F305253

General Info

Members Datasets Scaffolds Average Seq Length
199 166 119 177

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10002814|rootH1_1000281414
Length 188
Sequence MMRKGINQYPRPPGAKPVIRVLIITAAVLGVIAIAGLGADLRINMTPSEPLGLWRIRPLGRKVIAGDVVFICPPETELMRLARDRGYFRGGLCSGGYAPLIKTIAATAGQHVAIGRSVSIDGVPLLQSTLIARDGKGRPLAPYPGGTVPPGEVFLYSPFVGSYDSRYFGPLPAAGILGLAEEVFTYAP

Samples

Sample ID Description Type Environment
1 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
2 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
3 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
4 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
5 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
6 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
7 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
8 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
9 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
10 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
11 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
12 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
13 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
14 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
15 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
16 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
17 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
18 2643221558 Rhizobium sp. Root149 Isolate Unclassified
19 2643221568 Rhizobium sp. Root564 Isolate Unclassified
20 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
21 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
22 2643221718 Rhizobium sp. Root268 Isolate Unclassified
23 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
24 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
25 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
26 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
27 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
28 2791355266 Rhizobium sp. L43 Isolate Nodule
29 2791355267 Rhizobium sp. L18 Isolate Nodule
30 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
31 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
32 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
33 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
34 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
35 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
36 2802429634 Rhizobium anhuiense S10 Isolate Nodule
37 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
38 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
39 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
40 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
41 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
42 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
43 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
44 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
45 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
46 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
47 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
48 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
49 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
50 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
51 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
52 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
53 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
54 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
55 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
56 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
57 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
58 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
59 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
60 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
61 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
62 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
63 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
64 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
