F305194

General Info

Members Datasets Scaffolds Average Seq Length
198 152 396 262

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990088156|2990093223
Length 276
Sequence FPLPVRSDLMTSASTHPDHHRISPVFLGLAAIMAVSGWAVWSGLAEVTGVAVFFFVVSGWIVSLCLHEYAHARAALRSGDESVAAKGYLTLNPLKYTHAMLSIVLPVIFVVLGGIGLPGGAVYIERGRIRGRWKHSLISAAGPLTNALFAAILTAPFWLGAMADVPFAFRYALAFLAMLQVTAAILNLLPVPGLDGYGVLEPWLSPAARRQAEPFAPFGLLVVFGCLWIPAVNAVFWDSIGNVMQVLDVTDLDIGYGYDYFRFWQGEPELSVTPLP

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
4 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
6 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
7 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
8 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
9 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
10 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
11 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
12 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
13 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
14 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
15 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
16 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
17 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
18 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
19 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
20 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
21 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
22 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
23 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
24 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
25 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
26 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
27 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
28 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
29 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
30 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
31 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
32 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
33 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
34 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
35 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
36 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
37 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
38 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
39 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
40 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
41 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
42 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
43 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
46 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
47 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
48 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
49 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
50 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
51 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
52 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
53 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
54 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
55 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
58 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
59 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
60 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
64 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
65 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
66 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
67 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
68 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
69 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
73 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
79 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
82 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
83 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
106 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
109 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
110 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
111 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
112 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
