F305242

General Info

Members Datasets Scaffolds Average Seq Length
199 127 147 321

Family's Representative Sequence

Representative Sequence 3300002773|JGI25152J39213_1000345|JGI25152J39213_100034518
Length 321
Sequence MSENHNHYDVLIIGAGPIGMACAIEAKKANLSYIIIEKGALVNSLFNYPVFMTFFSTSQRLEIGGVPFVTINPKPNRNEAVEYYRRVAGKFDLHINLFETVNQVTKNGDSFAVNTSKTDYTARNVIVATGFYDVPLLMNVKGEELPKVTHYYKDPHLYAFQNVLVVGANNSGVDAALETYRKGANVTMVVRSAELGKNVKYWVRPDIENRIKEGEITAYFNSEVLEIKPNEVIVKTPAGIKTIPNDFVIAMTGYQPDFNMLRKFGIDLPDSLCPVYNDETMETNVKGLYLAGVVCGGMDTHKLFIENSRIHAEMIVKNILG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
22 2738541283 Pedobacter sp. OK701 Isolate Unclassified
23 2738541302 Pedobacter sp. CF074 Isolate Unclassified
24 2739367651 Pedobacter sp. OK291 Isolate Unclassified
25 2739367656 Pedobacter sp. CF523 Isolate Unclassified
26 2739367663 Pedobacter sp. YR510 Isolate Unclassified
27 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
28 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
29 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
30 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
31 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
32 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
33 2818991437 Pedobacter terrae 518 Isolate Unclassified
34 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
35 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
36 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
37 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
38 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
39 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
40 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
41 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
42 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
43 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
44 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
45 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
46 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
47 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
48 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
49 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
50 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
51 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
52 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
53 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
54 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
61 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
124 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
125 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.87
Metatranscriptomes 0
Isolates 26.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 0.5
Rhizoplane 1.01
Rhizosphere 71.36
Stem 0
Stem Tuber 0
Unclassified 19.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2461477 2162886007 Bacteria 1657
2 SwRhRL2b_contig_308855 2162886007 Bacteria 1974
3 SwRhRL2b_contig_466296 2162886007 Bacteria 30659
4 JGI25152J39213_1000345 3300002773 Bacteria 29225
5 JGI25150J39212_1000011 3300002774 Bacteria 195312
6 JGI25151J46595_10000033 3300003187 Bacteria 195312
7 JGI25153J46596_10000052 3300003215 Bacteria 139303
8 Ga0055536_1000016 3300003781 Bacteria 222134
9 Ga0055534_1009724 3300003784 Bacteria 2065
10 Ga0055530_10007372 3300003791 Bacteria 4650
11 Ga0065714_10001936 3300005288 Bacteria 75145
12 Ga0065714_10067891 3300005288 Bacteria 5128
13 Ga0065714_10072747 3300005288 Bacteria 3311
14 Ga0065714_10104694 3300005288 Bacteria 1580
