475 250
132 3300044673 Ga0453683_0048064 Ga0453683_0048064_1763_2551 250
133 3300044673 Ga0453683_0071542 Ga0453683_0071542_1272_2051 250
134 3300044673 Ga0453683_0080564 Ga0453683_0080564_99_884 250
135 3300044712 Ga0453684_0000003 Ga0453684_0000003_836661_837440 250
136 3300044712 Ga0453684_0000074 Ga0453684_0000074_222997_223776 250
137 3300044712 Ga0453684_0000106 Ga0453684_0000106_29735_30514 250
138 3300044712 Ga0453684_0000748 Ga0453684_0000748_92176_92955 250
139 3300044712 Ga0453684_0000958 Ga0453684_0000958_75559_76338 250
140 3300044712 Ga0453684_0001419 Ga0453684_0001419_65375_66166 250
141 3300044712 Ga0453684_0002081 Ga0453684_0002081_29948_30727 250
142 3300044712 Ga0453684_0004013 Ga0453684_0004013_16110_16889 250
143 3300044712 Ga0453684_0007562 Ga0453684_0007562_11767_12552 250
144 3300044712 Ga0453684_0022774 Ga0453684_0022774_4789_5574 250
145 3300044712 Ga0453684_0040447 Ga0453684_0040447_5478_6257 250
146 3300044712 Ga0453684_0043114 Ga0453684_0043114_2900_3682 250
147 3300044712 Ga0453684_0059998 Ga0453684_0059998_1420_2199 250
148 3300044712 Ga0453684_0067744 Ga0453684_0067744_2212_2991 250
149 3300044712 Ga0453684_0071859 Ga0453684_0071859_507_1292 250
150 3300044712 Ga0453684_0214412 Ga0453684_0214412_1184_1963 250
151 3300044712 Ga0453684_0291902 Ga0453684_0291902_259_1041 250
152 3300044712 Ga0453684_0322462 Ga0453684_0322462_255_1037 250
153 3300044712 Ga0453684_0423586 Ga0453684_0423586_121_900 250
154 3300044712 Ga0453684_0500344 Ga0453684_0500344_268_1047 250
155 3300044712 Ga0453684_0771133 Ga0453684_0771133_247_1026 250
156 3300045051 Ga0451576_0000073 Ga0451576_0000073_246704_247483 250
157 3300045051 Ga0451576_0008561 Ga0451576_0008561_8294_9079 250
158 3300045051 Ga0451576_0041134 Ga0451576_0041134_1144_1923 250
159 3300045051 Ga0451576_0061949 Ga0451576_0061949_2337_3116 250
160 3300045051 Ga0451576_0076137 Ga0451576_0076137_2259_3038 250
161 3300045051 Ga0451576_0322692 Ga0451576_0322692_318_1103 250
162 3300045051 Ga0451576_0407977 Ga0451576_0407977_472_1260 250
163 3300045051 Ga0451576_0847314 Ga0451576_0847314_37_819 250
164 3300050507 nmdc:mga05p37_90492_c1 nmdc:mga05p37_90492_c1_726_1511 250
165 3300050514 nmdc:mga08x19_253989_c1 nmdc:mga08x19_253989_c1_69_854 250
166 3300006038 Ga0075365_10287837 Ga0075365_102878372 251
167 3300025294 Ga0209025_1001277 Ga0209025_100127714 251
168 3300044712 Ga0453684_0002792 Ga0453684_0002792_35482_36264 251
169 3300050492 nmdc:mga0yw44_260102_c1 nmdc:mga0yw44_260102_c1_98_874 251
170 iso_pu_bacteria 2617270889 2617912976 251
171 iso_pu_bacteria 2913939268 2913939878 251
172 iso_pu_bacteria 642555144 642601035 251
173 3300039438 Ga0436360_0614344 Ga0436360_0614344_589_1356 252
174 3300035398 Ga0316574_0216430 Ga0316574_0216430_336_1109 253
175 3300036401 Ga0373937_0238992 Ga0373937_0238992_688_1476 253
176 3300049589 Ga0501073_0041390 Ga0501073_0041390_1292_2077 253
177 3300005518 Ga0070699_100026187 Ga0070699_1000261872 254
178 3300005546 Ga0070696_100019580 Ga0070696_1000195803 254
179 3300003354 JGI25160J50197_1035119 JGI25160J50197_10351192 255
180 3300005471 Ga0070698_100233366 Ga0070698_1002333662 255
181 3300006028 Ga0070717_10440870 Ga0070717_104408701 255
182 3300025302 Ga0207426_1000399 Ga0207426_100039946 255
183 3300035111 Ga0373923_0013797 Ga0373923_0013797_464_1258 255
184 3300035171 Ga0373946_0020888 Ga0373946_0020888_851_1645 255
185 3300036401 Ga0373937_0268312 Ga0373937_0268312_316_1110 255
186 3300045976 Ga0466967_0217312 Ga0466967_0217312_423_1217 255
187 3300049573 Ga0501037_0204369 Ga0501037_0204369_192_986 255
188 3300049575 Ga0501039_0077747 Ga0501039_0077747_143_937 255
189 3300049577 Ga0501041_0189131 Ga0501041_0189131_258_1052 255
190 3300049582 Ga0501048_0048489 Ga0501048_0048489_2030_2824 255
191 3300049587 Ga0501071_0056315 Ga0501071_0056315_286_1080 255
192 3300049588 Ga0501072_0123402 Ga0501072_0123402_1212_2006 255
193 3300049590 Ga0501074_0208803 Ga0501074_0208803_371_1165 255
194 3300049591 Ga0501075_0002865 Ga0501075_0002865_2379_3173 255
195 3300049592 Ga0501076_0034564 Ga0501076_0034564_564_1358 255
196 3300049741 Ga0501079_0030014 Ga0501079_0030014_3208_4002 255
197 3300049822 Ga0501035_0219702 Ga0501035_0219702_767_1561 255
198 3300049824 Ga0501045_0031239 Ga0501045_0031239_2972_3766 255
199 3300061734 Ga0530510_0180957 Ga0530510_0180957_560_1354 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