115 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
116 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
117 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
118 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
119 2643221578 Streptomyces sp. Root63 Isolate Unclassified
120 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
121 2643221714 Streptomyces sp. Root264 Isolate Unclassified
122 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
123 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
124 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
125 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
126 2808606448 Streptomyces sp. 193411 Isolate Unclassified
127 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
128 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
129 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
130 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
131 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
132 2862574272 Streptomyces sp. AcE210 Isolate Nodule
133 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
134 2867369537 Streptomyces sp. Z26 Isolate Unclassified
135 2867475112 Streptomyces sp. TM32 Isolate Unclassified
136 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
137 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
138 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
139 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
140 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
141 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
142 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
143 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
144 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
145 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
146 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
147 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
148 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
149 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
150 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
151 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
152 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.8
Metatranscriptomes 0.51
Isolates 19.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 1.52
Rhizoplane 1.01
Rhizosphere 73.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10026470 3300003316 Bacteria 2430
2 rootL2_10153224 3300003322 Bacteria 2050
3 Ga0068853_100077121 3300005539 Bacteria 2911
4 Ga0081455_10083657 3300005937 Bacteria 2607
5 Ga0075363_100083220 3300006048 Bacteria 1753
6 Ga0075370_10292081 3300006353 Bacteria 969
7 Ga0105243_10304557 3300009148 Bacteria 1445
8 Ga0183367_1009 3300015688 Bacteria 484598
9 Ga0209758_1004264 3300025297 Bacteria 12083
10 Ga0207426_1001691 3300025302 Bacteria 17029
11 Ga0307517_10052323 3300028786 Bacteria 4096
12 Ga0307515_10000140 3300028794 Bacteria 172330
13 Ga0307515_10085633 3300028794 Bacteria 4029
14 Ga0307511_10004554 3300030521 Bacteria 14136
15 Ga0307512_10158492 3300030522 Bacteria 1333
16 Ga0307513_10013159 3300031456 Bacteria 10166
17 Ga0307509_10024082 3300031507 Bacteria 6822
18 Ga0307509_10035978 3300031507 Bacteria 5427
19 Ga0307509_10078237 3300031507 Bacteria 3427
20 Ga0307508_10049164 3300031616 Bacteria 3755
21 Ga0307514_10050473 3300031649 Bacteria 3228
22 Ga0307516_10016029 3300031730 Bacteria 7857
23 Ga0307516_10034395 3300031730 Bacteria 5092
24 Ga0307413_10374249 3300031824 Bacteria 1107
25 Ga0307518_10064863 3300031838 Bacteria 2650
26 Ga0307518_10119428 3300031838 Bacteria 1867
27 Ga0307510_10112598 3300033180 Bacteria 2457
28 Ga0395900_0454715 3300037418 Bacteria 1236
29 Ga0395898_0002712 3300037466 Bacteria 20438
30 Ga0395898_0135816 3300037466 Bacteria 2355
31 Ga0395901_0583043 3300038443 Bacteria 1130
32 Ga0439439_0040171 3300041406 Bacteria 1210
33 Ga0451795_1693421 3300041456 Bacteria 1037
34 Ga0451835_0220789 3300041492 Bacteria 1002
35 Ga0451853_0107251 3300041512 Bacteria 7153
36 Ga0451853_0194090 3300041512 Bacteria 3407
37 Ga0451853_3347791 3300041512 Bacteria 2479
38 Ga0439449_0026982 3300042007 Bacteria 2143
39 Ga0439449_0072248 3300042007 Bacteria 1271
40 Ga0439449_0119400 3300042007 Bacteria 978
41 Ga0439457_001761 3300042014 Bacteria 6405
42 Ga0439457_005574 3300042014 Bacteria 3150
43 Ga0439457_024605 3300042014 Bacteria 1332
