F305584
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 199 | 118 | 198 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300005719|Ga0068861_100329380|Ga0068861_1003293801 |
| Length | 317 |
| Sequence | MHAVYEQLLILLSTPFYVAIIALEVLLSNYQHRKLYSWRDTATNVYLMLLNSAIDLLFRSFYIAILAYCYQHRYLEWHNVIMYWALLLLAEDFLYYWLHRFDHEIRLFWAVHVTHNFTVGFRSSVFQPLYRFIYFIPLAILGFKPLDIVFMYSLTQIWGIFVHTEVVRKMGILEYFMVTPSHHRVHHASNPKYLDRNLGMFLIIWDKMFGTFQPELPDKEYQTLKYGLTKPLEKDNATNIVFHEWKQILKDLKRSDIGLREKLFYLFGPPGWSHDASRQTSEQLREQELFEQDEKKEDPSLSIPKENLAPVVTSINQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 34 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 85 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 86 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 87 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 88 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 89 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 90 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 91 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 92 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 93 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 94 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 95 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 96 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 97 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 98 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 99 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 100 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 112 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 116 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 117 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 118 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0 |
| Isolates | 0.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.01 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 92.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10021140 | 3300003316 | Bacteria | 8344 |
| 2 | rootH2_10074876 | 3300003320 | Bacteria | 1923 |
| 3 | rootH2_10087488 | 3300003320 | Bacteria | 3499 |
| 4 | rootL2_10027987 | 3300003322 | Bacteria | 2837 |
| 5 | rootH1_10329320 | 3300003323 | Unclassified | 1221 |
| 6 | Ga0070683_100015119 | 3300005329 | Bacteria | 6774 |
| 7 | Ga0070683_100052913 | 3300005329 | Bacteria | 3762 |
| 8 | Ga0070670_100186793 | 3300005331 | Bacteria | 1800 |
| 9 | Ga0068869_100159270 | 3300005334 | Bacteria | 1756 |
| 10 | Ga0070666_10026921 | 3300005335 | Bacteria | 3762 |
| 11 | Ga0070666_10129493 | 3300005335 | Bacteria | 1753 |
| 12 | Ga0070682_100013837 | 3300005337 | Bacteria | 4652 |
| 13 | Ga0068868_100195317 | 3300005338 | Unclassified | 1684 |
| 14 | Ga0070660_100005499 | 3300005339 | Bacteria | 8776 |
| 15 | Ga0070671_100144480 | 3300005355 | Bacteria | 2008 |
| 16 | Ga0070674_100010085 | 3300005356 | Bacteria | 5691 |
| 17 | Ga0070659_100005352 | 3300005366 | Bacteria | 9211 |
| 18 | Ga0070667_100237352 | 3300005367 | Bacteria | 1627 |
| 19 | Ga0070662_100006981 | 3300005457 | Bacteria | 7307 |
| 20 | Ga0068867_100217651 | 3300005459 | Unclassified | 1537 |
| 21 | Ga0068867_100223843 | 3300005459 | Bacteria | 1517 |
| 22 | Ga0070679_100195266 | 3300005530 | Unclassified | 1992 |
| 23 | Ga0070684_100009329 | 3300005535 | Bacteria | 7723 |
| 24 | Ga0070684_100040820 | 3300005535 | Bacteria | 3997 |
| 25 | Ga0068853_100063025 | 3300005539 | Bacteria | 3210 |
| 26 | Ga0068853_100428790 | 3300005539 | Bacteria | 1241 |
| 27 | Ga0070665_100000009 | 3300005548 | Bacteria | 562640 |
| 28 | Ga0068855_100096088 | 3300005563 | Bacteria | 3415 |
| 29 | Ga0068855_100182049 | 3300005563 | Unclassified | 2375 |
| 30 | Ga0068855_100336460 | 3300005563 | Bacteria | 1665 |
