F305260

General Info

Members Datasets Scaffolds Average Seq Length
199 110 338 296

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10219665|rootL2_102196652
Length 302
Sequence MSLDFTSSPGAPGNHGAAAGRSSDVARLVEALTVELAGEKIDLPSFPDVAVRVRKALTNEDVEIEQVVRIISAEPALAARLLQVANSAALNPNGRRLTDLRTAVSRIGFNMARSATIAFAMSQLRRAEAYRGLEAPLTELWHHSAHVAAVSHVVAKRFTRMNADTALLAGLLQGVGKLYLLTRTVRFPALLSDPSIYQRIVADWHVRIAQAILRNWDMADEIVNAVAAAENPDRDHEGVTDLADVIAVSSTLAALGPDPRAEEMLFLGMPAARRMKLDAAACGAALAESHAEIVSLRQVLGS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
76 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
77 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
80 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
89 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.02
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 25.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10219665 3300003322 Bacteria 1999
2 Ga0070683_100375127 3300005329 Unclassified 1355
3 Ga0070690_100005861 3300005330 Bacteria 6927
4 Ga0070690_100140684 3300005330 Bacteria 1638
5 Ga0070677_10014364 3300005333 Unclassified 2785
6 Ga0070682_100019062 3300005337 Bacteria 4019
7 Ga0070689_100033119 3300005340 Bacteria 3934
8 Ga0070687_100126655 3300005343 Bacteria 1469
9 Ga0070661_100021553 3300005344 Bacteria 4605
10 Ga0070668_100322288 3300005347 Bacteria 1301
11 Ga0070669_100031788 3300005353 Unclassified 3812
12 Ga0070675_100033613 3300005354 Bacteria 4159
13 Ga0070674_100110504 3300005356 Unclassified 2017
14 Ga0070674_100211401 3300005356 Bacteria 1504
15 Ga0070673_100079245 3300005364 Unclassified 2659
16 Ga0070673_100099976 3300005364 Unclassified 2387
17 Ga0070688_100268430 3300005365 Bacteria 1221
18 Ga0070701_10037386 3300005438 Unclassified 2451
19 Ga0070701_10053222 3300005438 Bacteria 2106
20 Ga0070705_100015031 3300005440 Bacteria 3994
21 Ga0070700_100091870 3300005441 Unclassified 1983
22 Ga0070700_100095258 3300005441 Bacteria 1951
23 Ga0070694_100022576 3300005444 Bacteria 4033
24 Ga0070663_100174900 3300005455 Bacteria 1662
25 Ga0070663_100275677 3300005455 Bacteria 1339
26 Ga0070685_10090711 3300005466 Bacteria 1849
27 Ga0070672_100074656 3300005543 Bacteria 2705
28 Ga0070686_100015439 3300005544 Bacteria 4425
29 Ga0070693_100123120 3300005547 Bacteria 1611
30 Ga0070665_100014015 3300005548 Bacteria 8060
31 Ga0070665_100051650 3300005548 Bacteria 4123
32 Ga0070664_100069055 3300005564 Unclassified 3022
33 Ga0070664_100314234 3300005564 Bacteria 1418
34 Ga0070702_100011348 3300005615 Bacteria 4429
35 Ga0068859_100207392 3300005617 Unclassified 2045
36 Ga0068859_100657508 3300005617 Bacteria 1140
37 Ga0068864_100139264 3300005618 Unclassified 2188
38 Ga0068864_100296086 3300005618 Bacteria 1514
39 Ga0068861_100031245 3300005719 Bacteria 3910
40 Ga0068861_100049755 3300005719 Bacteria 3175
41 Ga0068861_100227111 3300005719 Bacteria 1581
42 Ga0068861_100318817 3300005719 Bacteria 1353
43 Ga0068863_100234173 3300005841 Bacteria 1772
44 Ga0068860_100509729 3300005843 Unclassified 1202
45 Ga0068862_100052855 3300005844 Unclassified 3477
46 Ga0081455_10001002 3300005937 Bacteria 35808
47 Ga0097621_100106467 3300006237 Unclassified 2365
48 Ga0068871_100018302 3300006358 Bacteria 5322
49 Ga0068871_100060437 3300006358 Unclassified 3092
