F305584

General Info

Members Datasets Scaffolds Average Seq Length
199 118 198 318

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100329380|Ga0068861_1003293801
Length 317
Sequence MHAVYEQLLILLSTPFYVAIIALEVLLSNYQHRKLYSWRDTATNVYLMLLNSAIDLLFRSFYIAILAYCYQHRYLEWHNVIMYWALLLLAEDFLYYWLHRFDHEIRLFWAVHVTHNFTVGFRSSVFQPLYRFIYFIPLAILGFKPLDIVFMYSLTQIWGIFVHTEVVRKMGILEYFMVTPSHHRVHHASNPKYLDRNLGMFLIIWDKMFGTFQPELPDKEYQTLKYGLTKPLEKDNATNIVFHEWKQILKDLKRSDIGLREKLFYLFGPPGWSHDASRQTSEQLREQELFEQDEKKEDPSLSIPKENLAPVVTSINQ

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
116 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
117 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 0
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10021140 3300003316 Bacteria 8344
2 rootH2_10074876 3300003320 Bacteria 1923
3 rootH2_10087488 3300003320 Bacteria 3499
4 rootL2_10027987 3300003322 Bacteria 2837
5 rootH1_10329320 3300003323 Unclassified 1221
6 Ga0070683_100015119 3300005329 Bacteria 6774
7 Ga0070683_100052913 3300005329 Bacteria 3762
8 Ga0070670_100186793 3300005331 Bacteria 1800
9 Ga0068869_100159270 3300005334 Bacteria 1756
10 Ga0070666_10026921 3300005335 Bacteria 3762
11 Ga0070666_10129493 3300005335 Bacteria 1753
12 Ga0070682_100013837 3300005337 Bacteria 4652
13 Ga0068868_100195317 3300005338 Unclassified 1684
14 Ga0070660_100005499 3300005339 Bacteria 8776
15 Ga0070671_100144480 3300005355 Bacteria 2008
16 Ga0070674_100010085 3300005356 Bacteria 5691
17 Ga0070659_100005352 3300005366 Bacteria 9211
18 Ga0070667_100237352 3300005367 Bacteria 1627
19 Ga0070662_100006981 3300005457 Bacteria 7307
20 Ga0068867_100217651 3300005459 Unclassified 1537
21 Ga0068867_100223843 3300005459 Bacteria 1517
22 Ga0070679_100195266 3300005530 Unclassified 1992
23 Ga0070684_100009329 3300005535 Bacteria 7723
24 Ga0070684_100040820 3300005535 Bacteria 3997
25 Ga0068853_100063025 3300005539 Bacteria 3210
26 Ga0068853_100428790 3300005539 Bacteria 1241
27 Ga0070665_100000009 3300005548 Bacteria 562640
28 Ga0068855_100096088 3300005563 Bacteria 3415
29 Ga0068855_100182049 3300005563 Unclassified 2375
30 Ga0068855_100336460 3300005563 Bacteria 1665
31 Ga0070664_100000950 3300005564 Bacteria 22641
32 Ga0068857_100023094 3300005577 Bacteria 5470
33 Ga0068857_100072415 3300005577 Bacteria 3071
34 Ga0068857_100132738 3300005577 Bacteria 2247
35 Ga0068854_100109954 3300005578 Bacteria 2077
36 Ga0068856_100033678 3300005614 Bacteria 5017
37 Ga0068856_100083452 3300005614 Bacteria 3173
38 Ga0068856_100134980 3300005614 Bacteria 2473
39 Ga0070702_100009894 3300005615 Unclassified 4682
40 Ga0068852_100002840 3300005616 Bacteria 12011
41 Ga0068852_100117923 3300005616 Bacteria 2425
42 Ga0068852_100264797 3300005616 Bacteria 1652
43 Ga0068866_10129529 3300005718 Bacteria 1433
44 Ga0068861_100329380 3300005719 Bacteria 1332
45 Ga0068861_100405165 3300005719 Bacteria 1211
46 Ga0068860_100000078 3300005843 Bacteria 171062
47 Ga0068860_100074564 3300005843 Unclassified 3227