| 31 | Ga0070664_100000950 | 3300005564 | Bacteria | 22641 |
| 32 | Ga0068857_100023094 | 3300005577 | Bacteria | 5470 |
| 33 | Ga0068857_100072415 | 3300005577 | Bacteria | 3071 |
| 34 | Ga0068857_100132738 | 3300005577 | Bacteria | 2247 |
| 35 | Ga0068854_100109954 | 3300005578 | Bacteria | 2077 |
| 36 | Ga0068856_100033678 | 3300005614 | Bacteria | 5017 |
| 37 | Ga0068856_100083452 | 3300005614 | Bacteria | 3173 |
| 38 | Ga0068856_100134980 | 3300005614 | Bacteria | 2473 |
| 39 | Ga0070702_100009894 | 3300005615 | Unclassified | 4682 |
| 40 | Ga0068852_100002840 | 3300005616 | Bacteria | 12011 |
| 41 | Ga0068852_100117923 | 3300005616 | Bacteria | 2425 |
| 42 | Ga0068852_100264797 | 3300005616 | Bacteria | 1652 |
| 43 | Ga0068866_10129529 | 3300005718 | Bacteria | 1433 |
| 44 | Ga0068861_100329380 | 3300005719 | Bacteria | 1332 |
| 45 | Ga0068861_100405165 | 3300005719 | Bacteria | 1211 |
| 46 | Ga0068860_100000078 | 3300005843 | Bacteria | 171062 |
| 47 | Ga0068860_100074564 | 3300005843 | Unclassified | 3227 |
| 48 | Ga0081540_1003562 | 3300005983 | Bacteria | 12251 |
| 49 | Ga0081539_10001226 | 3300005985 | Bacteria | 45853 |
| 50 | Ga0075366_10017154 | 3300006195 | Bacteria | 4165 |
| 51 | Ga0097621_100465896 | 3300006237 | Bacteria | 1140 |
| 52 | Ga0068871_100010171 | 3300006358 | Bacteria | 6852 |
| 53 | Ga0068871_100056845 | 3300006358 | Bacteria | 3182 |
| 54 | Ga0105240_10000263 | 3300009093 | Bacteria | 103973 |
| 55 | Ga0105240_10014873 | 3300009093 | Bacteria | 10605 |
| 56 | Ga0105240_10024146 | 3300009093 | Bacteria | 8023 |
| 57 | Ga0105240_10024327 | 3300009093 | Bacteria | 7987 |
| 58 | Ga0105240_10110312 | 3300009093 | Bacteria | 3330 |
| 59 | Ga0105240_10347005 | 3300009093 | Bacteria | 1685 |
| 60 | Ga0111539_10040039 | 3300009094 | Bacteria | 5644 |
| 61 | Ga0114129_10006797 | 3300009147 | Bacteria | 16240 |
| 62 | Ga0105241_10000384 | 3300009174 | Bacteria | 33496 |
| 63 | Ga0105241_10048607 | 3300009174 | Bacteria | 3229 |
| 64 | Ga0105237_10001123 | 3300009545 | Bacteria | 35881 |
| 65 | Ga0105237_10005503 | 3300009545 | Bacteria | 14274 |
| 66 | Ga0105237_10008043 | 3300009545 | Bacteria | 11467 |
| 67 | Ga0105237_10009512 | 3300009545 | Bacteria | 10407 |
| 68 | Ga0105237_10015253 | 3300009545 | Bacteria | 8004 |
| 69 | Ga0105237_10023708 | 3300009545 | Bacteria | 6282 |
| 70 | Ga0105238_10000536 | 3300009551 | Bacteria | 39756 |
| 71 | Ga0105238_10025613 | 3300009551 | Bacteria | 6013 |
| 72 | Ga0105238_10324170 | 3300009551 | Bacteria | 1527 |
| 73 | Ga0105249_10544137 | 3300009553 | Bacteria | 1211 |
| 74 | Ga0105239_10000760 | 3300010375 | Bacteria | 45542 |
| 75 | Ga0105239_10002155 | 3300010375 | Bacteria | 25331 |
| 76 | Ga0105239_10003509 | 3300010375 | Bacteria | 19199 |
| 77 | Ga0105239_10004319 | 3300010375 | Bacteria | 17042 |
| 78 | Ga0105239_10004921 | 3300010375 | Bacteria | 15791 |
| 79 | Ga0105239_10077689 | 3300010375 | Bacteria | 3653 |
| 80 | Ga0105239_10194993 | 3300010375 | Bacteria | 2268 |
| 81 | Ga0105239_10276668 | 3300010375 | Bacteria | 1889 |
| 82 | Ga0157371_10024064 | 3300013102 | Bacteria | 4449 |
| 83 | Ga0157370_10001887 | 3300013104 | Bacteria | 25802 |
| 84 | Ga0157370_10046983 | 3300013104 | Bacteria | 4139 |
| 85 | Ga0157370_10052709 | 3300013104 | Bacteria | 3883 |
| 86 | Ga0157369_10004105 | 3300013105 | Bacteria | 17247 |
| 87 | Ga0157369_10056659 | 3300013105 | Bacteria | 4229 |
| 88 | Ga0157369_10162241 | 3300013105 | Bacteria | 2359 |
| 89 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 90 | Ga0157374_10032223 | 3300013296 | Bacteria | 4770 |
| 91 | Ga0157374_10111422 | 3300013296 | Bacteria | 2633 |
| 92 | Ga0157378_10008134 | 3300013297 | Bacteria | 9153 |