15 Ga0065704_10000199 3300005289 Bacteria 297176
16 Ga0065704_10078449 3300005289 Bacteria 4424
17 Ga0065704_10085800 3300005289 Bacteria 3185
18 Ga0065704_10097602 3300005289 Bacteria 2387
19 Ga0070682_100000228 3300005337 Bacteria 40617
20 Ga0070660_100062180 3300005339 Bacteria 2900
21 Ga0070688_100048511 3300005365 Bacteria 2639
22 Ga0068855_100337269 3300005563 Bacteria 1663
23 Ga0105244_10000001 3300009036 Bacteria 1034899
24 Ga0105244_10068810 3300009036 Bacteria 1768
25 Ga0105250_10011153 3300009092 Bacteria 3730
26 Ga0105243_10000114 3300009148 Bacteria 92916
27 Ga0105243_10090186 3300009148 Bacteria 2522
28 Ga0105237_10001570 3300009545 Bacteria 29798
29 Ga0157373_10000004 3300013100 Bacteria 275553
30 Ga0157373_10000015 3300013100 Bacteria 183381
31 Ga0157373_10000424 3300013100 Bacteria 33838
32 Ga0157373_10010806 3300013100 Bacteria 6720
33 Ga0157373_10078900 3300013100 Bacteria 2322
34 Ga0157373_10159933 3300013100 Bacteria 1585
35 Ga0157373_10308816 3300013100 Bacteria 1124
36 Ga0157371_10000052 3300013102 Bacteria 179522
37 Ga0157371_10000503 3300013102 Bacteria 47159
38 Ga0157371_10000542 3300013102 Bacteria 44953
39 Ga0157371_10000684 3300013102 Bacteria 40124
40 Ga0157371_10016903 3300013102 Bacteria 5433
41 Ga0157370_10000084 3300013104 Bacteria 104159
42 Ga0157370_10000657 3300013104 Bacteria 42959
43 Ga0157370_10002291 3300013104 Bacteria 23191
44 Ga0157370_10021843 3300013104 Bacteria 6375
45 Ga0157370_10144513 3300013104 Bacteria 2215
46 Ga0157370_10174878 3300013104 Bacteria 1996
47 Ga0157370_10174879 3300013104 Bacteria 1996
48 Ga0157370_10269026 3300013104 Bacteria 1575
49 Ga0157369_10000285 3300013105 Bacteria 67687
50 Ga0157369_10009378 3300013105 Bacteria 11190
51 Ga0163162_10000073 3300013306 Bacteria 91871
52 Ga0157375_10002227 3300013308 Bacteria 16785
53 Ga0157375_10231075 3300013308 Bacteria 2009
54 Ga0182008_10000007 3300014497 Bacteria 372461
55 Ga0182008_10000112 3300014497 Bacteria 62174
56 Ga0182008_10000749 3300014497 Bacteria 22858
57 Ga0157376_10161593 3300014969 Bacteria 2031
58 Ga0182006_1000003 3300015261 Bacteria 826681
59 Ga0182006_1000064 3300015261 Bacteria 153418
60 Ga0182006_1000209 3300015261 Bacteria 58193
61 Ga0182006_1000236 3300015261 Bacteria 52217
62 Ga0182006_1003099 3300015261 Bacteria 8716
63 Ga0182006_1033637 3300015261 Bacteria 2054
64 Ga0182007_10000016 3300015262 Bacteria 202375
65 Ga0182007_10012227 3300015262 Bacteria 3310
66 Ga0183373_1011 3300015682 Bacteria 138873
67 Ga0163161_10000768 3300017792 Bacteria 25285
68 Ga0163161_10001065 3300017792 Bacteria 20800
69 Ga0163161_10001282 3300017792 Bacteria 18770
70 Ga0163161_10001714 3300017792 Bacteria 16064
71 Ga0163161_10017849 3300017792 Bacteria 4972
72 Ga0163161_10024897 3300017792 Bacteria 4231
73 Ga0207425_1000003 3300025245 Bacteria 1145342
74 Ga0209129_1000076 3300025258 Bacteria 195353
75 Ga0209675_1000057 3300025291 Bacteria 185467
76 Ga0209676_1000106 3300025292 Bacteria 222576
77 Ga0209025_1000007 3300025294 Bacteria 1145109
78 Ga0209758_1000114 3300025297 Bacteria 199324
79 Ga0209050_1000174 3300025298 Bacteria 148871
80 Ga0207655_1000013 3300025728 Bacteria 637510
81 Ga0207655_1058836 3300025728 Bacteria 1499
82 Ga0207671_10005203 3300025914 Bacteria 12094
83 Ga0207657_10119786 3300025919 Bacteria 2166
84 Ga0207709_10000400 3300025935 Bacteria 42510
85 Ga0307405_10000023 3300031731 Bacteria 141450
86 Ga0307407_10000059 3300031903 Bacteria 48015
87 Ga0307412_10000017 3300031911 Bacteria 294698
88 Ga0307412_10000079 3300031911 Bacteria 94863