48 Ga0081540_1003562 3300005983 Bacteria 12251
49 Ga0081539_10001226 3300005985 Bacteria 45853
50 Ga0075366_10017154 3300006195 Bacteria 4165
51 Ga0097621_100465896 3300006237 Bacteria 1140
52 Ga0068871_100010171 3300006358 Bacteria 6852
53 Ga0068871_100056845 3300006358 Bacteria 3182
54 Ga0105240_10000263 3300009093 Bacteria 103973
55 Ga0105240_10014873 3300009093 Bacteria 10605
56 Ga0105240_10024146 3300009093 Bacteria 8023
57 Ga0105240_10024327 3300009093 Bacteria 7987
58 Ga0105240_10110312 3300009093 Bacteria 3330
59 Ga0105240_10347005 3300009093 Bacteria 1685
60 Ga0111539_10040039 3300009094 Bacteria 5644
61 Ga0114129_10006797 3300009147 Bacteria 16240
62 Ga0105241_10000384 3300009174 Bacteria 33496
63 Ga0105241_10048607 3300009174 Bacteria 3229
64 Ga0105237_10001123 3300009545 Bacteria 35881
65 Ga0105237_10005503 3300009545 Bacteria 14274
66 Ga0105237_10008043 3300009545 Bacteria 11467
67 Ga0105237_10009512 3300009545 Bacteria 10407
68 Ga0105237_10015253 3300009545 Bacteria 8004
69 Ga0105237_10023708 3300009545 Bacteria 6282
70 Ga0105238_10000536 3300009551 Bacteria 39756
71 Ga0105238_10025613 3300009551 Bacteria 6013
72 Ga0105238_10324170 3300009551 Bacteria 1527
73 Ga0105249_10544137 3300009553 Bacteria 1211
74 Ga0105239_10000760 3300010375 Bacteria 45542
75 Ga0105239_10002155 3300010375 Bacteria 25331
76 Ga0105239_10003509 3300010375 Bacteria 19199
77 Ga0105239_10004319 3300010375 Bacteria 17042
78 Ga0105239_10004921 3300010375 Bacteria 15791
79 Ga0105239_10077689 3300010375 Bacteria 3653
80 Ga0105239_10194993 3300010375 Bacteria 2268
81 Ga0105239_10276668 3300010375 Bacteria 1889
82 Ga0157371_10024064 3300013102 Bacteria 4449
83 Ga0157370_10001887 3300013104 Bacteria 25802
84 Ga0157370_10046983 3300013104 Bacteria 4139
85 Ga0157370_10052709 3300013104 Bacteria 3883
86 Ga0157369_10004105 3300013105 Bacteria 17247
87 Ga0157369_10056659 3300013105 Bacteria 4229
88 Ga0157369_10162241 3300013105 Bacteria 2359
89 Ga0157374_10000002 3300013296 Bacteria 1054226
90 Ga0157374_10032223 3300013296 Bacteria 4770
91 Ga0157374_10111422 3300013296 Bacteria 2633
92 Ga0157378_10008134 3300013297 Bacteria 9153
93 Ga0157378_10008492 3300013297 Bacteria 8946
94 Ga0163162_10000624 3300013306 Bacteria 32874
95 Ga0163162_10196419 3300013306 Bacteria 2146
96 Ga0157372_10002492 3300013307 Bacteria 19958
97 Ga0157375_10201882 3300013308 Bacteria 2144
98 Ga0157375_10267947 3300013308 Bacteria 1870
99 Ga0157375_10767337 3300013308 Bacteria 1115
100 Ga0157375_10780375 3300013308 Bacteria 1105
101 Ga0157377_10061600 3300014745 Bacteria 2145
102 Ga0157376_10001744 3300014969 Bacteria 14472
103 Ga0157376_10053660 3300014969 Bacteria 3357
104 Ga0207688_10043815 3300025901 Bacteria 2493
105 Ga0207680_10007396 3300025903 Bacteria 5348
106 Ga0207647_10014949 3300025904 Bacteria 5334
107 Ga0207647_10021474 3300025904 Unclassified 4309
108 Ga0207654_10000887 3300025911 Bacteria 16589
109 Ga0207707_10034150 3300025912 Bacteria 4450