65 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
66 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
67 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
68 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
69 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
70 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
71 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
72 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
73 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
74 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
75 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
76 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
77 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
78 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
81 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
84 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
85 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
107 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
108 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
109 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
110 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
156 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
157 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
158 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
159 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
160 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
161 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
162 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
163 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
164 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
165 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
166 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.3
Metatranscriptomes 0
Isolates 40.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.07
Nodule 33.67
Rhizoplane 3.52
Rhizosphere 20.6
Stem 0
Stem Tuber 0
Unclassified 29.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000553 3300002773 Bacteria 20477
2 JGI25150J39212_1000090 3300002774 Bacteria 52878
3 JGI25151J46595_10000313 3300003187 Bacteria 52878
4 JGI25153J46596_10001922 3300003215 Bacteria 12332
5 rootH1_10002814 3300003316 Bacteria 40375
6 rootH1_10002814 3300003323 Bacteria 12796
7 rootH1_10042705 3300003316 Bacteria 1458
8 rootH2_10034305 3300003320 Bacteria 9510
9 rootL2_10010387 3300003322 Bacteria 55016
10 rootH1_10011917 3300003323 Bacteria 11772
11 rootH1_10086417 3300003316 Bacteria 3854
12 rootH1_10086417 3300003323 Bacteria 2170
13 Ga0055526_1003381 3300003771 Bacteria 10171
14 Ga0055540_1000094 3300003792 Bacteria 97733
15 Ga0058692_1000019 3300003856 Bacteria 255580
16 Ga0075365_10069870 3300006038 Bacteria 2361
17 Ga0214544_1001876 3300021320 Bacteria 44249
18 Ga0214542_1000418 3300021321 Bacteria 75807
19 Ga0214542_1004154 3300021321 Bacteria 28938
20 Ga0214543_1004493 3300021327 Bacteria 26374
21 Ga0214543_1005751 3300021327 Bacteria 22542
22 Ga0207425_1000172 3300025245 Bacteria 53044
23 Ga0207425_1040302 3300025245 Bacteria 892
24 Ga0209129_1000263 3300025258 Bacteria 52958
25 Ga0209676_1014219 3300025292 Bacteria 3006
26 Ga0209025_1000773 3300025294 Bacteria 53044
27 Ga0209564_1001053 3300025295 Bacteria 33613
28 Ga0209758_1000645 3300025297 Bacteria 52915
29 Ga0209758_1002323 3300025297 Bacteria 19654
30 Ga0209050_1006850 3300025298 Bacteria 6615
31 Ga0209256_1000999 3300025299 Bacteria 33608
32 Ga0209051_1000032 3300025303 Bacteria 383445
33 Ga0209051_1035406 3300025303 Bacteria 1858
34 Ga0207671_10000379 3300025914 Bacteria 63039
35 Ga0207640_10733003 3300025981 Bacteria 850
36 Ga0209371_1000107 3300027312 Bacteria 141889
37 Ga0268256_1000093 3300030500 Bacteria 141889
38 Ga0307514_10015843 3300031649 Bacteria 6214
39 Ga0307406_10029473 3300031901 Bacteria 3324
40 Ga0307412_10003113 3300031911 Bacteria 9213
41 Ga0373927_0000678 3300035695 Bacteria 25937
42 Ga0373925_0007178 3300037068 Bacteria 8143
43 Ga0395905_0001439 3300037471 Bacteria 28644