50 Ga0068865_100029386 3300006881 Bacteria 3647
51 Ga0068865_100208246 3300006881 Bacteria 1522
52 Ga0068865_100319143 3300006881 Bacteria 1249
53 Ga0097620_100207375 3300006931 Unclassified 2045
54 Ga0097620_100657435 3300006931 Bacteria 1140
55 Ga0111539_10101094 3300009094 Bacteria 3385
56 Ga0157375_10017120 3300013308 Bacteria 6533
57 Ga0163163_10069022 3300014325 Bacteria 3518
58 Ga0157380_10069214 3300014326 Bacteria 2847
59 Ga0157380_10074870 3300014326 Unclassified 2750
60 Ga0157380_10094960 3300014326 Unclassified 2469
61 Ga0157380_10394283 3300014326 Unclassified 1311
62 Ga0207682_10001515 3300025893 Bacteria 10708
63 Ga0207642_10209802 3300025899 Unclassified 1081
64 Ga0207645_10020848 3300025907 Bacteria 4282
65 Ga0207645_10171793 3300025907 Bacteria 1421
66 Ga0207643_10089544 3300025908 Bacteria 1792
67 Ga0207649_10036917 3300025920 Bacteria 2947
68 Ga0207681_10071885 3300025923 Unclassified 2414
69 Ga0207650_10341471 3300025925 Bacteria 1230
70 Ga0207659_10056322 3300025926 Unclassified 2815
71 Ga0207670_10049558 3300025936 Unclassified 2810
72 Ga0207670_10225819 3300025936 Bacteria 1436
73 Ga0207691_10021543 3300025940 Bacteria 6086
74 Ga0207691_10093572 3300025940 Bacteria 2691
75 Ga0207691_10132255 3300025940 Bacteria 2203
76 Ga0207689_10065746 3300025942 Bacteria 2982
77 Ga0207679_10054246 3300025945 Unclassified 2950
78 Ga0207712_10586906 3300025961 Bacteria 962
79 Ga0207678_10190236 3300026067 Bacteria 1753
80 Ga0207678_10193859 3300026067 Bacteria 1737
81 Ga0207708_10050865 3300026075 Unclassified 3154
82 Ga0207708_10067452 3300026075 Unclassified 2736
83 Ga0207708_10223213 3300026075 Unclassified 1510
84 Ga0207708_10233801 3300026075 Unclassified 1476
85 Ga0207641_10185705 3300026088 Bacteria 1907
86 Ga0207648_10072769 3300026089 Unclassified 2996
87 Ga0207648_10127455 3300026089 Bacteria 2239
88 Ga0207648_10407998 3300026089 Bacteria 1232
89 Ga0207676_10664927 3300026095 Bacteria 1006
90 Ga0207674_10079971 3300026116 Bacteria 3272
91 Ga0207675_100013581 3300026118 Bacteria 7603
92 Ga0207675_100063181 3300026118 Bacteria 3460
93 Ga0207675_100172098 3300026118 Unclassified 2070
94 Ga0207675_100382261 3300026118 Bacteria 1385
95 Ga0207675_100388760 3300026118 Bacteria 1373
96 Ga0207683_10002088 3300026121 Bacteria 17617
97 Ga0268266_10064160 3300028379 Bacteria 3172
98 Ga0268266_10088969 3300028379 Bacteria 2703
99 Ga0268265_10055542 3300028380 Unclassified 3009
100 Ga0268265_10283304 3300028380 Bacteria 1484
101 Ga0307513_10042854 3300031456 Bacteria 4977
102 Ga0307513_10088704 3300031456 Unclassified 3160
103 Ga0307509_10035229 3300031507 Bacteria 5496
104 Ga0307509_10127653 3300031507 Bacteria 2506
105 Ga0307408_100099773 3300031548 Bacteria 2210
106 Ga0307405_10160367 3300031731 Bacteria 1592
107 Ga0307405_10173412 3300031731 Bacteria 1541
108 Ga0307405_10411214 3300031731 Bacteria 1062
109 Ga0307413_10025307 3300031824 Bacteria 3252
110 Ga0307413_10052223 3300031824 Bacteria 2467
111 Ga0307407_10032954 3300031903 Bacteria 2822
112 Ga0307409_100053253 3300031995 Bacteria 3108
113 Ga0307409_100287475 3300031995 Unclassified 1523
114 Ga0307416_100174630 3300032002 Unclassified 2005
115 Ga0307416_100312741 3300032002 Bacteria 1568
116 Ga0307416_100315972 3300032002 Bacteria 1561