| 93 | Ga0157378_10008492 | 3300013297 | Bacteria | 8946 |
| 94 | Ga0163162_10000624 | 3300013306 | Bacteria | 32874 |
| 95 | Ga0163162_10196419 | 3300013306 | Bacteria | 2146 |
| 96 | Ga0157372_10002492 | 3300013307 | Bacteria | 19958 |
| 97 | Ga0157375_10201882 | 3300013308 | Bacteria | 2144 |
| 98 | Ga0157375_10267947 | 3300013308 | Bacteria | 1870 |
| 99 | Ga0157375_10767337 | 3300013308 | Bacteria | 1115 |
| 100 | Ga0157375_10780375 | 3300013308 | Bacteria | 1105 |
| 101 | Ga0157377_10061600 | 3300014745 | Bacteria | 2145 |
| 102 | Ga0157376_10001744 | 3300014969 | Bacteria | 14472 |
| 103 | Ga0157376_10053660 | 3300014969 | Bacteria | 3357 |
| 104 | Ga0207688_10043815 | 3300025901 | Bacteria | 2493 |
| 105 | Ga0207680_10007396 | 3300025903 | Bacteria | 5348 |
| 106 | Ga0207647_10014949 | 3300025904 | Bacteria | 5334 |
| 107 | Ga0207647_10021474 | 3300025904 | Unclassified | 4309 |
| 108 | Ga0207654_10000887 | 3300025911 | Bacteria | 16589 |
| 109 | Ga0207707_10034150 | 3300025912 | Bacteria | 4450 |
| 110 | Ga0207695_10000016 | 3300025913 | Bacteria | 771991 |
| 111 | Ga0207695_10000128 | 3300025913 | Bacteria | 226098 |
| 112 | Ga0207695_10000296 | 3300025913 | Bacteria | 123322 |
| 113 | Ga0207695_10004554 | 3300025913 | Bacteria | 18847 |
| 114 | Ga0207695_10022769 | 3300025913 | Bacteria | 7099 |
| 115 | Ga0207695_10050912 | 3300025913 | Unclassified | 4353 |
| 116 | Ga0207695_10087514 | 3300025913 | Bacteria | 3138 |
| 117 | Ga0207695_10144107 | 3300025913 | Unclassified | 2328 |
| 118 | Ga0207671_10004253 | 3300025914 | Bacteria | 13784 |
| 119 | Ga0207671_10004676 | 3300025914 | Bacteria | 12952 |
| 120 | Ga0207671_10011496 | 3300025914 | Bacteria | 7195 |
| 121 | Ga0207671_10016235 | 3300025914 | Bacteria | 5795 |
| 122 | Ga0207671_10058381 | 3300025914 | Bacteria | 2860 |
| 123 | Ga0207660_10056274 | 3300025917 | Bacteria | 2814 |
| 124 | Ga0207657_10004992 | 3300025919 | Bacteria | 13947 |
| 125 | Ga0207694_10000720 | 3300025924 | Bacteria | 29711 |
| 126 | Ga0207694_10036463 | 3300025924 | Bacteria | 3775 |
| 127 | Ga0207694_10093751 | 3300025924 | Bacteria | 2372 |
| 128 | Ga0207694_10135391 | 3300025924 | Bacteria | 1978 |
| 129 | Ga0207644_10096743 | 3300025931 | Bacteria | 2211 |
| 130 | Ga0207706_10005696 | 3300025933 | Bacteria | 11606 |
| 131 | Ga0207669_10203791 | 3300025937 | Bacteria | 1438 |
| 132 | Ga0207661_10003970 | 3300025944 | Bacteria | 10335 |
| 133 | Ga0207679_10046524 | 3300025945 | Bacteria | 3146 |
| 134 | Ga0207667_10000143 | 3300025949 | Bacteria | 108717 |
| 135 | Ga0207667_10000583 | 3300025949 | Bacteria | 47418 |
| 136 | Ga0207667_10148492 | 3300025949 | Unclassified | 2413 |
| 137 | Ga0207667_10152886 | 3300025949 | Bacteria | 2375 |
| 138 | Ga0207640_10060484 | 3300025981 | Bacteria | 2504 |
| 139 | Ga0207658_10198394 | 3300025986 | Bacteria | 1674 |
| 140 | Ga0207677_10065738 | 3300026023 | Bacteria | 2532 |
| 141 | Ga0207677_10246742 | 3300026023 | Unclassified | 1448 |
| 142 | Ga0207639_10023498 | 3300026041 | Bacteria | 4453 |
| 143 | Ga0207639_10048440 | 3300026041 | Bacteria | 3217 |
| 144 | Ga0207639_10076414 | 3300026041 | Bacteria | 2637 |
| 145 | Ga0207639_10120395 | 3300026041 | Unclassified | 2156 |
| 146 | Ga0207639_10276652 | 3300026041 | Bacteria | 1475 |
| 147 | Ga0207702_10087567 | 3300026078 | Bacteria | 2719 |
| 148 | Ga0207702_10149620 | 3300026078 | Bacteria | 2122 |
| 149 | Ga0207641_10258901 | 3300026088 | Bacteria | 1628 |
| 150 | Ga0207648_10073577 | 3300026089 | Unclassified | 2978 |
| 151 | Ga0207676_10375458 | 3300026095 | Bacteria | 1322 |
| 152 | Ga0207674_10013442 | 3300026116 | Bacteria | 9086 |
| 153 | Ga0207674_10120220 | 3300026116 | Bacteria | 2595 |