110 Ga0207695_10000016 3300025913 Bacteria 771991
111 Ga0207695_10000128 3300025913 Bacteria 226098
112 Ga0207695_10000296 3300025913 Bacteria 123322
113 Ga0207695_10004554 3300025913 Bacteria 18847
114 Ga0207695_10022769 3300025913 Bacteria 7099
115 Ga0207695_10050912 3300025913 Unclassified 4353
116 Ga0207695_10087514 3300025913 Bacteria 3138
117 Ga0207695_10144107 3300025913 Unclassified 2328
118 Ga0207671_10004253 3300025914 Bacteria 13784
119 Ga0207671_10004676 3300025914 Bacteria 12952
120 Ga0207671_10011496 3300025914 Bacteria 7195
121 Ga0207671_10016235 3300025914 Bacteria 5795
122 Ga0207671_10058381 3300025914 Bacteria 2860
123 Ga0207660_10056274 3300025917 Bacteria 2814
124 Ga0207657_10004992 3300025919 Bacteria 13947
125 Ga0207694_10000720 3300025924 Bacteria 29711
126 Ga0207694_10036463 3300025924 Bacteria 3775
127 Ga0207694_10093751 3300025924 Bacteria 2372
128 Ga0207694_10135391 3300025924 Bacteria 1978
129 Ga0207644_10096743 3300025931 Bacteria 2211
130 Ga0207706_10005696 3300025933 Bacteria 11606
131 Ga0207669_10203791 3300025937 Bacteria 1438
132 Ga0207661_10003970 3300025944 Bacteria 10335
133 Ga0207679_10046524 3300025945 Bacteria 3146
134 Ga0207667_10000143 3300025949 Bacteria 108717
135 Ga0207667_10000583 3300025949 Bacteria 47418
136 Ga0207667_10148492 3300025949 Unclassified 2413
137 Ga0207667_10152886 3300025949 Bacteria 2375
138 Ga0207640_10060484 3300025981 Bacteria 2504
139 Ga0207658_10198394 3300025986 Bacteria 1674
140 Ga0207677_10065738 3300026023 Bacteria 2532
141 Ga0207677_10246742 3300026023 Unclassified 1448
142 Ga0207639_10023498 3300026041 Bacteria 4453
143 Ga0207639_10048440 3300026041 Bacteria 3217
144 Ga0207639_10076414 3300026041 Bacteria 2637
145 Ga0207639_10120395 3300026041 Unclassified 2156
146 Ga0207639_10276652 3300026041 Bacteria 1475
147 Ga0207702_10087567 3300026078 Bacteria 2719
148 Ga0207702_10149620 3300026078 Bacteria 2122
149 Ga0207641_10258901 3300026088 Bacteria 1628
150 Ga0207648_10073577 3300026089 Unclassified 2978
151 Ga0207676_10375458 3300026095 Bacteria 1322
152 Ga0207674_10013442 3300026116 Bacteria 9086
153 Ga0207674_10120220 3300026116 Bacteria 2595
154 Ga0207674_10322349 3300026116 Bacteria 1494
155 Ga0207698_10003520 3300026142 Bacteria 9440
156 Ga0268266_10000014 3300028379 Bacteria 644033
157 Ga0268264_10000105 3300028381 Bacteria 212531
158 Ga0268264_10003887 3300028381 Bacteria 12806
159 Ga0268264_10068813 3300028381 Bacteria 2993
160 Ga0307517_10021498 3300028786 Bacteria 8145
161 Ga0307509_10034760 3300031507 Bacteria 5537
162 Ga0307509_10121639 3300031507 Bacteria 2586
163 Ga0373952_0029121 3300035092 Bacteria 1215
164 Ga0436365_1553484 3300039437 Bacteria 10706
165 Ga0439449_0074719 3300042007 Bacteria 1249
166 Ga0466969_0000244 3300044656 Bacteria 29819
167 Ga0466972_0006774 3300044658 Bacteria 5750
168 Ga0466972_0010045 3300044658 Bacteria 4754
169 Ga0466966_0034900 3300044684 Unclassified 3251
170 Ga0466961_0016976 3300044693 Bacteria 4675
171 Ga0466964_0032751 3300044706 Bacteria 2067