117 Ga0307411_10024452 3300032005 Unclassified 3601
118 Ga0307415_100222380 3300032126 Bacteria 1514
119 Ga0307415_100367903 3300032126 Bacteria 1216
120 Ga0307415_100500225 3300032126 Bacteria 1062
121 Ga0307415_100504561 3300032126 Bacteria 1058
122 Ga0451789_1012395 3300041443 Bacteria 1380
123 Ga0451791_1851668 3300041451 Unclassified 1272
124 Ga0451793_0801938 3300041452 Unclassified 1183
125 Ga0451807_0016767 3300041486 Bacteria 10079
126 Ga0451807_1847581 3300041486 Unclassified 4488
127 Ga0451837_1864283 3300041494 Bacteria 2583
128 Ga0451849_1298886 3300041505 Bacteria 1788
129 Ga0451853_0785216 3300041512 Bacteria 1395
130 Ga0450914_008633 3300042118 Bacteria 948
131 Ga0495638_0080556 3300046460 Bacteria 1978
132 Ga0495616_0095272 3300046513 Bacteria 1403
133 Ga0495616_0105757 3300046513 Bacteria 1313
134 Ga0495632_0029749 3300046519 Bacteria 2841
135 Ga0495668_0010798 3300046616 Bacteria 5511
136 Ga0495625_0069653 3300046660 Bacteria 2471
137 Ga0495671_0141115 3300046692 Bacteria 1174
138 Ga0495649_0020239 3300046694 Unclassified 3733
139 Ga0495672_0136290 3300047320 Bacteria 1287
140 Ga0495626_0129186 3300048091 Bacteria 1080
141 Ga0501038_0201984 3300049574 Bacteria 1595
142 Ga0501039_0164909 3300049575 Bacteria 1742
143 Ga0501040_0220672 3300049576 Bacteria 1349
144 Ga0501042_0087933 3300049578 Bacteria 2229
145 Ga0501042_0144798 3300049578 Unclassified 1713
146 Ga0501048_0325419 3300049582 Bacteria 1095
147 Ga0501068_0022702 3300049584 Bacteria 3671
148 Ga0501068_0031356 3300049584 Bacteria 3157
149 Ga0501069_0041284 3300049585 Bacteria 2550
150 Ga0501070_0182768 3300049586 Bacteria 1725
151 Ga0501071_0089901 3300049587 Bacteria 2254
152 Ga0501071_0281685 3300049587 Bacteria 1258
153 Ga0501072_0044386 3300049588 Bacteria 3496
154 Ga0501072_0538052 3300049588 Bacteria 923
155 Ga0501073_0013561 3300049589 Bacteria 5927
156 Ga0501073_0031531 3300049589 Bacteria 3781
157 Ga0501073_0164581 3300049589 Bacteria 1536
158 Ga0501074_0012134 3300049590 Bacteria 6264
159 Ga0501074_0029520 3300049590 Bacteria 3972
160 Ga0501076_0034561 3300049592 Unclassified 3952
161 Ga0501077_0078668 3300049593 Bacteria 2089
162 Ga0501079_0008919 3300049741 Bacteria 7593
163 Ga0501080_0001443 3300049742 Bacteria 20008
164 Ga0501080_0179831 3300049742 Bacteria 1947
165 Ga0501083_0017386 3300049744 Bacteria 5013
166 Ga0501084_0053428 3300054114 Bacteria 3379
167 Ga0501084_0164973 3300054114 Bacteria 1870
168 Ga0501084_0254088 3300054114 Bacteria 1483
169 Ga0501082_0049295 3300060353 Bacteria 3631
170 rootL2_10219665
171 Ga0070683_100375127
172 Ga0070690_100005861
173 Ga0070690_100140684
174 Ga0070677_10014364
175 Ga0070682_100019062
176 Ga0070689_100033119
177 Ga0070687_100126655
178 Ga0070661_100021553
179 Ga0070668_100322288
180 Ga0070669_100031788
181 Ga0070675_100033613
182 Ga0070674_100110504
183 Ga0070674_100211401
184 Ga0070673_100079245
185 Ga0070673_100099976
186 Ga0070688_100268430
187 Ga0070701_10037386
188 Ga0070701_10053222
189 Ga0070705_100015031
190 Ga0070700_100091870
191 Ga0070700_100095258
192 Ga0070694_100022576
193 Ga0070663_100174900
194 Ga0070663_100275677
195 Ga0070685_10090711
196 Ga0070672_100074656
197 Ga0070686_100015439
198 Ga0070693_100123120
199 Ga0070665_100014015