5

233

0.95

PF13614

AAA_31

AAA domain

2

189

0.82

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

1

255

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v03-assembly1.cif.gz_B mind cell division protein, aquifex aeolicus 0.8383 2 244
3r9i-assembly2.cif.gz_C 2.6a resolution structure of mind complexed with mine (12-31) peptide 0.8337 2 243
1ion-assembly1.cif.gz_A the septum site-determining protein mind complexed with mg-adp from pyrococcus horikoshii ot3 0.8285 1 255
4v02-assembly1.cif.gz_A minc:mind cell division protein complex, aquifex aeolicus 0.8274 2 245
5tvk-assembly1.cif.gz_B crystal structure of putative plasmid partition protein (bb_s35) from borrelia burgdorferi b31 bound to amppnp 0.8273 1 244
ID Description Score Start End Superfamily
af_Q57633_4_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8726 3 244 3.40.50.300
af_Q57633_4_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8621 3 244 3.40.50.300
3r9iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8337 2 243 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8274 2 245 3.40.50.300
af_Q57853_2_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.819 3 248 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A845XLS9-F1-model_v4 MinD/ParA family protein 0.937 3 244 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A359EBF8-F1-model_v4 CDP-3, 6-dideoxy-D-glycero-L-glycero-4-hexulose-4-reductase 0.9319 1 247
AF-A0A2N6G027-F1-model_v4 CDP-3, 6-dideoxy-D-glycero-L-glycero-4-hexulose-4-reductase 0.9314 1 248
AF-A0A4R6UNY3-F1-model_v4 MinD-like ATPase involved in chromosome partitioning or flagellar assembly 0.9311 1 244 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A7W2BXZ1-F1-model_v4 deleted 0.9302 1 244

Feature Viewer

pLDDT pTM Quality
85.71 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map