172 Ga0453684_0023453 3300044712 Bacteria 9086
173 Ga0466968_0006501 3300044735 Bacteria 4408
174 Ga0466970_0025652 3300044765 Bacteria 3087
175 Ga0466957_0000218 3300044842 Bacteria 27018
176 Ga0466959_0000039 3300045049 Bacteria 101186
177 Ga0466959_0004171 3300045049 Bacteria 9628
178 Ga0466967_0080611 3300045976 Bacteria 2938
179 Ga0495664_0142350 3300046477 Unclassified 1454
180 Ga0495608_0083467 3300046511 Bacteria 2074
181 Ga0495618_0046549 3300046514 Unclassified 2738
182 Ga0495587_0024806 3300046536 Bacteria 3671
183 Ga0495668_0004004 3300046616 Bacteria 10726
184 Ga0495611_0000983 3300046648 Bacteria 15159
185 Ga0495599_0151167 3300046678 Bacteria 1438
186 Ga0495687_000056 3300047443 Bacteria 188227
187 Ga0495684_0024797 3300047471 Bacteria 4612
188 Ga0501034_0013554 3300049571 Bacteria 8390
189 Ga0501047_0039106 3300049581 Bacteria 4589
190 Ga0501257_013045 3300049686 Bacteria 1904
191 Ga0501035_0046225 3300049822 Bacteria 3916
192 nmdc:mga05p37_970_c1 3300050507 Bacteria 16850
193 nmdc:mga08y16_164005_c1 3300050511 Bacteria 2308
194 Ga0500578_0086701 3300053086 Bacteria 1989
195 Ga0500637_0105403 3300053178 Unclassified 1635
196 Ga0500645_055722 3300053730 Bacteria 1148
197 Ga0466962_0003550 3300061719 Bacteria 7429
198 Ga0466962_0091252 3300061719 Bacteria 1460

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100217651 Ga0068867_1002176512 290
2 3300005614 Ga0068856_100083452 Ga0068856_1000834523 290
3 3300026078 Ga0207702_10087567 Ga0207702_100875672 290
4 3300003323 rootH1_10329320 rootH1_103293201 294
5 3300005719 Ga0068861_100405165 Ga0068861_1004051651 294
6 3300006195 Ga0075366_10017154 Ga0075366_100171544 294
7 3300044842 Ga0466957_0000218 Ga0466957_0000218_8517_9458 294
8 3300042007 Ga0439449_0074719 Ga0439449_0074719_220_1107 295
9 3300003320 rootH2_10074876 rootH2_100748762 296
10 3300005577 Ga0068857_100072415 Ga0068857_1000724152 296
11 3300005614 Ga0068856_100134980 Ga0068856_1001349802 296
12 3300009174 Ga0105241_10048607 Ga0105241_100486072 296
13 3300009545 Ga0105237_10023708 Ga0105237_100237085 296
14 3300025914 Ga0207671_10058381 Ga0207671_100583813 296
15 3300026078 Ga0207702_10149620 Ga0207702_101496202 296
16 3300026116 Ga0207674_10120220 Ga0207674_101202202 296
17 3300013104 Ga0157370_10052709 Ga0157370_100527092 297
18 3300044712 Ga0453684_0023453 Ga0453684_0023453_368_1264 297
19 3300010375 Ga0105239_10002155 Ga0105239_100021558 298
20 3300025901 Ga0207688_10043815 Ga0207688_100438151 298
21 3300025945 Ga0207679_10046524 Ga0207679_100465242 298
22 3300026088 Ga0207641_10258901 Ga0207641_102589012 299
23 3300031507 Ga0307509_10121639 Ga0307509_101216393 299
24 3300046648 Ga0495611_0000983 Ga0495611_0000983_11186_12166 299
25 3300005335 Ga0070666_10026921 Ga0070666_100269213 300
26 3300025903 Ga0207680_10007396 Ga0207680_100073964 300
27 3300014969 Ga0157376_10053660 Ga0157376_100536601 301
28 3300044706 Ga0466964_0032751 Ga0466964_0032751_893_1834 301