44 Ga0451833_0467532 3300041491 Bacteria 3095
45 Ga0451835_0304819 3300041492 Bacteria 2925
46 Ga0451837_1001405 3300041494 Bacteria 1468
47 Ga0451837_1302625 3300041494 Bacteria 4333
48 Ga0451839_0137182 3300041496 Bacteria 4541
49 Ga0451841_0346929 3300041498 Bacteria 1813
50 Ga0451845_0156729 3300041501 Bacteria 1856
51 Ga0451849_0526645 3300041505 Bacteria 1023
52 Ga0451851_0801712 3300041507 Bacteria 5970
53 Ga0451851_0942411 3300041507 Bacteria 1000
54 Ga0451843_0331227 3300041509 Bacteria 2707
55 Ga0451843_1400179 3300041509 Bacteria 1654
56 Ga0451855_0896666 3300041511 Bacteria 1689
57 Ga0451853_3775668 3300041512 Bacteria 3138
58 Ga0495638_0000077 3300046460 Bacteria 158724
59 Ga0495605_0033756 3300046474 Bacteria 2596
60 Ga0495585_0014652 3300046492 Bacteria 4562
61 Ga0495606_0115559 3300046507 Bacteria 1613
62 Ga0495610_0032910 3300046512 Bacteria 2687
63 Ga0495610_0181148 3300046512 Plasmid 876
64 Ga0495648_0012874 3300046524 Bacteria 6214
65 Ga0495633_0001600 3300046558 Bacteria 17165
66 Ga0495656_0132401 3300046615 Bacteria 1188
67 Ga0495668_0016307 3300046616 Bacteria 4318
68 Ga0495625_0003024 3300046660 Bacteria 17253
69 Ga0495588_0028886 3300046674 Bacteria 2779
70 Ga0495670_0013057 3300046691 Bacteria 4084
71 Ga0495660_0130545 3300046810 Bacteria 1261
72 Ga0495686_0070240 3300047472 Bacteria 2158
73 Ga0495615_0035084 3300048090 Bacteria 1224
74 Ga0496100_0000431 3300048903 Bacteria 20358
75 Ga0496102_0000625 3300048905 Bacteria 36336
76 Ga0496103_0003326 3300048906 Bacteria 9833
77 Ga0496107_0154023 3300048910 Bacteria 1701
78 Ga0496113_0061543 3300048916 Bacteria 2833
79 Ga0496113_0661032 3300048916 Bacteria 835
80 Ga0496116_0000601 3300048919 Bacteria 47643
81 Ga0496116_0000868 3300048919 Bacteria 37701
82 Ga0496117_0001345 3300048920 Bacteria 36055
83 Ga0496117_0278131 3300048920 Bacteria 898
84 Ga0496118_0000524 3300048921 Bacteria 63074
85 Ga0496118_0064155 3300048921 Bacteria 2697
86 Ga0496119_0006812 3300048922 Bacteria 10474
87 Ga0496119_0060388 3300048922 Bacteria 2270
88 Ga0496120_0001015 3300048923 Bacteria 37573
89 Ga0496121_0001402 3300048924 Bacteria 40798
90 Ga0496121_0072255 3300048924 Bacteria 2770
91 Ga0496122_0002943 3300048925 Bacteria 23224
92 Ga0496122_0008327 3300048925 Bacteria 11220
93 Ga0496122_0019299 3300048925 Bacteria 6236
94 Ga0496122_0029106 3300048925 Bacteria 4668
95 Ga0496122_0033815 3300048925 Bacteria 4197
96 Ga0496123_0004310 3300048926 Bacteria 15100
97 Ga0496123_0027284 3300048926 Bacteria 4257
98 Ga0496123_0152210 3300048926 Bacteria 1246
99 Ga0496124_0002118 3300048927 Bacteria 26720
100 Ga0496124_0012941 3300048927 Bacteria 8184
101 Ga0496124_0049926 3300048927 Bacteria 3566
102 Ga0496124_0103580 3300048927 Bacteria 2302
103 Ga0496126_0000243 3300048929 Bacteria 117685
104 Ga0496126_0002170 3300048929 Bacteria 27261
105 Ga0496126_0513104 3300048929 Plasmid 956
106 Ga0495678_038605 3300049459 Bacteria 1931
107 Ga0501032_0096074 3300049569 Bacteria 1964
108 Ga0501033_0000054 3300049570 Bacteria 108163
109 Ga0501034_0054016 3300049571 Bacteria 4045
110 Ga0501039_0798452 3300049575 Bacteria 736
111 Ga0501039_0911589 3300049575 Unclassified 684
112 Ga0501035_0003741 3300049822 Bacteria 14510
113 nmdc:mga0yw44_521_c1 3300050492 Bacteria 13775
114 Ga0500578_0173528 3300053086 Bacteria 1332
115 Ga0500643_102188 3300053087 Bacteria 777
116 Ga0500556_0000105 3300053104 Bacteria 74717
117 Ga0500556_0099635 3300053104 Bacteria 1118
118 Ga0500618_000427 3300053125 Bacteria 28047
119 Ga0500636_0008615 3300053177 Bacteria 5908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842285085 2842290235 153
2 iso_pu_bacteria 2842402390 2842407969 153
3 iso_pu_bacteria 2842409023 2842414619 153
4 iso_pu_bacteria 2842415677 2842421008 153
5 3300048916 Ga0496113_0661032 Ga0496113_0661032_13_480 154
6 3300048929 Ga0496126_0513104 Ga0496126_0513104_46_510 154
7 3300048927 Ga0496124_0012941 Ga0496124_0012941_1142_1672 155
8 3300035695 Ga0373927_0000678 Ga0373927_0000678_23787_24353 159