89 Ga0307412_10000578 3300031911 Bacteria 21731
90 Ga0307412_10107243 3300031911 Bacteria 1988
91 Ga0307409_100079402 3300031995 Bacteria 2644
92 Ga0307416_100000031 3300032002 Bacteria 159059
93 Ga0307416_100000116 3300032002 Bacteria 47978
94 Ga0307414_10000004 3300032004 Bacteria 472218
95 Ga0307414_10000805 3300032004 Bacteria 16049
96 Ga0307414_10006891 3300032004 Bacteria 6361
97 Ga0307414_10027353 3300032004 Bacteria 3684
98 Ga0307414_10089103 3300032004 Bacteria 2285
99 Ga0307414_10206174 3300032004 Bacteria 1603
100 Ga0307414_10278714 3300032004 Bacteria 1404
101 Ga0439465_0001374 3300041413 Bacteria 7848
102 Ga0495627_000002 3300046453 Bacteria 903861
103 Ga0495590_0001404 3300046457 Bacteria 10460
104 Ga0495606_0007057 3300046507 Bacteria 10173
105 Ga0495606_0027411 3300046507 Bacteria 4041
106 Ga0495610_0000006 3300046512 Bacteria 856822
107 Ga0495610_0000098 3300046512 Bacteria 101620
108 Ga0495610_0000119 3300046512 Bacteria 89692
109 Ga0495632_0007190 3300046519 Bacteria 7036
110 Ga0495663_0000064 3300046525 Bacteria 49767
111 Ga0495654_0000006 3300046530 Bacteria 451432
112 Ga0495609_0000047 3300046538 Bacteria 156247
113 Ga0495633_0000003 3300046558 Bacteria 472476
114 Ga0495633_0000884 3300046558 Bacteria 25757
115 Ga0495633_0114582 3300046558 Bacteria 1249
116 Ga0495625_0000532 3300046660 Bacteria 56088
117 Ga0495686_0002350 3300047472 Bacteria 18040
118 Ga0496102_0032902 3300048905 Bacteria 4660
119 Ga0496113_0068698 3300048916 Bacteria 2689
120 Ga0496116_0000006 3300048919 Bacteria 811937
121 Ga0496117_0000200 3300048920 Bacteria 118143
122 Ga0496118_0000244 3300048921 Bacteria 96301
123 Ga0496118_0038414 3300048921 Bacteria 3838
124 Ga0496119_0000108 3300048922 Bacteria 116616
125 Ga0496121_0289478 3300048924 Bacteria 1117
126 Ga0496122_0000345 3300048925 Bacteria 100238
127 Ga0496122_0000346 3300048925 Bacteria 100205
128 Ga0496122_0000837 3300048925 Bacteria 58147
129 Ga0496122_0000857 3300048925 Bacteria 57236
130 Ga0496122_0003252 3300048925 Bacteria 21563
131 Ga0496122_0016857 3300048925 Bacteria 6874
132 Ga0496123_0002133 3300048926 Bacteria 25303
133 Ga0496123_0004031 3300048926 Bacteria 15846
134 Ga0496123_0026257 3300048926 Bacteria 4368
135 Ga0496124_0003238 3300048927 Bacteria 20101
136 Ga0496125_0001430 3300048928 Bacteria 34814
137 Ga0496125_0002741 3300048928 Bacteria 22291
138 Ga0496125_0014169 3300048928 Bacteria 7776
139 Ga0496125_0192021 3300048928 Bacteria 1347
140 Ga0496126_0001354 3300048929 Bacteria 38854
141 Ga0496126_0166004 3300048929 Bacteria 1884
142 Ga0496126_0188687 3300048929 Bacteria 1747
143 Ga0501249_004614 3300049679 Bacteria 2800
144 Ga0501241_000021 3300049758 Bacteria 82723
145 Ga0501241_003215 3300049758 Bacteria 3099
146 Ga0501269_001757 3300049766 Bacteria 2761
147 Ga0500651_0004796 3300053093 Bacteria 7627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0192021 Ga0496125_0192021_511_1335 273
2 3300046512 Ga0495610_0000119 Ga0495610_0000119_23793_24704 302
3 3300013100 Ga0157373_10000004 Ga0157373_10000004169 308
4 iso_pu_bacteria 2751185877 2753670666 313
5 iso_pu_bacteria 2511231000 2511232982 315
6 iso_pu_bacteria 2582581281 2585159576 315
7 iso_pu_bacteria 2582581282 2585163833 315
8 iso_pu_bacteria 2585428061 2587751100 315
9 iso_pu_bacteria 2585428095 2587865302 315
10 iso_pu_bacteria 2585428187 2588231360 315
11 iso_pu_bacteria 2842083920 2842088182 315
12 iso_pu_bacteria 2945924605 2945926228 315
13 iso_pu_bacteria 2993372514 2993374430 315
14 iso_pu_bacteria 2993480792 2993481318 315
15 iso_pu_bacteria 2523533629 2524006810 316