200 Ga0070665_100051650
201 Ga0070664_100069055
202 Ga0070664_100314234
203 Ga0070702_100011348
204 Ga0068859_100207392
205 Ga0068859_100657508
206 Ga0068864_100139264
207 Ga0068864_100296086
208 Ga0068861_100031245
209 Ga0068861_100049755
210 Ga0068861_100227111
211 Ga0068861_100318817
212 Ga0068863_100234173
213 Ga0068860_100509729
214 Ga0068862_100052855
215 Ga0081455_10001002
216 Ga0097621_100106467
217 Ga0068871_100018302
218 Ga0068871_100060437
219 Ga0068865_100029386
220 Ga0068865_100208246
221 Ga0068865_100319143
222 Ga0097620_100207375
223 Ga0097620_100657435
224 Ga0111539_10101094
225 Ga0157375_10017120
226 Ga0163163_10069022
227 Ga0157380_10069214
228 Ga0157380_10074870
229 Ga0157380_10094960
230 Ga0157380_10394283
231 Ga0207682_10001515
232 Ga0207642_10209802
233 Ga0207645_10020848
234 Ga0207645_10171793
235 Ga0207643_10089544
236 Ga0207649_10036917
237 Ga0207681_10071885
238 Ga0207650_10341471
239 Ga0207659_10056322
240 Ga0207670_10049558
241 Ga0207670_10225819
242 Ga0207691_10021543
243 Ga0207691_10093572
244 Ga0207691_10132255
245 Ga0207689_10065746
246 Ga0207679_10054246
247 Ga0207712_10586906
248 Ga0207678_10190236
249 Ga0207678_10193859
250 Ga0207708_10050865
251 Ga0207708_10067452
252 Ga0207708_10223213
253 Ga0207708_10233801
254 Ga0207641_10185705
255 Ga0207648_10072769
256 Ga0207648_10127455
257 Ga0207648_10407998
258 Ga0207676_10664927
259 Ga0207674_10079971
260 Ga0207675_100013581
261 Ga0207675_100063181
262 Ga0207675_100172098
263 Ga0207675_100382261
264 Ga0207675_100388760
265 Ga0207683_10002088
266 Ga0268266_10064160
267 Ga0268266_10088969
268 Ga0268265_10055542
269 Ga0268265_10283304
270 Ga0307513_10042854
271 Ga0307513_10088704
272 Ga0307509_10035229
273 Ga0307509_10127653
274 Ga0307408_100099773
275 Ga0307405_10160367
276 Ga0307405_10173412
277 Ga0307405_10411214
278 Ga0307413_10025307
279 Ga0307413_10052223
280 Ga0307407_10032954
281 Ga0307409_100053253
282 Ga0307409_100287475
283 Ga0307416_100174630
284 Ga0307416_100312741
285 Ga0307416_100315972
286 Ga0307411_10024452
287 Ga0307415_100222380
288 Ga0307415_100367903
289 Ga0307415_100500225
290 Ga0307415_100504561
291 Ga0451789_1012395
292 Ga0451791_1851668
293 Ga0451793_0801938
294 Ga0451807_0016767
295 Ga0451807_1847581
296 Ga0451837_1864283
297 Ga0451849_1298886
298 Ga0451853_0785216
299 Ga0450914_008633
300 Ga0495638_0080556
301 Ga0495616_0095272
302 Ga0495616_0105757
303 Ga0495632_0029749
304 Ga0495668_0010798
305 Ga0495625_0069653
306 Ga0495671_0141115
307 Ga0495649_0020239
308 Ga0495672_0136290
309 Ga0495626_0129186
310 Ga0501038_0201984
311 Ga0501039_0164909
312 Ga0501040_0220672
313 Ga0501042_0087933
314 Ga0501042_0144798
315 Ga0501048_0325419
316 Ga0501068_0022702
317 Ga0501068_0031356
318 Ga0501069_0041284
319 Ga0501070_0182768
320 Ga0501071_0089901
321 Ga0501071_0281685
322 Ga0501072_0044386
323 Ga0501072_0538052
324 Ga0501073_0013561
325 Ga0501073_0031531
326 Ga0501073_0164581
327 Ga0501074_0012134
328 Ga0501074_0029520
329 Ga0501076_0034561
330 Ga0501077_0078668
331 Ga0501079_0008919
332 Ga0501080_0001443
333 Ga0501080_0179831
334 Ga0501083_0017386
335 Ga0501084_0053428
336 Ga0501084_0164973
337 Ga0501084_0254088
338 Ga0501082_0049295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08668