44 Ga0450894_000346 3300042131 Bacteria 8184
45 Ga0450898_003930 3300042134 Bacteria 2167
46 Ga0450899_000173 3300042135 Bacteria 6431
47 Ga0450906_000318 3300042145 Bacteria 9746
48 Ga0466969_0027050 3300044656 Bacteria 2939
49 Ga0466972_0010182 3300044658 Bacteria 4724
50 Ga0466965_0037728 3300044683 Bacteria 2373
51 Ga0466965_0042692 3300044683 Bacteria 2238
52 Ga0466966_0048359 3300044684 Bacteria 2709
53 Ga0466961_0026099 3300044693 Bacteria 3756
54 Ga0466963_0000322 3300044694 Bacteria 21659
55 Ga0466964_0058072 3300044706 Bacteria 1603
56 Ga0466971_0011436 3300044719 Bacteria 3888
57 Ga0466971_0062866 3300044719 Bacteria 1680
58 Ga0466971_0195024 3300044719 Bacteria 955
59 Ga0466959_0258752 3300045049 Bacteria 1198
60 Ga0466967_0094618 3300045976 Bacteria 2721
61 Ga0466967_0307364 3300045976 Bacteria 1527
62 Ga0495617_011633 3300046452 Bacteria 3000
63 Ga0495592_0010074 3300046454 Bacteria 7118
64 Ga0495603_0011303 3300046455 Bacteria 5408
65 Ga0495590_0030641 3300046457 Bacteria 1885
66 Ga0495629_0057267 3300046459 Bacteria 2726
67 Ga0495638_0126751 3300046460 Bacteria 1504
68 Ga0495638_0203152 3300046460 Bacteria 1117
69 Ga0495651_0078096 3300046462 Bacteria 2504
70 Ga0495582_0127254 3300046473 Bacteria 1438
71 Ga0495662_0001168 3300046476 Bacteria 12945
72 Ga0495662_0003688 3300046476 Bacteria 7723
73 Ga0495585_0069759 3300046492 Bacteria 1918
74 Ga0495594_0012767 3300046499 Bacteria 4382
75 Ga0495594_0038844 3300046499 Bacteria 2601
76 Ga0495594_0071470 3300046499 Bacteria 1930
77 Ga0495607_0079089 3300046501 Bacteria 1812
78 Ga0495583_0122146 3300046506 Bacteria 1095
79 Ga0495628_0028981 3300046516 Bacteria 4493
80 Ga0495642_0144131 3300046528 Bacteria 1029
81 Ga0495652_0057482 3300046529 Bacteria 3298
82 Ga0495654_0032488 3300046530 Bacteria 2646
83 Ga0495609_0017437 3300046538 Bacteria 3334
84 Ga0495611_0070851 3300046648 Bacteria 1593
85 Ga0495611_0224374 3300046648 Bacteria 874
86 Ga0495625_0009734 3300046660 Bacteria 8001
87 Ga0495625_0135987 3300046660 Bacteria 1661
88 Ga0495635_0008745 3300046663 Bacteria 7070
89 Ga0495635_0033649 3300046663 Bacteria 3555
90 Ga0495588_0000972 3300046674 Bacteria 12533
91 Ga0495588_0079712 3300046674 Bacteria 1708
92 Ga0495657_0005704 3300046675 Bacteria 9804
93 Ga0495623_0043667 3300046679 Bacteria 2851
94 Ga0495613_0015518 3300046689 Bacteria 5664
95 Ga0495613_0060293 3300046689 Bacteria 2779
96 Ga0495613_0067156 3300046689 Bacteria 2617
97 Ga0495670_0034702 3300046691 Bacteria 2514
98 Ga0495670_0139939 3300046691 Bacteria 1265
99 Ga0495589_0002680 3300046794 Bacteria 9844
100 Ga0495660_0025843 3300046810 Bacteria 3332
101 Ga0495604_0121651 3300047317 Bacteria 1888
102 Ga0495636_0010444 3300047318 Bacteria 3667
103 Ga0495636_0045029 3300047318 Bacteria 1838
104 Ga0495636_0052049 3300047318 Bacteria 1717
105 Ga0495636_0058176 3300047318 Bacteria 1629
106 Ga0495676_0031973 3300047321 Bacteria 4445
107 Ga0495680_0005818 3300047322 Bacteria 11542
108 Ga0495683_0013954 3300047323 Bacteria 4189
109 Ga0495683_0035369 3300047323 Bacteria 2538
110 Ga0495687_001537 3300047443 Bacteria 20988
111 Ga0495675_0051813 3300047444 Bacteria 2606
112 Ga0495685_003928 3300047447 Bacteria 4772
113 Ga0495681_0000414 3300047470 Bacteria 32879
114 Ga0495614_0032872 3300048089 Bacteria 2232
115 Ga0496100_0473450 3300048903 Bacteria 963
116 Ga0501323_015604 3300049539 Bacteria 961
117 Ga0501031_0059865 3300049568 Bacteria 2482
118 Ga0501031_0123759 3300049568 Bacteria 1689
119 Ga0501032_0022819 3300049569 Bacteria 4334
120 Ga0501033_0001763 3300049570 Bacteria 18925
121 Ga0501034_0003158 3300049571 Bacteria 18949
122 Ga0501034_0114215 3300049571 Bacteria 2689
123 Ga0501034_0134258 3300049571 Bacteria 2456
124 Ga0501034_0316562 3300049571 Bacteria 1494
125 Ga0501036_0002425 3300049572 Bacteria 14597
126 Ga0501036_0250479 3300049572 Bacteria 1484
127 Ga0501036_0345657 3300049572 Bacteria 1242
128 Ga0501037_0119184 3300049573 Bacteria 1898
129 Ga0501038_0023551 3300049574 Bacteria 5503
130 Ga0501038_0038627 3300049574 Bacteria 4180
131 Ga0501039_0011609 3300049575 Bacteria 6708
132 Ga0501039_0117757 3300049575 Bacteria 2080
133 Ga0501042_0371841 3300049578 Bacteria 1034
134 Ga0501043_0003398 3300049579 Bacteria 13086
135 Ga0501043_0028496 3300049579 Bacteria 4384
136 Ga0501046_0049046 3300049580 Bacteria 3341