16 iso_pu_bacteria 2582581278 2585143911 316
17 iso_pu_bacteria 2585428045 2587678114 316
18 iso_pu_bacteria 2585428060 2587745827 316
19 iso_pu_bacteria 2585428115 2587944161 316
20 iso_pu_bacteria 2585428182 2588210024 316
21 iso_pu_bacteria 2585428183 2588214794 316
22 iso_pu_bacteria 2585428184 2588218023 316
23 iso_pu_bacteria 2585428185 2588222780 316
24 iso_pu_bacteria 2588253712 2588444430 316
25 iso_pu_bacteria 2588254255 2590602720 316
26 iso_pu_bacteria 2588254257 2590613190 316
27 iso_pu_bacteria 2728369107 2729199746 316
28 iso_pu_bacteria 2738541283 2738758868 316
29 iso_pu_bacteria 2738541302 2738856722 316
30 iso_pu_bacteria 2739367651 2739587416 316
31 iso_pu_bacteria 2739367663 2739646610 316
32 iso_pu_bacteria 2739367874 2740058769 316
33 iso_pu_bacteria 2765235839 2765573906 316
34 iso_pu_bacteria 2775506739 2775672171 316
35 iso_pu_bacteria 2816332188 2816874143 316
36 iso_pu_bacteria 2818991437 2819550253 316
37 iso_pu_bacteria 2849281842 2849285035 316
38 iso_pu_bacteria 2871720351 2871720489 316
39 iso_pu_bacteria 2889290771 2889295593 316
40 iso_pu_bacteria 2905999023 2906002920 316
41 iso_pu_bacteria 2919097161 2919099223 316
42 iso_pu_bacteria 2919399522 2919401015 316
43 iso_pu_bacteria 2945997725 2946002815 316
44 iso_pu_bacteria 2946019816 2946022409 316
45 iso_pu_bacteria 2954016120 2954019687 316
46 iso_pu_bacteria 2977243572 2977245200 316
47 3300002773 JGI25152J39213_1000345 JGI25152J39213_100034518 317
48 3300002774 JGI25150J39212_1000011 JGI25150J39212_100001145 317
49 3300003187 JGI25151J46595_10000033 JGI25151J46595_1000003345 317
50 3300003215 JGI25153J46596_10000052 JGI25153J46596_1000005280 317
51 3300003781 Ga0055536_1000016 Ga0055536_1000016117 317
52 3300003791 Ga0055530_10007372 Ga0055530_100073722 317
53 3300005288 Ga0065714_10067891 Ga0065714_100678915 317
54 3300005563 Ga0068855_100337269 Ga0068855_1003372692 317
55 3300009036 Ga0105244_10068810 Ga0105244_100688102 317
56 3300013100 Ga0157373_10010806 Ga0157373_100108065 317
57 3300013102 Ga0157371_10000503 Ga0157371_1000050341 317
58 3300013104 Ga0157370_10144513 Ga0157370_101445131 317
59 3300013105 Ga0157369_10000285 Ga0157369_1000028567 317
60 3300013306 Ga0163162_10000073 Ga0163162_1000007346 317
61 3300013308 Ga0157375_10231075 Ga0157375_102310752 317
62 3300014497 Ga0182008_10000749 Ga0182008_100007499 317
63 3300015261 Ga0182006_1000064 Ga0182006_100006466 317
64 3300015261 Ga0182006_1000209 Ga0182006_100020942 317
65 3300015262 Ga0182007_10000016 Ga0182007_1000001699 317
66 3300015682 Ga0183373_1011 Ga0183373_101164 317
67 3300017792 Ga0163161_10001065 Ga0163161_100010657 317
68 3300017792 Ga0163161_10001282 Ga0163161_100012825 317
69 3300017792 Ga0163161_10024897 Ga0163161_100248973 317
70 3300025245 Ga0207425_1000003 Ga0207425_1000003875 317
71 3300025258 Ga0209129_1000076 Ga0209129_100007643 317
72 3300025292 Ga0209676_1000106 Ga0209676_100010687 317
73 3300025294 Ga0209025_1000007 Ga0209025_1000007874 317
74 3300025297 Ga0209758_1000114 Ga0209758_1000114124 317
75 3300025298 Ga0209050_1000174 Ga0209050_100017471 317
76 3300025728 Ga0207655_1058836 Ga0207655_10588361 317
77 3300031731 Ga0307405_10000023 Ga0307405_1000002389 317
78 3300031903 Ga0307407_10000059 Ga0307407_1000005936 317
79 3300031995 Ga0307409_100079402 Ga0307409_1000794022 317
80 3300032002 Ga0307416_100000116 Ga0307416_10000011636 317
81 3300032004 Ga0307414_10006891 Ga0307414_100068914 317
82 3300046507 Ga0495606_0027411 Ga0495606_0027411_878_1846 317