| 154 | Ga0207674_10322349 | 3300026116 | Bacteria | 1494 |
| 155 | Ga0207698_10003520 | 3300026142 | Bacteria | 9440 |
| 156 | Ga0268266_10000014 | 3300028379 | Bacteria | 644033 |
| 157 | Ga0268264_10000105 | 3300028381 | Bacteria | 212531 |
| 158 | Ga0268264_10003887 | 3300028381 | Bacteria | 12806 |
| 159 | Ga0268264_10068813 | 3300028381 | Bacteria | 2993 |
| 160 | Ga0307517_10021498 | 3300028786 | Bacteria | 8145 |
| 161 | Ga0307509_10034760 | 3300031507 | Bacteria | 5537 |
| 162 | Ga0307509_10121639 | 3300031507 | Bacteria | 2586 |
| 163 | Ga0373952_0029121 | 3300035092 | Bacteria | 1215 |
| 164 | Ga0436365_1553484 | 3300039437 | Bacteria | 10706 |
| 165 | Ga0439449_0074719 | 3300042007 | Bacteria | 1249 |
| 166 | Ga0466969_0000244 | 3300044656 | Bacteria | 29819 |
| 167 | Ga0466972_0006774 | 3300044658 | Bacteria | 5750 |
| 168 | Ga0466972_0010045 | 3300044658 | Bacteria | 4754 |
| 169 | Ga0466966_0034900 | 3300044684 | Unclassified | 3251 |
| 170 | Ga0466961_0016976 | 3300044693 | Bacteria | 4675 |
| 171 | Ga0466964_0032751 | 3300044706 | Bacteria | 2067 |
| 172 | Ga0453684_0023453 | 3300044712 | Bacteria | 9086 |
| 173 | Ga0466968_0006501 | 3300044735 | Bacteria | 4408 |
| 174 | Ga0466970_0025652 | 3300044765 | Bacteria | 3087 |
| 175 | Ga0466957_0000218 | 3300044842 | Bacteria | 27018 |
| 176 | Ga0466959_0000039 | 3300045049 | Bacteria | 101186 |
| 177 | Ga0466959_0004171 | 3300045049 | Bacteria | 9628 |
| 178 | Ga0466967_0080611 | 3300045976 | Bacteria | 2938 |
| 179 | Ga0495664_0142350 | 3300046477 | Unclassified | 1454 |
| 180 | Ga0495608_0083467 | 3300046511 | Bacteria | 2074 |
| 181 | Ga0495618_0046549 | 3300046514 | Unclassified | 2738 |
| 182 | Ga0495587_0024806 | 3300046536 | Bacteria | 3671 |
| 183 | Ga0495668_0004004 | 3300046616 | Bacteria | 10726 |
| 184 | Ga0495611_0000983 | 3300046648 | Bacteria | 15159 |
| 185 | Ga0495599_0151167 | 3300046678 | Bacteria | 1438 |
| 186 | Ga0495687_000056 | 3300047443 | Bacteria | 188227 |
| 187 | Ga0495684_0024797 | 3300047471 | Bacteria | 4612 |
| 188 | Ga0501034_0013554 | 3300049571 | Bacteria | 8390 |
| 189 | Ga0501047_0039106 | 3300049581 | Bacteria | 4589 |
| 190 | Ga0501257_013045 | 3300049686 | Bacteria | 1904 |
| 191 | Ga0501035_0046225 | 3300049822 | Bacteria | 3916 |
| 192 | nmdc:mga05p37_970_c1 | 3300050507 | Bacteria | 16850 |
| 193 | nmdc:mga08y16_164005_c1 | 3300050511 | Bacteria | 2308 |
| 194 | Ga0500578_0086701 | 3300053086 | Bacteria | 1989 |
| 195 | Ga0500637_0105403 | 3300053178 | Unclassified | 1635 |
| 196 | Ga0500645_055722 | 3300053730 | Bacteria | 1148 |
| 197 | Ga0466962_0003550 | 3300061719 | Bacteria | 7429 |
| 198 | Ga0466962_0091252 | 3300061719 | Bacteria | 1460 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_100217651 | Ga0068867_1002176512 | 290 |
| 2 | 3300005614 | Ga0068856_100083452 | Ga0068856_1000834523 | 290 |
| 3 | 3300026078 | Ga0207702_10087567 | Ga0207702_100875672 | 290 |
| 4 | 3300003323 | rootH1_10329320 | rootH1_103293201 | 294 |
| 5 | 3300005719 | Ga0068861_100405165 | Ga0068861_1004051651 | 294 |
| 6 | 3300006195 | Ga0075366_10017154 | Ga0075366_100171544 | 294 |
| 7 | 3300044842 | Ga0466957_0000218 | Ga0466957_0000218_8517_9458 | 294 |
| 8 | 3300042007 | Ga0439449_0074719 | Ga0439449_0074719_220_1107 | 295 |
| 9 | 3300003320 | rootH2_10074876 | rootH2_100748762 | 296 |
| 10 | 3300005577 | Ga0068857_100072415 | Ga0068857_1000724152 | 296 |
| 11 | 3300005614 | Ga0068856_100134980 | Ga0068856_1001349802 | 296 |
| 12 | 3300009174 | Ga0105241_10048607 | Ga0105241_100486072 | 296 |
| 13 | 3300009545 | Ga0105237_10023708 | Ga0105237_100237085 | 296 |
| 14 | 3300025914 | Ga0207671_10058381 | Ga0207671_100583813 | 296 |
| 15 | 3300026078 | Ga0207702_10149620 | Ga0207702_101496202 | 296 |