29 3300005334 Ga0068869_100159270 Ga0068869_1001592701 302
30 3300005355 Ga0070671_100144480 Ga0070671_1001444801 302
31 3300005539 Ga0068853_100063025 Ga0068853_1000630252 302
32 3300006237 Ga0097621_100465896 Ga0097621_1004658961 302
33 3300026041 Ga0207639_10048440 Ga0207639_100484403 302
34 3300049581 Ga0501047_0039106 Ga0501047_0039106_2287_3222 302
35 3300009147 Ga0114129_10006797 Ga0114129_1000679713 303
36 3300050507 nmdc:mga05p37_970_c1 nmdc:mga05p37_970_c1_5149_6084 303
37 3300005331 Ga0070670_100186793 Ga0070670_1001867931 304
38 3300005563 Ga0068855_100182049 Ga0068855_1001820491 304
39 3300005616 Ga0068852_100117923 Ga0068852_1001179231 304
40 3300005983 Ga0081540_1003562 Ga0081540_10035621 304
41 3300009093 Ga0105240_10024327 Ga0105240_100243271 304
42 3300009093 Ga0105240_10347005 Ga0105240_103470052 304
43 3300009545 Ga0105237_10008043 Ga0105237_100080438 304
44 3300009545 Ga0105237_10009512 Ga0105237_100095125 304
45 3300010375 Ga0105239_10000760 Ga0105239_1000076012 304
46 3300010375 Ga0105239_10077689 Ga0105239_100776892 304
47 3300013296 Ga0157374_10000002 Ga0157374_10000002243 304
48 3300013306 Ga0163162_10196419 Ga0163162_101964192 304
49 3300013307 Ga0157372_10002492 Ga0157372_100024922 304
50 3300014969 Ga0157376_10001744 Ga0157376_100017444 304
51 3300025904 Ga0207647_10021474 Ga0207647_100214746 304
52 3300025913 Ga0207695_10000016 Ga0207695_1000001678 304
53 3300025913 Ga0207695_10000296 Ga0207695_1000029671 304
54 3300025913 Ga0207695_10050912 Ga0207695_100509127 304
55 3300025913 Ga0207695_10087514 Ga0207695_100875141 304
56 3300025914 Ga0207671_10011496 Ga0207671_100114963 304
57 3300025914 Ga0207671_10016235 Ga0207671_100162352 304
58 3300025924 Ga0207694_10093751 Ga0207694_100937513 304
59 3300025924 Ga0207694_10135391 Ga0207694_101353911 304
60 3300025949 Ga0207667_10148492 Ga0207667_101484922 304
61 3300026041 Ga0207639_10076414 Ga0207639_100764141 304
62 3300044693 Ga0466961_0016976 Ga0466961_0016976_3698_4621 304
63 3300044765 Ga0466970_0025652 Ga0466970_0025652_2091_3014 304
64 3300045049 Ga0466959_0004171 Ga0466959_0004171_3013_3936 304
65 3300053178 Ga0500637_0105403 Ga0500637_0105403_223_1239 304
66 3300061719 Ga0466962_0003550 Ga0466962_0003550_4106_5029 304
67 3300010375 Ga0105239_10004921 Ga0105239_1000492114 305
68 3300005719 Ga0068861_100329380 Ga0068861_1003293801 306
69 3300005329 Ga0070683_100015119 Ga0070683_1000151193 307
70 3300005535 Ga0070684_100040820 Ga0070684_1000408202 307
71 3300005563 Ga0068855_100336460 Ga0068855_1003364601 307
72 3300005614 Ga0068856_100033678 Ga0068856_1000336783 307
73 3300009093 Ga0105240_10000263 Ga0105240_1000026315 307
74 3300009093 Ga0105240_10110312 Ga0105240_101103123 307
75 3300009174 Ga0105241_10000384 Ga0105241_1000038415 307
76 3300009545 Ga0105237_10015253 Ga0105237_100152537 307
77 3300009551 Ga0105238_10000536 Ga0105238_1000053616 307
78 3300010375 Ga0105239_10004319 Ga0105239_1000431912 307
79 3300013104 Ga0157370_10046983 Ga0157370_100469831 307