83 3300046512 Ga0495610_0000098 Ga0495610_0000098_32369_33337 317
84 3300046558 Ga0495633_0114582 Ga0495633_0114582_240_1208 317
85 3300049679 Ga0501249_004614 Ga0501249_004614_316_1281 317
86 iso_pu_bacteria 2585427687 2586209443 317
87 iso_pu_bacteria 2842722452 2842726859 317
88 iso_pu_bacteria 2842909656 2842911702 317
89 iso_pu_bacteria 2904445276 2904448850 317
90 3300025919 Ga0207657_10119786 Ga0207657_101197862 318
91 iso_pu_bacteria 2739367656 2739614432 318
92 iso_pu_bacteria 2857627736 2857631615 318
93 iso_pu_bacteria 2898713307 2898715583 318
94 3300005288 Ga0065714_10072747 Ga0065714_100727473 319
95 3300005288 Ga0065714_10104694 Ga0065714_101046941 319
96 3300009092 Ga0105250_10011153 Ga0105250_100111533 319
97 3300013100 Ga0157373_10000424 Ga0157373_1000042416 319
98 3300013100 Ga0157373_10078900 Ga0157373_100789003 319
99 3300013100 Ga0157373_10308816 Ga0157373_103088161 319
100 3300013102 Ga0157371_10000052 Ga0157371_1000005277 319
101 3300013102 Ga0157371_10016903 Ga0157371_100169033 319
102 3300013104 Ga0157370_10000657 Ga0157370_1000065712 319
103 3300013104 Ga0157370_10002291 Ga0157370_1000229111 319
104 3300013104 Ga0157370_10174878 Ga0157370_101748783 319
105 3300013104 Ga0157370_10174879 Ga0157370_101748793 319
106 3300013105 Ga0157369_10009378 Ga0157369_100093789 319
107 3300013308 Ga0157375_10002227 Ga0157375_100022278 319
108 3300014497 Ga0182008_10000007 Ga0182008_10000007160 319
109 3300015261 Ga0182006_1000003 Ga0182006_100000347 319
110 3300031911 Ga0307412_10000079 Ga0307412_1000007919 319
111 3300032002 Ga0307416_100000031 Ga0307416_100000031147 319
112 3300032004 Ga0307414_10000805 Ga0307414_100008055 319
113 3300032004 Ga0307414_10027353 Ga0307414_100273532 319
114 3300032004 Ga0307414_10278714 Ga0307414_102787142 319
115 3300046457 Ga0495590_0001404 Ga0495590_0001404_557_1522 319
116 3300046512 Ga0495610_0000006 Ga0495610_0000006_815141_816103 319
117 3300046519 Ga0495632_0007190 Ga0495632_0007190_1519_2481 319
118 3300046525 Ga0495663_0000064 Ga0495663_0000064_11716_12678 319
119 3300046538 Ga0495609_0000047 Ga0495609_0000047_132037_132999 319
120 3300046558 Ga0495633_0000884 Ga0495633_0000884_995_1957 319
121 3300046660 Ga0495625_0000532 Ga0495625_0000532_28317_29279 319
122 3300048928 Ga0496125_0014169 Ga0496125_0014169_866_1828 319
123 2162886007 SwRhRL2b_contig_308855 SwRhRL2b_0039.00003850 320
124 3300003784 Ga0055534_1009724 Ga0055534_10097242 320
125 3300005289 Ga0065704_10078449 Ga0065704_100784493 320
126 3300005289 Ga0065704_10097602 Ga0065704_100976021 320
127 3300005337 Ga0070682_100000228 Ga0070682_10000022820 320
128 3300005339 Ga0070660_100062180 Ga0070660_1000621802 320
129 3300009036 Ga0105244_10000001 Ga0105244_1000000188 320
130 3300009148 Ga0105243_10000114 Ga0105243_1000011418 320
131 3300009148 Ga0105243_10090186 Ga0105243_100901863 320
132 3300009545 Ga0105237_10001570 Ga0105237_1000157019 320
133 3300013104 Ga0157370_10000084 Ga0157370_1000008446 320
134 3300013104 Ga0157370_10021843 Ga0157370_100218435 320
135 3300014497 Ga0182008_10000112 Ga0182008_1000011212 320
136 3300015261 Ga0182006_1000236 Ga0182006_100023628 320
137 3300017792 Ga0163161_10001714 Ga0163161_1000171416 320
138 3300017792 Ga0163161_10017849 Ga0163161_100178492 320
139 3300025291 Ga0209675_1000057 Ga0209675_1000057138 320
140 3300025728 Ga0207655_1000013 Ga0207655_1000013214 320
141 3300025914 Ga0207671_10005203 Ga0207671_100052033 320
142 3300025935 Ga0207709_10000400 Ga0207709_1000040012 320
143 3300031911 Ga0307412_10000578 Ga0307412_100005789 320