| 16 | 3300026116 | Ga0207674_10120220 | Ga0207674_101202202 | 296 |
| 17 | 3300013104 | Ga0157370_10052709 | Ga0157370_100527092 | 297 |
| 18 | 3300044712 | Ga0453684_0023453 | Ga0453684_0023453_368_1264 | 297 |
| 19 | 3300010375 | Ga0105239_10002155 | Ga0105239_100021558 | 298 |
| 20 | 3300025901 | Ga0207688_10043815 | Ga0207688_100438151 | 298 |
| 21 | 3300025945 | Ga0207679_10046524 | Ga0207679_100465242 | 298 |
| 22 | 3300026088 | Ga0207641_10258901 | Ga0207641_102589012 | 299 |
| 23 | 3300031507 | Ga0307509_10121639 | Ga0307509_101216393 | 299 |
| 24 | 3300046648 | Ga0495611_0000983 | Ga0495611_0000983_11186_12166 | 299 |
| 25 | 3300005335 | Ga0070666_10026921 | Ga0070666_100269213 | 300 |
| 26 | 3300025903 | Ga0207680_10007396 | Ga0207680_100073964 | 300 |
| 27 | 3300014969 | Ga0157376_10053660 | Ga0157376_100536601 | 301 |
| 28 | 3300044706 | Ga0466964_0032751 | Ga0466964_0032751_893_1834 | 301 |
| 29 | 3300005334 | Ga0068869_100159270 | Ga0068869_1001592701 | 302 |
| 30 | 3300005355 | Ga0070671_100144480 | Ga0070671_1001444801 | 302 |
| 31 | 3300005539 | Ga0068853_100063025 | Ga0068853_1000630252 | 302 |
| 32 | 3300006237 | Ga0097621_100465896 | Ga0097621_1004658961 | 302 |
| 33 | 3300026041 | Ga0207639_10048440 | Ga0207639_100484403 | 302 |
| 34 | 3300049581 | Ga0501047_0039106 | Ga0501047_0039106_2287_3222 | 302 |
| 35 | 3300009147 | Ga0114129_10006797 | Ga0114129_1000679713 | 303 |
| 36 | 3300050507 | nmdc:mga05p37_970_c1 | nmdc:mga05p37_970_c1_5149_6084 | 303 |
| 37 | 3300005331 | Ga0070670_100186793 | Ga0070670_1001867931 | 304 |
| 38 | 3300005563 | Ga0068855_100182049 | Ga0068855_1001820491 | 304 |
| 39 | 3300005616 | Ga0068852_100117923 | Ga0068852_1001179231 | 304 |
| 40 | 3300005983 | Ga0081540_1003562 | Ga0081540_10035621 | 304 |
| 41 | 3300009093 | Ga0105240_10024327 | Ga0105240_100243271 | 304 |
| 42 | 3300009093 | Ga0105240_10347005 | Ga0105240_103470052 | 304 |
| 43 | 3300009545 | Ga0105237_10008043 | Ga0105237_100080438 | 304 |
| 44 | 3300009545 | Ga0105237_10009512 | Ga0105237_100095125 | 304 |
| 45 | 3300010375 | Ga0105239_10000760 | Ga0105239_1000076012 | 304 |
| 46 | 3300010375 | Ga0105239_10077689 | Ga0105239_100776892 | 304 |
| 47 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002243 | 304 |
| 48 | 3300013306 | Ga0163162_10196419 | Ga0163162_101964192 | 304 |
| 49 | 3300013307 | Ga0157372_10002492 | Ga0157372_100024922 | 304 |
| 50 | 3300014969 | Ga0157376_10001744 | Ga0157376_100017444 | 304 |
| 51 | 3300025904 | Ga0207647_10021474 | Ga0207647_100214746 | 304 |
| 52 | 3300025913 | Ga0207695_10000016 | Ga0207695_1000001678 | 304 |
| 53 | 3300025913 | Ga0207695_10000296 | Ga0207695_1000029671 | 304 |
| 54 | 3300025913 | Ga0207695_10050912 | Ga0207695_100509127 | 304 |
| 55 | 3300025913 | Ga0207695_10087514 | Ga0207695_100875141 | 304 |
| 56 | 3300025914 | Ga0207671_10011496 | Ga0207671_100114963 | 304 |
| 57 | 3300025914 | Ga0207671_10016235 | Ga0207671_100162352 | 304 |
| 58 | 3300025924 | Ga0207694_10093751 | Ga0207694_100937513 | 304 |
| 59 | 3300025924 | Ga0207694_10135391 | Ga0207694_101353911 | 304 |
| 60 | 3300025949 | Ga0207667_10148492 | Ga0207667_101484922 | 304 |
| 61 | 3300026041 | Ga0207639_10076414 | Ga0207639_100764141 | 304 |
| 62 | 3300044693 | Ga0466961_0016976 | Ga0466961_0016976_3698_4621 | 304 |
| 63 | 3300044765 | Ga0466970_0025652 | Ga0466970_0025652_2091_3014 | 304 |
| 64 | 3300045049 | Ga0466959_0004171 | Ga0466959_0004171_3013_3936 | 304 |
| 65 | 3300053178 | Ga0500637_0105403 | Ga0500637_0105403_223_1239 | 304 |
| 66 | 3300061719 | Ga0466962_0003550 | Ga0466962_0003550_4106_5029 | 304 |
| 67 | 3300010375 | Ga0105239_10004921 | Ga0105239_1000492114 | 305 |