137 Ga0501047_0042778 3300049581 Bacteria 4376
138 Ga0501047_0045852 3300049581 Bacteria 4226
139 Ga0501047_0082670 3300049581 Bacteria 3086
140 Ga0501047_0111287 3300049581 Bacteria 2621
141 Ga0501048_0033435 3300049582 Bacteria 3714
142 Ga0501070_0002210 3300049586 Bacteria 17080
143 Ga0501071_0515541 3300049587 Bacteria 917
144 Ga0501073_0124485 3300049589 Bacteria 1787
145 Ga0501080_0340507 3300049742 Bacteria 1355
146 Ga0501035_0001672 3300049822 Bacteria 22429
147 Ga0501035_0192454 3300049822 Bacteria 1753
148 Ga0501044_0000770 3300049823 Bacteria 38854
149 Ga0501044_0228838 3300049823 Bacteria 1807
150 Ga0501044_0274228 3300049823 Bacteria 1621
151 Ga0501045_0255237 3300049824 Bacteria 1305
152 nmdc:mga03n38_26242_c1 3300050490 Bacteria 2404
153 nmdc:mga07m45_281275_c1 3300050496 Bacteria 968
154 Ga0500610_0146222 3300053079 Bacteria 1189
155 Ga0495655_0059596 3300053083 Bacteria 1037
156 Ga0500560_017765 3300053107 Bacteria 1970
157 Ga0500573_0087740 3300053140 Bacteria 1761
158 Ga0500600_0126855 3300053149 Bacteria 1306
159 Ga0501084_0387392 3300054114 Bacteria 1181
160 2990093223 2990088156 Bacteria 6657676
161 2547407686 2547132111 Bacteria 8013147
162 2585311489 2582581313 Bacteria 10042643
163 2616694430 2616644814 Bacteria 11555299
164 2616899563 2616644941 Bacteria 8510691
165 2643897519 2643221578 Bacteria 9213798
166 2644408663 2643221673 Bacteria 9196637
167 2644632203 2643221714 Bacteria 9015452
168 2784587535 2784132148 Bacteria 8627943
169 2785344816 2784746763 Bacteria 9783172
170 2804844574 2802429296 Bacteria 7227771
171 2808919332 2808606375 Bacteria 9466072
172 2809231099 2808606448 Bacteria 8656184
173 2811847752 2808606982 Bacteria 7791042
174 2812481587 2811994917 Bacteria 7761064
175 2819693973 2818991463 Bacteria 7948711
176 2862288531 2862281513 Bacteria 9621493
177 2862383633 2862382967 Bacteria 10317375
178 2862582751 2862574272 Bacteria 10567477
179 2863406042 2863404153 Bacteria 9672205
180 2867370775 2867369537 Bacteria 6501581
181 2867481316 2867475112 Bacteria 6909112
182 2873156886 2873151551 Bacteria 8625867
183 2912759659 2912757875 Bacteria 7940295
184 2935395798 2935390628 Bacteria 7043367
185 2946051232 2946045630 Bacteria 8527308
186 2946074721 2946072368 Bacteria 8999607
187 2954004186 2954002825 Bacteria 9173742
188 2954387664 2954380949 Bacteria 10050426
189 2997456161 2997451912 Bacteria 8492419
190 3006487263 3006486233 Bacteria 8157040
191 3006502006 3006493962 Bacteria 8825450
192 8008562248 8008558824 Bacteria 10610750
193 8023626535 8023623736 Bacteria 8593882
194 8025417142 8025413630 Bacteria 7014048
195 8025479781 8025478263 Bacteria 8209203
196 8025533667 8025530807 Bacteria 8495698
197 8056668777 8056667051 Bacteria 6953971
198 8056836582 8056829672 Bacteria 9045328
199 rootH1_10026470
200 rootL2_10153224
201 Ga0068853_100077121
202 Ga0081455_10083657
203 Ga0075363_100083220
204 Ga0075370_10292081
205 Ga0105243_10304557
206 Ga0183367_1009
207 Ga0209758_1004264
208 Ga0207426_1001691
209 Ga0307517_10052323
210 Ga0307515_10000140
211 Ga0307515_10085633
212 Ga0307511_10004554
213 Ga0307512_10158492
214 Ga0307513_10013159
215 Ga0307509_10024082
216 Ga0307509_10035978
217 Ga0307509_10078237
218 Ga0307508_10049164
219 Ga0307514_10050473
220 Ga0307516_10016029
221 Ga0307516_10034395
222 Ga0307413_10374249
223 Ga0307518_10064863
224 Ga0307518_10119428
225 Ga0307510_10112598
226 Ga0395900_0454715
227 Ga0395898_0002712
228 Ga0395898_0135816
229 Ga0395901_0583043
230 Ga0439439_0040171
231 Ga0451795_1693421
232 Ga0451835_0220789
233 Ga0451853_0107251
234 Ga0451853_0194090
235 Ga0451853_3347791
236 Ga0439449_0026982
237 Ga0439449_0072248
238 Ga0439449_0119400
239 Ga0439457_001761
240 Ga0439457_005574
241 Ga0439457_024605
242 Ga0450894_000346
243 Ga0450898_003930
244 Ga0450899_000173
245 Ga0450906_000318
246 Ga0466969_0027050
247 Ga0466972_0010182
248 Ga0466965_0037728
249 Ga0466965_0042692
250 Ga0466966_0048359
251 Ga0466961_0026099
252 Ga0466963_0000322
253 Ga0466964_0058072
254 Ga0466971_0011436
255 Ga0466971_0062866
256 Ga0466971_0195024
257 Ga0466959_0258752
258 Ga0466967_0094618
259 Ga0466967_0307364
260 Ga0495617_011633
261 Ga0495592_0010074
262 Ga0495603_0011303
263 Ga0495590_0030641
264 Ga0495629_0057267
265 Ga0495638_0126751
266 Ga0495638_0203152
267 Ga0495651_0078096
268 Ga0495582_0127254
269 Ga0495662_0001168