144 3300032004 Ga0307414_10000004 Ga0307414_10000004280 320
145 3300032004 Ga0307414_10206174 Ga0307414_102061742 320
146 3300041413 Ga0439465_0001374 Ga0439465_0001374_4245_5210 320
147 3300046453 Ga0495627_000002 Ga0495627_000002_613039_614010 320
148 3300046507 Ga0495606_0007057 Ga0495606_0007057_1108_2073 320
149 3300046530 Ga0495654_0000006 Ga0495654_0000006_367349_368320 320
150 3300046558 Ga0495633_0000003 Ga0495633_0000003_119530_120498 320
151 3300047472 Ga0495686_0002350 Ga0495686_0002350_13995_14966 320
152 3300048905 Ga0496102_0032902 Ga0496102_0032902_1391_2359 320
153 3300048916 Ga0496113_0068698 Ga0496113_0068698_396_1364 320
154 3300048919 Ga0496116_0000006 Ga0496116_0000006_393632_394600 320
155 3300048920 Ga0496117_0000200 Ga0496117_0000200_28282_29250 320
156 3300048921 Ga0496118_0000244 Ga0496118_0000244_23380_24348 320
157 3300048921 Ga0496118_0038414 Ga0496118_0038414_1328_2293 320
158 3300048922 Ga0496119_0000108 Ga0496119_0000108_87367_88335 320
159 3300048925 Ga0496122_0000345 Ga0496122_0000345_84743_85723 320
160 3300048925 Ga0496122_0000346 Ga0496122_0000346_11794_12762 320
161 3300048925 Ga0496122_0000837 Ga0496122_0000837_31292_32257 320
162 3300048925 Ga0496122_0000857 Ga0496122_0000857_29613_30587 320
163 3300048925 Ga0496122_0003252 Ga0496122_0003252_79_1044 320
164 3300048925 Ga0496122_0016857 Ga0496122_0016857_2313_3290 320
165 3300048926 Ga0496123_0002133 Ga0496123_0002133_3992_4960 320
166 3300048926 Ga0496123_0004031 Ga0496123_0004031_1790_2764 320
167 3300048926 Ga0496123_0026257 Ga0496123_0026257_2049_3014 320
168 3300048927 Ga0496124_0003238 Ga0496124_0003238_6677_7645 320
169 3300048928 Ga0496125_0001430 Ga0496125_0001430_13306_14271 320
170 3300048928 Ga0496125_0002741 Ga0496125_0002741_11836_12804 320
171 3300048929 Ga0496126_0001354 Ga0496126_0001354_22538_23503 320
172 3300048929 Ga0496126_0166004 Ga0496126_0166004_136_1107 320
173 3300048929 Ga0496126_0188687 Ga0496126_0188687_277_1242 320
174 3300049758 Ga0501241_000021 Ga0501241_000021_61163_62131 320
175 3300049766 Ga0501269_001757 Ga0501269_001757_754_1722 320
176 iso_pu_bacteria 2772190705 2772603449 320
177 iso_pu_bacteria 8055588893 8055591042 320
178 2162886007 SwRhRL2b_contig_2461477 SwRhRL2b_0068.00004250 321
179 2162886007 SwRhRL2b_contig_466296 SwRhRL2b_0870.00004090 321
180 3300005288 Ga0065714_10001936 Ga0065714_1000193630 321
181 3300005289 Ga0065704_10000199 Ga0065704_10000199104 321
182 3300005289 Ga0065704_10085800 Ga0065704_100858002 321
183 3300005365 Ga0070688_100048511 Ga0070688_1000485112 321
184 3300013100 Ga0157373_10000015 Ga0157373_10000015147 321
185 3300013100 Ga0157373_10159933 Ga0157373_101599331 321
186 3300013102 Ga0157371_10000542 Ga0157371_100005422 321
187 3300013102 Ga0157371_10000684 Ga0157371_1000068427 321
188 3300013104 Ga0157370_10269026 Ga0157370_102690262 321
189 3300014969 Ga0157376_10161593 Ga0157376_101615932 321
190 3300015261 Ga0182006_1003099 Ga0182006_10030997 321
191 3300015261 Ga0182006_1033637 Ga0182006_10336372 321
192 3300015262 Ga0182007_10012227 Ga0182007_100122273 321
193 3300017792 Ga0163161_10000768 Ga0163161_100007682 321
194 3300031911 Ga0307412_10000017 Ga0307412_10000017170 321
195 3300031911 Ga0307412_10107243 Ga0307412_101072433 321
196 3300032004 Ga0307414_10089103 Ga0307414_100891032 321
197 3300048924 Ga0496121_0289478 Ga0496121_0289478_92_1072 321
198 3300049758 Ga0501241_003215 Ga0501241_003215_380_1345 321
199 3300053093 Ga0500651_0004796 Ga0500651_0004796_6602_7567 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