80 3300013105 Ga0157369_10056659 Ga0157369_100566592 307
81 3300025911 Ga0207654_10000887 Ga0207654_100008873 307
82 3300025913 Ga0207695_10000128 Ga0207695_1000012884 307
83 3300025913 Ga0207695_10004554 Ga0207695_1000455414 307
84 3300025924 Ga0207694_10000720 Ga0207694_1000072016 307
85 3300025944 Ga0207661_10003970 Ga0207661_100039703 307
86 3300025949 Ga0207667_10000143 Ga0207667_1000014385 307
87 3300044658 Ga0466972_0006774 Ga0466972_0006774_2623_3570 307
88 3300044735 Ga0466968_0006501 Ga0466968_0006501_2773_3720 307
89 iso_pu_bacteria 2738541278 2738727580 307
90 3300026041 Ga0207639_10120395 Ga0207639_101203952 308
91 3300005338 Ga0068868_100195317 Ga0068868_1001953172 309
92 3300005548 Ga0070665_100000009 Ga0070665_100000009340 309
93 3300005563 Ga0068855_100096088 Ga0068855_1000960882 309
94 3300005577 Ga0068857_100023094 Ga0068857_1000230943 309
95 3300005616 Ga0068852_100002840 Ga0068852_1000028409 309
96 3300005843 Ga0068860_100000078 Ga0068860_10000007818 309
97 3300005843 Ga0068860_100074564 Ga0068860_1000745643 309
98 3300009093 Ga0105240_10014873 Ga0105240_100148732 309
99 3300009093 Ga0105240_10024146 Ga0105240_100241469 309
100 3300009545 Ga0105237_10001123 Ga0105237_1000112321 309
101 3300009545 Ga0105237_10005503 Ga0105237_100055034 309
102 3300009551 Ga0105238_10025613 Ga0105238_100256135 309
103 3300009551 Ga0105238_10324170 Ga0105238_103241701 309
104 3300009553 Ga0105249_10544137 Ga0105249_105441371 309
105 3300010375 Ga0105239_10003509 Ga0105239_1000350913 309
106 3300010375 Ga0105239_10276668 Ga0105239_102766681 309
107 3300013104 Ga0157370_10001887 Ga0157370_100018874 309
108 3300013105 Ga0157369_10004105 Ga0157369_1000410510 309
109 3300013296 Ga0157374_10111422 Ga0157374_101114224 309
110 3300013297 Ga0157378_10008492 Ga0157378_100084927 309
111 3300013306 Ga0163162_10000624 Ga0163162_1000062412 309
112 3300013308 Ga0157375_10267947 Ga0157375_102679472 309
113 3300013308 Ga0157375_10767337 Ga0157375_107673371 309
114 3300025904 Ga0207647_10014949 Ga0207647_100149493 309
115 3300025913 Ga0207695_10022769 Ga0207695_100227697 309
116 3300025913 Ga0207695_10144107 Ga0207695_101441071 309
117 3300025914 Ga0207671_10004253 Ga0207671_100042534 309
118 3300025914 Ga0207671_10004676 Ga0207671_1000467611 309
119 3300025924 Ga0207694_10036463 Ga0207694_100364632 309
120 3300025931 Ga0207644_10096743 Ga0207644_100967432 309
121 3300025949 Ga0207667_10000583 Ga0207667_100005833 309
122 3300025949 Ga0207667_10152886 Ga0207667_101528862 309
123 3300025981 Ga0207640_10060484 Ga0207640_100604843 309
124 3300025986 Ga0207658_10198394 Ga0207658_101983941 309
125 3300026023 Ga0207677_10246742 Ga0207677_102467421 309
126 3300026116 Ga0207674_10013442 Ga0207674_100134427 309
127 3300026142 Ga0207698_10003520 Ga0207698_100035202 309
128 3300028379 Ga0268266_10000014 Ga0268266_10000014332 309
129 3300028381 Ga0268264_10000105 Ga0268264_10000105164 309
130 3300028381 Ga0268264_10003887 Ga0268264_1000388712 309