| 68 | 3300005719 | Ga0068861_100329380 | Ga0068861_1003293801 | 306 |
| 69 | 3300005329 | Ga0070683_100015119 | Ga0070683_1000151193 | 307 |
| 70 | 3300005535 | Ga0070684_100040820 | Ga0070684_1000408202 | 307 |
| 71 | 3300005563 | Ga0068855_100336460 | Ga0068855_1003364601 | 307 |
| 72 | 3300005614 | Ga0068856_100033678 | Ga0068856_1000336783 | 307 |
| 73 | 3300009093 | Ga0105240_10000263 | Ga0105240_1000026315 | 307 |
| 74 | 3300009093 | Ga0105240_10110312 | Ga0105240_101103123 | 307 |
| 75 | 3300009174 | Ga0105241_10000384 | Ga0105241_1000038415 | 307 |
| 76 | 3300009545 | Ga0105237_10015253 | Ga0105237_100152537 | 307 |
| 77 | 3300009551 | Ga0105238_10000536 | Ga0105238_1000053616 | 307 |
| 78 | 3300010375 | Ga0105239_10004319 | Ga0105239_1000431912 | 307 |
| 79 | 3300013104 | Ga0157370_10046983 | Ga0157370_100469831 | 307 |
| 80 | 3300013105 | Ga0157369_10056659 | Ga0157369_100566592 | 307 |
| 81 | 3300025911 | Ga0207654_10000887 | Ga0207654_100008873 | 307 |
| 82 | 3300025913 | Ga0207695_10000128 | Ga0207695_1000012884 | 307 |
| 83 | 3300025913 | Ga0207695_10004554 | Ga0207695_1000455414 | 307 |
| 84 | 3300025924 | Ga0207694_10000720 | Ga0207694_1000072016 | 307 |
| 85 | 3300025944 | Ga0207661_10003970 | Ga0207661_100039703 | 307 |
| 86 | 3300025949 | Ga0207667_10000143 | Ga0207667_1000014385 | 307 |
| 87 | 3300044658 | Ga0466972_0006774 | Ga0466972_0006774_2623_3570 | 307 |
| 88 | 3300044735 | Ga0466968_0006501 | Ga0466968_0006501_2773_3720 | 307 |
| 89 | iso_pu_bacteria | 2738541278 | 2738727580 | 307 |
| 90 | 3300026041 | Ga0207639_10120395 | Ga0207639_101203952 | 308 |
| 91 | 3300005338 | Ga0068868_100195317 | Ga0068868_1001953172 | 309 |
| 92 | 3300005548 | Ga0070665_100000009 | Ga0070665_100000009340 | 309 |
| 93 | 3300005563 | Ga0068855_100096088 | Ga0068855_1000960882 | 309 |
| 94 | 3300005577 | Ga0068857_100023094 | Ga0068857_1000230943 | 309 |
| 95 | 3300005616 | Ga0068852_100002840 | Ga0068852_1000028409 | 309 |
| 96 | 3300005843 | Ga0068860_100000078 | Ga0068860_10000007818 | 309 |
| 97 | 3300005843 | Ga0068860_100074564 | Ga0068860_1000745643 | 309 |
| 98 | 3300009093 | Ga0105240_10014873 | Ga0105240_100148732 | 309 |
| 99 | 3300009093 | Ga0105240_10024146 | Ga0105240_100241469 | 309 |
| 100 | 3300009545 | Ga0105237_10001123 | Ga0105237_1000112321 | 309 |
| 101 | 3300009545 | Ga0105237_10005503 | Ga0105237_100055034 | 309 |
| 102 | 3300009551 | Ga0105238_10025613 | Ga0105238_100256135 | 309 |
| 103 | 3300009551 | Ga0105238_10324170 | Ga0105238_103241701 | 309 |
| 104 | 3300009553 | Ga0105249_10544137 | Ga0105249_105441371 | 309 |
| 105 | 3300010375 | Ga0105239_10003509 | Ga0105239_1000350913 | 309 |
| 106 | 3300010375 | Ga0105239_10276668 | Ga0105239_102766681 | 309 |
| 107 | 3300013104 | Ga0157370_10001887 | Ga0157370_100018874 | 309 |
| 108 | 3300013105 | Ga0157369_10004105 | Ga0157369_1000410510 | 309 |
| 109 | 3300013296 | Ga0157374_10111422 | Ga0157374_101114224 | 309 |
| 110 | 3300013297 | Ga0157378_10008492 | Ga0157378_100084927 | 309 |
| 111 | 3300013306 | Ga0163162_10000624 | Ga0163162_1000062412 | 309 |
| 112 | 3300013308 | Ga0157375_10267947 | Ga0157375_102679472 | 309 |
| 113 | 3300013308 | Ga0157375_10767337 | Ga0157375_107673371 | 309 |
| 114 | 3300025904 | Ga0207647_10014949 | Ga0207647_100149493 | 309 |
| 115 | 3300025913 | Ga0207695_10022769 | Ga0207695_100227697 | 309 |
| 116 | 3300025913 | Ga0207695_10144107 | Ga0207695_101441071 | 309 |
| 117 | 3300025914 | Ga0207671_10004253 | Ga0207671_100042534 | 309 |
| 118 | 3300025914 | Ga0207671_10004676 | Ga0207671_1000467611 | 309 |
| 119 | 3300025924 | Ga0207694_10036463 | Ga0207694_100364632 | 309 |
| 120 | 3300025931 | Ga0207644_10096743 | Ga0207644_100967432 | 309 |