9 3300037068 Ga0373925_0007178 Ga0373925_0007178_1392_1958 159
10 3300046507 Ga0495606_0115559 Ga0495606_0115559_507_986 159
11 iso_pu_bacteria 2891373044 2891374036 159
12 3300025245 Ga0207425_1040302 Ga0207425_10403022 160
13 3300031649 Ga0307514_10015843 Ga0307514_100158432 161
14 3300049571 Ga0501034_0054016 Ga0501034_0054016_250_735 161
15 iso_pu_bacteria 2915980308 2915986702 161
16 iso_pu_bacteria 2921250672 2921257074 161
17 3300053087 Ga0500643_102188 Ga0500643_102188_175_663 162
18 iso_pu_bacteria 2838661181 2838668401 164
19 iso_pu_bacteria 2582581308 2585281453 165
20 iso_pu_bacteria 2615840626 2616310820 165
21 iso_pu_bacteria 2842110456 2842117897 165
22 3300046810 Ga0495660_0130545 Ga0495660_0130545_22_522 166
23 3300049575 Ga0501039_0911589 Ga0501039_0911589_129_629 166
24 3300037471 Ga0395905_0001439 Ga0395905_0001439_8320_8823 167
25 3300041494 Ga0451837_1302625 Ga0451837_1302625_1357_1923 167
26 3300041498 Ga0451841_0346929 Ga0451841_0346929_696_1262 167
27 3300041507 Ga0451851_0942411 Ga0451851_0942411_138_704 167
28 3300041509 Ga0451843_1400179 Ga0451843_1400179_30_596 167
29 3300046460 Ga0495638_0000077 Ga0495638_0000077_88186_88689 167
30 3300003792 Ga0055540_1000094 Ga0055540_100009498 168
31 3300025292 Ga0209676_1014219 Ga0209676_10142193 168
32 3300025298 Ga0209050_1006850 Ga0209050_10068502 168
33 3300025303 Ga0209051_1000032 Ga0209051_1000032224 168
34 3300025914 Ga0207671_10000379 Ga0207671_1000037920 169
35 3300025981 Ga0207640_10733003 Ga0207640_107330031 169
36 3300041491 Ga0451833_0467532 Ga0451833_0467532_795_1361 169
37 3300041492 Ga0451835_0304819 Ga0451835_0304819_1241_1807 169
38 3300041494 Ga0451837_1001405 Ga0451837_1001405_724_1290 169
39 3300041496 Ga0451839_0137182 Ga0451839_0137182_2396_2962 169
40 3300041501 Ga0451845_0156729 Ga0451845_0156729_29_595 169
41 3300041505 Ga0451849_0526645 Ga0451849_0526645_288_854 169
42 3300041507 Ga0451851_0801712 Ga0451851_0801712_3151_3717 169
43 3300041509 Ga0451843_0331227 Ga0451843_0331227_1250_1816 169
44 3300041511 Ga0451855_0896666 Ga0451855_0896666_475_1041 169
45 3300041512 Ga0451853_3775668 Ga0451853_3775668_311_877 169
46 3300046474 Ga0495605_0033756 Ga0495605_0033756_1992_2558 169
47 3300046492 Ga0495585_0014652 Ga0495585_0014652_3021_3587 169
48 3300046512 Ga0495610_0032910 Ga0495610_0032910_1681_2247 169
49 3300046512 Ga0495610_0181148 Ga0495610_0181148_165_731 169
50 3300046524 Ga0495648_0012874 Ga0495648_0012874_2017_2583 169
51 3300046558 Ga0495633_0001600 Ga0495633_0001600_5450_6016 169
52 3300046615 Ga0495656_0132401 Ga0495656_0132401_262_828 169
53 3300046616 Ga0495668_0016307 Ga0495668_0016307_1899_2465 169
54 3300046660 Ga0495625_0003024 Ga0495625_0003024_2772_3338 169
55 3300046691 Ga0495670_0013057 Ga0495670_0013057_243_809 169
56 3300047472 Ga0495686_0070240 Ga0495686_0070240_1220_1786 169
57 3300048090 Ga0495615_0035084 Ga0495615_0035084_193_759 169
58 3300049459 Ga0495678_038605 Ga0495678_038605_1034_1600 169
59 3300053125 Ga0500618_000427 Ga0500618_000427_3420_3986 169
60 iso_pu_bacteria 2615840698 2616551436 169
61 3300053104 Ga0500556_0000105 Ga0500556_0000105_6538_7050 170
62 3300048903 Ga0496100_0000431 Ga0496100_0000431_17302_17817 171
63 3300048905 Ga0496102_0000625 Ga0496102_0000625_18896_19411 171
64 3300048920 Ga0496117_0001345 Ga0496117_0001345_18896_19411 171
65 3300048921 Ga0496118_0000524 Ga0496118_0000524_18896_19411 171
66 3300048929 Ga0496126_0002170 Ga0496126_0002170_9979_10494 171
67 iso_pu_bacteria 2558860983 2561469531 172
68 iso_pu_bacteria 2582581316 2585336543 172
69 iso_pu_bacteria 2643221558 2643810858 172
70 iso_pu_bacteria 2643221568 2643858378 172
71 iso_pu_bacteria 2791355266 2793363432 172
72 iso_pu_bacteria 2989776772 2989780914 172
73 iso_pu_bacteria 8004395343 8004396479 172
74 iso_pu_bacteria 2935675223 2935683976 173
75 iso_pu_bacteria 2937843397 2937844124 173
76 3300025297 Ga0209758_1002323 Ga0209758_100232319 174
77 3300053086 Ga0500578_0173528 Ga0500578_0173528_438_962 174
78 3300006038 Ga0075365_10069870 Ga0075365_100698702 176