270 Ga0495662_0003688
271 Ga0495585_0069759
272 Ga0495594_0012767
273 Ga0495594_0038844
274 Ga0495594_0071470
275 Ga0495607_0079089
276 Ga0495583_0122146
277 Ga0495628_0028981
278 Ga0495642_0144131
279 Ga0495652_0057482
280 Ga0495654_0032488
281 Ga0495609_0017437
282 Ga0495611_0070851
283 Ga0495611_0224374
284 Ga0495625_0009734
285 Ga0495625_0135987
286 Ga0495635_0008745
287 Ga0495635_0033649
288 Ga0495588_0000972
289 Ga0495588_0079712
290 Ga0495657_0005704
291 Ga0495623_0043667
292 Ga0495613_0015518
293 Ga0495613_0060293
294 Ga0495613_0067156
295 Ga0495670_0034702
296 Ga0495670_0139939
297 Ga0495589_0002680
298 Ga0495660_0025843
299 Ga0495604_0121651
300 Ga0495636_0010444
301 Ga0495636_0045029
302 Ga0495636_0052049
303 Ga0495636_0058176
304 Ga0495676_0031973
305 Ga0495680_0005818
306 Ga0495683_0013954
307 Ga0495683_0035369
308 Ga0495687_001537
309 Ga0495675_0051813
310 Ga0495685_003928
311 Ga0495681_0000414
312 Ga0495614_0032872
313 Ga0496100_0473450
314 Ga0501323_015604
315 Ga0501031_0059865
316 Ga0501031_0123759
317 Ga0501032_0022819
318 Ga0501033_0001763
319 Ga0501034_0003158
320 Ga0501034_0114215
321 Ga0501034_0134258
322 Ga0501034_0316562
323 Ga0501036_0002425
324 Ga0501036_0250479
325 Ga0501036_0345657
326 Ga0501037_0119184
327 Ga0501038_0023551
328 Ga0501038_0038627
329 Ga0501039_0011609
330 Ga0501039_0117757
331 Ga0501042_0371841
332 Ga0501043_0003398
333 Ga0501043_0028496
334 Ga0501046_0049046
335 Ga0501047_0042778
336 Ga0501047_0045852
337 Ga0501047_0082670
338 Ga0501047_0111287
339 Ga0501048_0033435
340 Ga0501070_0002210
341 Ga0501071_0515541
342 Ga0501073_0124485
343 Ga0501080_0340507
344 Ga0501035_0001672
345 Ga0501035_0192454
346 Ga0501044_0000770
347 Ga0501044_0228838
348 Ga0501044_0274228
349 Ga0501045_0255237
350 nmdc:mga03n38_26242_c1
351 nmdc:mga07m45_281275_c1
352 Ga0500610_0146222
353 Ga0495655_0059596
354 Ga0500560_017765
355 Ga0500573_0087740
356 Ga0500600_0126855
357 Ga0501084_0387392
358 2990093223
359 2547407686
360 2585311489
361 2616694430
362 2616899563
363 2643897519
364 2644408663
365 2644632203
366 2784587535
367 2785344816
368 2804844574
369 2808919332
370 2809231099
371 2811847752
372 2812481587
373 2819693973
374 2862288531
375 2862383633
376 2862582751
377 2863406042
378 2867370775
379 2867481316
380 2873156886
381 2912759659
382 2935395798
383 2946051232
384 2946074721
385 2954004186
386 2954387664
387 2997456161
388 3006487263
389 3006502006
390 8008562248
391 8023626535
392 8025417142
393 8025479781
394 8025533667
395 8056668777
396 8056836582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pp5-assembly1.cif.gz_C unitary crystal structure of positively supercharged ferritin variant ftn(pos)-m1 (mg formate condition) 0.4113 47 211
8pp5-assembly1.cif.gz_F unitary crystal structure of positively supercharged ferritin variant ftn(pos)-m1 (mg formate condition) 0.4107 47 211
7a6b-assembly1.cif.gz_A 1.33 a structure of human apoferritin obtained from titan mono- bcor microscope 0.4069 47 208
8pp5-assembly1.cif.gz_B unitary crystal structure of positively supercharged ferritin variant ftn(pos)-m1 (mg formate condition) 0.4066 47 211
6wyf-assembly1.cif.gz_A crystal structure of human h-chain ferritin variant 157c delta c-star modified with a raft agent soaked in an acrylate solution 0.4061 47 208
ID Description Score Start End Superfamily
af_Q54YM8_263_426_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.412 18 227 1.20.1250.20
af_A0A0N7KDT4_322_482_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4036 15 223 1.20.1250.20
af_A0A0N7KDT4_322_482_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4 15 223 1.20.1250.20
af_C0PV55_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3954 52 196 1.20.140.150
af_Q54YM8_263_426_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.391 18 227 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2M9LRH8-F1-model_v4 Site-2 protease family protein 0.9665 3 262 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A5C8QPF4-F1-model_v4 Site-2 protease family protein 0.9656 4 264 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-B5GXH9-F1-model_v4 deleted 0.9652 4 264
AF-E2Q1T8-F1-model_v4 Membrane protein 0.9648 3 264 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A7T7KZM5-F1-model_v4 Site-2 protease family protein 0.9572 1 262 GO:0005886
GO:0006508
GO:0008237
GO:0046872

Map