131 3300028786 Ga0307517_10021498 Ga0307517_100214986 309
132 3300047443 Ga0495687_000056 Ga0495687_000056_156911_157861 309
133 3300005530 Ga0070679_100195266 Ga0070679_1001952663 310
134 3300039437 Ga0436365_1553484 Ga0436365_1553484_8374_9330 310
135 3300045976 Ga0466967_0080611 Ga0466967_0080611_1234_2214 311
136 3300049822 Ga0501035_0046225 Ga0501035_0046225_874_1809 311
137 3300003316 rootH1_10021140 rootH1_100211406 312
138 3300003320 rootH2_10087488 rootH2_100874885 312
139 3300003322 rootL2_10027987 rootL2_100279872 312
140 3300005329 Ga0070683_100052913 Ga0070683_1000529134 312
141 3300005335 Ga0070666_10129493 Ga0070666_101294931 312
142 3300005337 Ga0070682_100013837 Ga0070682_1000138372 312
143 3300005339 Ga0070660_100005499 Ga0070660_1000054995 312
144 3300005356 Ga0070674_100010085 Ga0070674_1000100854 312
145 3300005366 Ga0070659_100005352 Ga0070659_1000053524 312
146 3300005367 Ga0070667_100237352 Ga0070667_1002373522 312
147 3300005457 Ga0070662_100006981 Ga0070662_1000069818 312
148 3300005459 Ga0068867_100223843 Ga0068867_1002238432 312
149 3300005535 Ga0070684_100009329 Ga0070684_1000093295 312
150 3300005539 Ga0068853_100428790 Ga0068853_1004287901 312
151 3300005564 Ga0070664_100000950 Ga0070664_10000095012 312
152 3300005577 Ga0068857_100132738 Ga0068857_1001327383 312
153 3300005578 Ga0068854_100109954 Ga0068854_1001099542 312
154 3300005615 Ga0070702_100009894 Ga0070702_1000098945 312
155 3300005616 Ga0068852_100264797 Ga0068852_1002647971 312
156 3300005718 Ga0068866_10129529 Ga0068866_101295291 312
157 3300005985 Ga0081539_10001226 Ga0081539_1000122621 312
158 3300006358 Ga0068871_100010171 Ga0068871_1000101715 312
159 3300006358 Ga0068871_100056845 Ga0068871_1000568454 312
160 3300009094 Ga0111539_10040039 Ga0111539_100400394 312
161 3300010375 Ga0105239_10194993 Ga0105239_101949933 312
162 3300013102 Ga0157371_10024064 Ga0157371_100240645 312
163 3300013105 Ga0157369_10162241 Ga0157369_101622412 312
164 3300013296 Ga0157374_10032223 Ga0157374_100322235 312
165 3300013297 Ga0157378_10008134 Ga0157378_100081345 312
166 3300013308 Ga0157375_10201882 Ga0157375_102018822 312
167 3300013308 Ga0157375_10780375 Ga0157375_107803751 312
168 3300014745 Ga0157377_10061600 Ga0157377_100616002 312
169 3300025912 Ga0207707_10034150 Ga0207707_100341503 312
170 3300025917 Ga0207660_10056274 Ga0207660_100562741 312
171 3300025919 Ga0207657_10004992 Ga0207657_100049925 312
172 3300025933 Ga0207706_10005696 Ga0207706_100056964 312
173 3300025937 Ga0207669_10203791 Ga0207669_102037912 312
174 3300026023 Ga0207677_10065738 Ga0207677_100657383 312
175 3300026041 Ga0207639_10023498 Ga0207639_100234983 312
176 3300026041 Ga0207639_10276652 Ga0207639_102766522 312
177 3300026089 Ga0207648_10073577 Ga0207648_100735771 312
178 3300026095 Ga0207676_10375458 Ga0207676_103754581 312
179 3300026116 Ga0207674_10322349 Ga0207674_103223492 312
180 3300028381 Ga0268264_10068813 Ga0268264_100688131 312
181 3300031507 Ga0307509_10034760 Ga0307509_100347604 312