79 3300046674 Ga0495588_0028886 Ga0495588_0028886_628_1158 176
80 3300048906 Ga0496103_0003326 Ga0496103_0003326_1544_2074 176
81 3300048910 Ga0496107_0154023 Ga0496107_0154023_661_1191 176
82 3300048916 Ga0496113_0061543 Ga0496113_0061543_1970_2500 176
83 3300048919 Ga0496116_0000601 Ga0496116_0000601_17059_17589 176
84 3300048919 Ga0496116_0000868 Ga0496116_0000868_18288_18818 176
85 3300048920 Ga0496117_0278131 Ga0496117_0278131_96_626 176
86 3300048922 Ga0496119_0006812 Ga0496119_0006812_7598_8128 176
87 3300048923 Ga0496120_0001015 Ga0496120_0001015_18884_19414 176
88 3300048924 Ga0496121_0001402 Ga0496121_0001402_21385_21915 176
89 3300048925 Ga0496122_0002943 Ga0496122_0002943_21415_21945 176
90 3300048925 Ga0496122_0008327 Ga0496122_0008327_3127_3660 176
91 3300048925 Ga0496122_0019299 Ga0496122_0019299_3810_4340 176
92 3300048926 Ga0496123_0004310 Ga0496123_0004310_5558_6088 176
93 3300048926 Ga0496123_0152210 Ga0496123_0152210_574_1104 176
94 3300048927 Ga0496124_0002118 Ga0496124_0002118_8031_8561 176
95 3300048927 Ga0496124_0049926 Ga0496124_0049926_1051_1581 176
96 3300048927 Ga0496124_0103580 Ga0496124_0103580_1236_1766 176
97 3300048929 Ga0496126_0000243 Ga0496126_0000243_8267_8797 176
98 3300050492 nmdc:mga0yw44_521_c1 nmdc:mga0yw44_521_c1_3825_4361 176
99 iso_pu_bacteria 2643221637 2644208151 176
100 iso_pu_bacteria 2643221718 2644651909 176
101 3300003323 rootH1_10086417 rootH1_100864172 178
102 iso_pu_bacteria 2802428860 2802733579 182
103 iso_pu_bacteria 2513237144 2513914227 183
104 iso_pu_bacteria 2643221636 2644200568 183
105 iso_pu_bacteria 2857516855 2857524251 183
106 iso_pu_bacteria 2933586486 2933593917 183
107 iso_pu_bacteria 2937084907 2937087791 183
108 iso_pu_bacteria 2957437181 2957440520 183
109 iso_pu_bacteria 2967728569 2967733680 183
110 iso_pu_bacteria 2970122695 2970125116 183
111 iso_pu_bacteria 2977530762 2977531796 183
112 iso_pu_bacteria 639633055 639651135 183
113 iso_pu_bacteria 2512875026 2512975116 184
114 iso_pu_bacteria 2513237089 2513605152 184
115 iso_pu_bacteria 2513237146 2513930095 184
116 iso_pu_bacteria 2513237160 2514007817 184
117 iso_pu_bacteria 2513237162 2514024610 184
118 iso_pu_bacteria 2515154116 2515661332 184
119 iso_pu_bacteria 2516653077 2517042881 184
120 iso_pu_bacteria 2517093000 2517099969 184
121 iso_pu_bacteria 2517487022 2517567760 184
122 iso_pu_bacteria 2582581294 2585204446 184
123 iso_pu_bacteria 2599185170 2599413985 184
124 iso_pu_bacteria 2765235942 2766064472 184
125 iso_pu_bacteria 2791355091 2792623737 184
126 iso_pu_bacteria 2791355092 2792630030 184
127 iso_pu_bacteria 2791355094 2792641109 184
128 iso_pu_bacteria 2791355253 2793283248 184
129 iso_pu_bacteria 2791355267 2793370565 184
130 iso_pu_bacteria 2802428858 2802722318 184
131 iso_pu_bacteria 2802428859 2802728114 184
132 iso_pu_bacteria 2802428861 2802736675 184
133 iso_pu_bacteria 2802428862 2802747929 184
134 iso_pu_bacteria 2802428863 2802749759 184
135 iso_pu_bacteria 2802429634 2806055740 184
136 iso_pu_bacteria 2802429635 2806062545 184
137 iso_pu_bacteria 2838035591 2838042555 184
138 iso_pu_bacteria 2842110456 2842113974 184
139 iso_pu_bacteria 2920760137 2920762334 184
140 iso_pu_bacteria 2933016740 2933023028 184
141 iso_pu_bacteria 2933586486 2933589749 184
142 iso_pu_bacteria 2937029754 2937035504 184
143 iso_pu_bacteria 2937036028 2937039906 184
144 iso_pu_bacteria 2957375807 2957376344 184
145 iso_pu_bacteria 2960591022 2960597357 184
146 iso_pu_bacteria 2960631154 2960636551 184
147 iso_pu_bacteria 2960680706 2960686063 184
148 iso_pu_bacteria 2960693952 2960695990 184
149 iso_pu_bacteria 2967686174 2967690997 184
150 iso_pu_bacteria 2970026789 2970029024 184
151 iso_pu_bacteria 2970143518 2970148087 184
152 iso_pu_bacteria 2977544691 2977546764 184
153 iso_pu_bacteria 8003999396 8004005307 184
154 iso_pu_bacteria 8005484373 8005488217 184
155 iso_pu_bacteria 8005682033 8005687186 184
156 iso_pu_bacteria 8018150411 8018153794 184
157 iso_pu_bacteria 8046767195 8046767810 184
158 iso_pu_bacteria 8056375014 8056377349 184