| 121 | 3300025949 | Ga0207667_10000583 | Ga0207667_100005833 | 309 |
| 122 | 3300025949 | Ga0207667_10152886 | Ga0207667_101528862 | 309 |
| 123 | 3300025981 | Ga0207640_10060484 | Ga0207640_100604843 | 309 |
| 124 | 3300025986 | Ga0207658_10198394 | Ga0207658_101983941 | 309 |
| 125 | 3300026023 | Ga0207677_10246742 | Ga0207677_102467421 | 309 |
| 126 | 3300026116 | Ga0207674_10013442 | Ga0207674_100134427 | 309 |
| 127 | 3300026142 | Ga0207698_10003520 | Ga0207698_100035202 | 309 |
| 128 | 3300028379 | Ga0268266_10000014 | Ga0268266_10000014332 | 309 |
| 129 | 3300028381 | Ga0268264_10000105 | Ga0268264_10000105164 | 309 |
| 130 | 3300028381 | Ga0268264_10003887 | Ga0268264_1000388712 | 309 |
| 131 | 3300028786 | Ga0307517_10021498 | Ga0307517_100214986 | 309 |
| 132 | 3300047443 | Ga0495687_000056 | Ga0495687_000056_156911_157861 | 309 |
| 133 | 3300005530 | Ga0070679_100195266 | Ga0070679_1001952663 | 310 |
| 134 | 3300039437 | Ga0436365_1553484 | Ga0436365_1553484_8374_9330 | 310 |
| 135 | 3300045976 | Ga0466967_0080611 | Ga0466967_0080611_1234_2214 | 311 |
| 136 | 3300049822 | Ga0501035_0046225 | Ga0501035_0046225_874_1809 | 311 |
| 137 | 3300003316 | rootH1_10021140 | rootH1_100211406 | 312 |
| 138 | 3300003320 | rootH2_10087488 | rootH2_100874885 | 312 |
| 139 | 3300003322 | rootL2_10027987 | rootL2_100279872 | 312 |
| 140 | 3300005329 | Ga0070683_100052913 | Ga0070683_1000529134 | 312 |
| 141 | 3300005335 | Ga0070666_10129493 | Ga0070666_101294931 | 312 |
| 142 | 3300005337 | Ga0070682_100013837 | Ga0070682_1000138372 | 312 |
| 143 | 3300005339 | Ga0070660_100005499 | Ga0070660_1000054995 | 312 |
| 144 | 3300005356 | Ga0070674_100010085 | Ga0070674_1000100854 | 312 |
| 145 | 3300005366 | Ga0070659_100005352 | Ga0070659_1000053524 | 312 |
| 146 | 3300005367 | Ga0070667_100237352 | Ga0070667_1002373522 | 312 |
| 147 | 3300005457 | Ga0070662_100006981 | Ga0070662_1000069818 | 312 |
| 148 | 3300005459 | Ga0068867_100223843 | Ga0068867_1002238432 | 312 |
| 149 | 3300005535 | Ga0070684_100009329 | Ga0070684_1000093295 | 312 |
| 150 | 3300005539 | Ga0068853_100428790 | Ga0068853_1004287901 | 312 |
| 151 | 3300005564 | Ga0070664_100000950 | Ga0070664_10000095012 | 312 |
| 152 | 3300005577 | Ga0068857_100132738 | Ga0068857_1001327383 | 312 |
| 153 | 3300005578 | Ga0068854_100109954 | Ga0068854_1001099542 | 312 |
| 154 | 3300005615 | Ga0070702_100009894 | Ga0070702_1000098945 | 312 |
| 155 | 3300005616 | Ga0068852_100264797 | Ga0068852_1002647971 | 312 |
| 156 | 3300005718 | Ga0068866_10129529 | Ga0068866_101295291 | 312 |
| 157 | 3300005985 | Ga0081539_10001226 | Ga0081539_1000122621 | 312 |
| 158 | 3300006358 | Ga0068871_100010171 | Ga0068871_1000101715 | 312 |
| 159 | 3300006358 | Ga0068871_100056845 | Ga0068871_1000568454 | 312 |
| 160 | 3300009094 | Ga0111539_10040039 | Ga0111539_100400394 | 312 |
| 161 | 3300010375 | Ga0105239_10194993 | Ga0105239_101949933 | 312 |
| 162 | 3300013102 | Ga0157371_10024064 | Ga0157371_100240645 | 312 |
| 163 | 3300013105 | Ga0157369_10162241 | Ga0157369_101622412 | 312 |
| 164 | 3300013296 | Ga0157374_10032223 | Ga0157374_100322235 | 312 |
| 165 | 3300013297 | Ga0157378_10008134 | Ga0157378_100081345 | 312 |
| 166 | 3300013308 | Ga0157375_10201882 | Ga0157375_102018822 | 312 |
| 167 | 3300013308 | Ga0157375_10780375 | Ga0157375_107803751 | 312 |
| 168 | 3300014745 | Ga0157377_10061600 | Ga0157377_100616002 | 312 |
| 169 | 3300025912 | Ga0207707_10034150 | Ga0207707_100341503 | 312 |
| 170 | 3300025917 | Ga0207660_10056274 | Ga0207660_100562741 | 312 |
| 171 | 3300025919 | Ga0207657_10004992 | Ga0207657_100049925 | 312 |
| 172 | 3300025933 | Ga0207706_10005696 | Ga0207706_100056964 | 312 |
| 173 | 3300025937 | Ga0207669_10203791 | Ga0207669_102037912 | 312 |