182 3300035092 Ga0373952_0029121 Ga0373952_0029121_177_1124 312
183 3300044656 Ga0466969_0000244 Ga0466969_0000244_13340_14281 312
184 3300044658 Ga0466972_0010045 Ga0466972_0010045_2700_3638 312
185 3300044684 Ga0466966_0034900 Ga0466966_0034900_1800_2741 312
186 3300045049 Ga0466959_0000039 Ga0466959_0000039_66348_67289 312
187 3300046477 Ga0495664_0142350 Ga0495664_0142350_266_1213 312
188 3300046511 Ga0495608_0083467 Ga0495608_0083467_975_1931 312
189 3300046514 Ga0495618_0046549 Ga0495618_0046549_1505_2461 312
190 3300046536 Ga0495587_0024806 Ga0495587_0024806_1873_2829 312
191 3300046616 Ga0495668_0004004 Ga0495668_0004004_3930_4868 312
192 3300046678 Ga0495599_0151167 Ga0495599_0151167_141_1097 312
193 3300047471 Ga0495684_0024797 Ga0495684_0024797_1664_2620 312
194 3300049571 Ga0501034_0013554 Ga0501034_0013554_5455_6420 312
195 3300049686 Ga0501257_013045 Ga0501257_013045_855_1793 312
196 3300050511 nmdc:mga08y16_164005_c1 nmdc:mga08y16_164005_c1_296_1267 312
197 3300053086 Ga0500578_0086701 Ga0500578_0086701_523_1461 312
198 3300053730 Ga0500645_055722 Ga0500645_055722_175_1116 312
199 3300061719 Ga0466962_0091252 Ga0466962_0091252_357_1298 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

84

211

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ntb-assembly1.cif.gz_A mus musculus ltc4 synthase in gsh complex form 0.3537 36 179
5hv9-assembly1.cif.gz_A human ltc4s mutant-s36e 0.341 42 179
4ntb-assembly1.cif.gz_A mus musculus ltc4 synthase in gsh complex form 0.3286 36 179
5hv9-assembly1.cif.gz_A human ltc4s mutant-s36e 0.3142 42 179
1bg5-assembly1.cif.gz_A-2 crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase 0.2479 21 171
ID Description Score Start End Superfamily
af_Q9M8M1_345_541_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3073 17 181 1.20.1250.20
af_A0A0R0KVV6_29_221_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2862 13 180 1.20.1250.20
af_Q8BGC3_251_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2715 10 180 1.20.1250.20
af_A2ZU80_263_462_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2705 17 178 1.20.1250.20
af_O17328_389_593_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2697 15 180 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7C6Y7A1-F1-model_v4 Sterol desaturase family protein 0.8701 50 279 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A2V8S024-F1-model_v4 Fatty acid hydroxylase domain-containing protein 0.8674 39 276 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A849FVE0-F1-model_v4 Sterol desaturase family protein 0.865 32 240 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A5C9C8E3-F1-model_v4 Fatty acid hydroxylase 0.8636 49 297 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A519SFC0-F1-model_v4 Sterol desaturase family protein 0.8632 14 272 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479

Feature Viewer

pLDDT pTM Quality
69.13 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map