HDOD

HDOD domain

43

232

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7a-assembly1.cif.gz_A crystal structure of putative metal-dependent phosphohydrolase (yp_926882.1) from shewanella amazonensis sb2b at 2.06 a resolution 0.7114 22 296
3i7a-assembly1.cif.gz_A crystal structure of putative metal-dependent phosphohydrolase (yp_926882.1) from shewanella amazonensis sb2b at 2.06 a resolution 0.6988 22 296
3m1t-assembly1.cif.gz_A crystal structure of putative phosphohydrolase (yp_929327.1) from shewanella amazonensis sb2b at 1.62 a resolution 0.6471 22 300
3m1t-assembly1.cif.gz_A crystal structure of putative phosphohydrolase (yp_929327.1) from shewanella amazonensis sb2b at 1.62 a resolution 0.6348 22 300
3mem-assembly1.cif.gz_A crystal structure of a putative signal transduction protein (maqu_0641) from marinobacter aquaeolei vt8 at 2.25 a resolution 0.6245 19 301
ID Description Score Start End Superfamily
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7733 141 262 1.10.3210.10
3i7aA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6926 23 296 1.10.3210.10
3i7aA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.684 23 296 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6754 140 252 1.10.3210.10
3ccgA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6496 141 254 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A449IFW6-F1-model_v4 HDOD domain-containing protein 0.8943 138 289
AF-A0A3M4ECR9-F1-model_v4 deleted 0.8935 150 251
AF-A0A7V0KQQ0-F1-model_v4 HDOD domain-containing protein 0.8771 150 278
AF-A0A656H674-F1-model_v4 deleted 0.8635 134 293
AF-A0A359EML7-F1-model_v4 deleted 0.8594 167 296

Map