159 iso_pu_bacteria 8057575449 8057580281 184
160 3300053177 Ga0500636_0008615 Ga0500636_0008615_4501_5061 186
161 3300002773 JGI25152J39213_1000553 JGI25152J39213_100055311 187
162 3300002774 JGI25150J39212_1000090 JGI25150J39212_100009012 187
163 3300003187 JGI25151J46595_10000313 JGI25151J46595_1000031357 187
164 3300003215 JGI25153J46596_10001922 JGI25153J46596_100019226 187
165 3300003316 rootH1_10002814 rootH1_1000281414 187
166 3300003316 rootH1_10042705 rootH1_100427052 187
167 3300003320 rootH2_10034305 rootH2_100343052 187
168 3300003322 rootL2_10010387 rootL2_1001038726 187
169 3300003323 rootH1_10011917 rootH1_100119177 187
170 3300003771 Ga0055526_1003381 Ga0055526_10033812 187
171 3300003856 Ga0058692_1000019 Ga0058692_1000019214 187
172 3300003856 Ga0058692_1000019 Ga0058692_100001977 187
173 3300021320 Ga0214544_1001876 Ga0214544_100187642 187
174 3300021321 Ga0214542_1000418 Ga0214542_100041844 187
175 3300021321 Ga0214542_1004154 Ga0214542_100415424 187
176 3300021327 Ga0214543_1004493 Ga0214543_100449314 187
177 3300021327 Ga0214543_1005751 Ga0214543_10057517 187
178 3300025245 Ga0207425_1000172 Ga0207425_100017253 187
179 3300025258 Ga0209129_1000263 Ga0209129_100026351 187
180 3300025294 Ga0209025_1000773 Ga0209025_100077353 187
181 3300025295 Ga0209564_1001053 Ga0209564_100105312 187
182 3300025297 Ga0209758_1000645 Ga0209758_100064551 187
183 3300025299 Ga0209256_1000999 Ga0209256_100099925 187
184 3300025303 Ga0209051_1035406 Ga0209051_10354063 187
185 3300027312 Ga0209371_1000107 Ga0209371_100010752 187
186 3300030500 Ga0268256_1000093 Ga0268256_100009352 187
187 3300031901 Ga0307406_10029473 Ga0307406_100294732 187
188 3300031911 Ga0307412_10003113 Ga0307412_100031135 187
189 3300048921 Ga0496118_0064155 Ga0496118_0064155_1123_1692 187
190 3300048922 Ga0496119_0060388 Ga0496119_0060388_20_583 187
191 3300048924 Ga0496121_0072255 Ga0496121_0072255_838_1401 187
192 3300048925 Ga0496122_0029106 Ga0496122_0029106_2632_3198 187
193 3300048925 Ga0496122_0033815 Ga0496122_0033815_207_773 187
194 3300048926 Ga0496123_0027284 Ga0496123_0027284_2743_3309 187
195 3300049569 Ga0501032_0096074 Ga0501032_0096074_1161_1727 187
196 3300049570 Ga0501033_0000054 Ga0501033_0000054_63049_63615 187
197 3300049575 Ga0501039_0798452 Ga0501039_0798452_26_592 187
198 3300049822 Ga0501035_0003741 Ga0501035_0003741_9047_9613 187
199 3300053104 Ga0500556_0099635 Ga0500556_0099635_241_807 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

16

185

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k8w-assembly1.cif.gz_A-2 an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa 0.6638 56 186
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6599 40 185
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6497 40 187
4nv4-assembly1.cif.gz_A 1.8 angstrom crystal structure of signal peptidase i from bacillus anthracis. 0.6383 99 177
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6234 40 187
ID Description Score Start End Superfamily
af_A0A5K1K8B7_164_341_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.829 62 179 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7224 39 178 2.10.109.10
af_Q96LU5_28_157_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7111 40 179 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7038 39 178 2.10.109.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.6982 46 180 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A528JI88-F1-model_v4 Conjugative transfer signal peptidase TraF 0.9933 49 187 GO:0004252
GO:0006465
GO:0042597
AF-A0A528JI88-F1-model_v4 Conjugative transfer signal peptidase TraF 0.9862 49 187 GO:0004252
GO:0006465
GO:0042597
AF-A0A4Y3WFK7-F1-model_v4 Conjugal transfer protein TraF 0.9859 39 187 GO:0004252
GO:0006465
GO:0016020
GO:0042597
AF-A0A024J1G0-F1-model_v4 deleted 0.9796 21 187
AF-A0A256GZP3-F1-model_v4 Conjugative transfer signal peptidase TraF 0.9787 58 187 GO:0004252
GO:0006465
GO:0042597

Feature Viewer

pLDDT pTM Quality
86.54 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map