11

292

0.97

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

162

237

0.95

PF00890

FAD_binding_2

FAD binding domain

9

48

0.93

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

43

199

0.81

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

8

307

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eeg-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to dopamine 0.9832 5 35
4mig-assembly1.cif.gz_C pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9813 4 35
8eef-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to octopamine 0.9805 5 35
4mig-assembly1.cif.gz_A pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9798 4 35
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.9531 4 35
ID Description Score Start End Superfamily
af_O60112_6_422_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9516 4 35 3.30.300.30
3gpiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9417 4 32 3.40.50.720
af_Q2FYF3_1_146_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9339 1 146 3.50.50.60
af_Q2FYF3_156_325_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9297 157 320 3.50.50.60
af_Q2FYF3_1_146_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9279 1 146 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3M1KW72-F1-model_v4 YpdA family putative bacillithiol disulfide reductase 0.9591 1 253 GO:0004497
GO:0050660
AF-A0A7Y5LTN9-F1-model_v4 YpdA family putative bacillithiol disulfide reductase 0.9547 2 253 GO:0016491
AF-A0A2S1QD44-F1-model_v4 YpdA family putative bacillithiol disulfide reductase 0.9539 2 321 GO:0016491
AF-A0A7C5R3F2-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9518 95 320 GO:0016491
AF-A0A3M1KW72-F1-model_v4 YpdA family putative bacillithiol disulfide reductase 0.9518 1 253 GO:0004497
GO:0050660

Feature Viewer

pLDDT pTM Quality
84.64 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map