| 174 | 3300026023 | Ga0207677_10065738 | Ga0207677_100657383 | 312 |
| 175 | 3300026041 | Ga0207639_10023498 | Ga0207639_100234983 | 312 |
| 176 | 3300026041 | Ga0207639_10276652 | Ga0207639_102766522 | 312 |
| 177 | 3300026089 | Ga0207648_10073577 | Ga0207648_100735771 | 312 |
| 178 | 3300026095 | Ga0207676_10375458 | Ga0207676_103754581 | 312 |
| 179 | 3300026116 | Ga0207674_10322349 | Ga0207674_103223492 | 312 |
| 180 | 3300028381 | Ga0268264_10068813 | Ga0268264_100688131 | 312 |
| 181 | 3300031507 | Ga0307509_10034760 | Ga0307509_100347604 | 312 |
| 182 | 3300035092 | Ga0373952_0029121 | Ga0373952_0029121_177_1124 | 312 |
| 183 | 3300044656 | Ga0466969_0000244 | Ga0466969_0000244_13340_14281 | 312 |
| 184 | 3300044658 | Ga0466972_0010045 | Ga0466972_0010045_2700_3638 | 312 |
| 185 | 3300044684 | Ga0466966_0034900 | Ga0466966_0034900_1800_2741 | 312 |
| 186 | 3300045049 | Ga0466959_0000039 | Ga0466959_0000039_66348_67289 | 312 |
| 187 | 3300046477 | Ga0495664_0142350 | Ga0495664_0142350_266_1213 | 312 |
| 188 | 3300046511 | Ga0495608_0083467 | Ga0495608_0083467_975_1931 | 312 |
| 189 | 3300046514 | Ga0495618_0046549 | Ga0495618_0046549_1505_2461 | 312 |
| 190 | 3300046536 | Ga0495587_0024806 | Ga0495587_0024806_1873_2829 | 312 |
| 191 | 3300046616 | Ga0495668_0004004 | Ga0495668_0004004_3930_4868 | 312 |
| 192 | 3300046678 | Ga0495599_0151167 | Ga0495599_0151167_141_1097 | 312 |
| 193 | 3300047471 | Ga0495684_0024797 | Ga0495684_0024797_1664_2620 | 312 |
| 194 | 3300049571 | Ga0501034_0013554 | Ga0501034_0013554_5455_6420 | 312 |
| 195 | 3300049686 | Ga0501257_013045 | Ga0501257_013045_855_1793 | 312 |
| 196 | 3300050511 | nmdc:mga08y16_164005_c1 | nmdc:mga08y16_164005_c1_296_1267 | 312 |
| 197 | 3300053086 | Ga0500578_0086701 | Ga0500578_0086701_523_1461 | 312 |
| 198 | 3300053730 | Ga0500645_055722 | Ga0500645_055722_175_1116 | 312 |
| 199 | 3300061719 | Ga0466962_0091252 | Ga0466962_0091252_357_1298 | 312 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ntb-assembly1.cif.gz_A | mus musculus ltc4 synthase in gsh complex form | 0.3537 | 36 | 179 |
| 5hv9-assembly1.cif.gz_A | human ltc4s mutant-s36e | 0.341 | 42 | 179 |
| 4ntb-assembly1.cif.gz_A | mus musculus ltc4 synthase in gsh complex form | 0.3286 | 36 | 179 |
| 5hv9-assembly1.cif.gz_A | human ltc4s mutant-s36e | 0.3142 | 42 | 179 |
| 1bg5-assembly1.cif.gz_A-2 | crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase | 0.2479 | 21 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9M8M1_345_541_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3073 | 17 | 181 | 1.20.1250.20 |
| af_A0A0R0KVV6_29_221_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2862 | 13 | 180 | 1.20.1250.20 |
| af_Q8BGC3_251_439_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2715 | 10 | 180 | 1.20.1250.20 |
| af_A2ZU80_263_462_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2705 | 17 | 178 | 1.20.1250.20 |
| af_O17328_389_593_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2697 | 15 | 180 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6Y7A1-F1-model_v4 | Sterol desaturase family protein | 0.8701 | 50 | 279 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A2V8S024-F1-model_v4 | Fatty acid hydroxylase domain-containing protein | 0.8674 | 39 | 276 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A849FVE0-F1-model_v4 | Sterol desaturase family protein | 0.865 | 32 | 240 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A5C9C8E3-F1-model_v4 | Fatty acid hydroxylase | 0.8636 | 49 | 297 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A519SFC0-F1-model_v4 | Sterol desaturase family protein | 0.8632 | 14 | 272 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar