F305115

General Info

Members Datasets Scaffolds Average Seq Length
198 140 396 134

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_1165083|Ga0501084_1165083_118_579
Length 153
Sequence VHWSECHPHKSIQPKGKEMATKIFVNLPVKNLAKSIEFFTELGFTFNQQFTDETATCMIVTDDIFVMLLTEAKFKAFTPKEICDTKKYTEALVALSLDSRAKVDEMVRKAVSAGGTTYNEAQDHGFMYAHGFQDPDGHIWELIYMEPGAIGQP

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
102 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
103 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2643221621 Achromobacter sp. Root83 Isolate Unclassified
137 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
138 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
139 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
140 2894510363 Methylomonas sp. Kb3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 1.01
Rhizoplane 3.03
Rhizosphere 88.38
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_1165083 3300054114 Unclassified 647
2 rootH1_10142220 3300003316 Bacteria 2313
3 rootL2_10074119 3300003322 Bacteria 3979
4 JGI25405J52794_10031041 3300003911 Bacteria 1109
5 Ga0070676_10070842 3300005328 Bacteria 2093
6 Ga0070677_10065336 3300005333 Bacteria 1514
7 Ga0068869_100886192 3300005334 Bacteria 771
8 Ga0070666_10404952 3300005335 Bacteria 981
9 Ga0070682_100009408 3300005337 Bacteria 5529
10 Ga0070682_100137302 3300005337 Bacteria 1662
11 Ga0070682_100368764 3300005337 Bacteria 1076
12 Ga0070687_100593494 3300005343 Unclassified 760
13 Ga0070692_10154144 3300005345 Bacteria 1311
14 Ga0070668_100240070 3300005347 Bacteria 1501
15 Ga0070668_101119027 3300005347 Bacteria 711
16 Ga0070669_100000063 3300005353 Bacteria 107421
17 Ga0070669_100173093 3300005353 Bacteria 1684
18 Ga0070675_100039454 3300005354 Bacteria 3853
19 Ga0070675_100098842 3300005354 Bacteria 2455
20 Ga0070675_100232848 3300005354 Bacteria 1607
21 Ga0070671_100929996 3300005355 Bacteria 760
22 Ga0070674_100033665 3300005356 Bacteria 3413
23 Ga0070674_100038359 3300005356 Bacteria 3228
24 Ga0070673_100107413 3300005364 Bacteria 2308
25 Ga0070673_100241219 3300005364 Bacteria 1572
26 Ga0070688_100052782 3300005365 Bacteria 2541
27 Ga0070701_10844347 3300005438 Bacteria 628
28 Ga0070701_11101644 3300005438 Bacteria 559
29 Ga0070705_100807062 3300005440 Unclassified 747
30 Ga0070700_100024056 3300005441 Bacteria 3571
31 Ga0070678_100079560 3300005456 Bacteria 2480
32 Ga0070662_100843918 3300005457 Bacteria 780
33 Ga0068867_101081713 3300005459 Unclassified 731
34 Ga0068867_101497861 3300005459 Bacteria 628
35 Ga0070685_10042495 3300005466 Bacteria 2594
36 Ga0070685_10070153 3300005466 Bacteria 2074
37 Ga0070685_10812922 3300005466 Bacteria 690
38 Ga0070672_100044862 3300005543 Bacteria 3416
39 Ga0070672_100282172 3300005543 Bacteria 1404
40 Ga0070686_100221425 3300005544 Bacteria 1368
41 Ga0070686_100891669 3300005544 Bacteria 723
42 Ga0070665_100229361 3300005548 Bacteria 1857
43 Ga0070704_100373685 3300005549 Bacteria 1209
44 Ga0068854_100849775 3300005578 Bacteria 799
45 Ga0070702_100285448 3300005615 Bacteria 1135
46 Ga0070702_100997059 3300005615 Bacteria 663
47 Ga0068864_100723158 3300005618 Bacteria 974
48 Ga0068861_100088744 3300005719 Bacteria 2436
49 Ga0068861_100190536 3300005719 Bacteria 1714
50 Ga0068863_100097396 3300005841 Bacteria 2793
51 Ga0068863_100549322 3300005841 Bacteria 1140
52 Ga0068858_101174947 3300005842 Bacteria 754
53 Ga0068860_100312595 3300005843 Bacteria 1541
54 Ga0068862_100342595 3300005844 Bacteria 1385
55 Ga0068862_101348212 3300005844 Unclassified 716
56 Ga0081455_10003315 3300005937 Bacteria 18615
57 Ga0081455_10077704 3300005937 Unclassified 2729
58 Ga0081539_10017513 3300005985 Bacteria 5025
59 Ga0075366_10003834 3300006195 Bacteria 8009
60 Ga0075366_11067330 3300006195 Bacteria 504
61 Ga0097621_100083070 3300006237 Bacteria 2668
62 Ga0097621_100139540 3300006237 Bacteria 2070
63 Ga0068871_100091126 3300006358 Bacteria 2540
64 Ga0068871_100746305 3300006358 Unclassified 899
65 Ga0075430_100119769 3300006846 Bacteria 2194
66 Ga0075430_100524490 3300006846 Bacteria 977
67 Ga0075431_101426560 3300006847 Bacteria 652
68 Ga0075433_10104552 3300006852 Bacteria 2509
69 Ga0068865_100405262 3300006881 Bacteria 1118
70 Ga0068865_101199819 3300006881 Unclassified 672
71 Ga0097620_101625492 3300006931 Bacteria 714
72 Ga0111539_10100324 3300009094 Unclassified 3400
73 Ga0105243_10433231 3300009148 Bacteria 1229
74 Ga0105242_10117353 3300009176 Bacteria 2278
75 Ga0105238_11606407 3300009551 Bacteria 680
76 Ga0105249_11014613 3300009553 Bacteria 899
77 Ga0105249_11421562 3300009553 Bacteria 766
78 Ga0157374_10119186 3300013296 Bacteria 2546
79 Ga0157378_11271943 3300013297 Bacteria 776
80 Ga0157378_12459485 3300013297 Unclassified 573
81 Ga0163162_10019441 3300013306 Bacteria 6662
82 Ga0157375_10676539 3300013308 Bacteria 1187
83 Ga0157375_12979746 3300013308 Bacteria 565
84 Ga0163163_10538895 3300014325 Bacteria 1230
85 Ga0163163_12139761 3300014325 Unclassified 619
86 Ga0157380_10208176 3300014326 Bacteria 1741
87 Ga0157377_10644813 3300014745 Bacteria 761
88 Ga0157376_10121566 3300014969 Bacteria 2315
89 Ga0157376_10588787 3300014969 Bacteria 1106
90 Ga0157376_11057747 3300014969 Unclassified 836
91 Ga0163161_10067585 3300017792 Bacteria 2610
92 Ga0163161_10195822 3300017792 Bacteria 1555
93 Ga0207682_10019323 3300025893 Bacteria 2667
94 Ga0207645_10092447 3300025907 Bacteria 1946
95 Ga0207681_10000015 3300025923 Bacteria 352892
96 Ga0207681_10078979 3300025923 Bacteria 2317
97 Ga0207650_10528250 3300025925 Bacteria 988
98 Ga0207659_10208323 3300025926 Bacteria 1565
99 Ga0207659_10333395 3300025926 Bacteria 1255
100 Ga0207644_10156700 3300025931 Bacteria 1767
101 Ga0207644_11487947 3300025931 Bacteria 568
102 Ga0207686_10030834 3300025934 Bacteria 3179
103 Ga0207709_10387643 3300025935 Bacteria 1065
104 Ga0207670_10012199 3300025936 Bacteria 5018
105 Ga0207704_10039520 3300025938 Bacteria 2748
106 Ga0207704_10826386 3300025938 Bacteria 775
107 Ga0207691_10050400 3300025940 Bacteria 3812
108 Ga0207691_10059974 3300025940 Bacteria 3459
109 Ga0207711_10905155 3300025941 Bacteria 820
110 Ga0207689_10012194 3300025942 Bacteria 7353
111 Ga0207689_10127160 3300025942 Bacteria 2096
112 Ga0207651_10021906 3300025960 Bacteria 3894
113 Ga0207712_10847400 3300025961 Bacteria 805
114 Ga0207677_10170510 3300026023 Bacteria 1701
115 Ga0207708_10216282 3300026075 Bacteria 1533
116 Ga0207648_10472235 3300026089 Bacteria 1145
117 Ga0207648_11277627 3300026089 Bacteria 690
118 Ga0207675_100032135 3300026118 Bacteria 4890
119 Ga0207675_100137698 3300026118 Bacteria 2318
120 Ga0207675_101020481 3300026118 Bacteria 846
121 Ga0207683_10058243 3300026121 Bacteria 3392
122 Ga0209966_1168314 3300027695 Unclassified 513
123 Ga0207428_10018125 3300027907 Bacteria 6023
124 Ga0268266_10145843 3300028379 Bacteria 2128
125 Ga0268264_10212519 3300028381 Bacteria 1777
126 Ga0307513_10057767 3300031456 Bacteria 4130
127 Ga0307513_10164481 3300031456 Bacteria 2105
128 Ga0307513_10705328 3300031456 Bacteria 715
129 Ga0307509_10028702 3300031507 Bacteria 6183
130 Ga0307509_10073471 3300031507 Bacteria 3560
131 Ga0307509_10520496 3300031507 Bacteria 871
132 Ga0307408_101801010 3300031548 Bacteria 585
133 Ga0307413_10004407 3300031824 Bacteria 6122
134 Ga0307413_10254916 3300031824 Bacteria 1304
135 Ga0307407_10346742 3300031903 Bacteria 1050
136 Ga0307412_10395898 3300031911 Bacteria 1123
137 Ga0307409_100026254 3300031995 Bacteria 4104
138 Ga0307409_101349164 3300031995 Bacteria 739
139 Ga0307409_101668715 3300031995 Bacteria 666
140 Ga0307416_100872148 3300032002 Bacteria 999
141 Ga0307416_101581268 3300032002 Bacteria 761
142 Ga0307416_102840380 3300032002 Bacteria 579
143 Ga0307411_10774331 3300032005 Bacteria 843
144 Ga0307415_100374886 3300032126 Bacteria 1206
145 Ga0373931_1112192 3300035691 Bacteria 538
146 Ga0451787_475054 3300041441 Bacteria 1531
147 Ga0451800_1147039 3300041459 Bacteria 4301
148 Ga0451804_0451585 3300041463 Bacteria 1113
149 Ga0451804_0984718 3300041463 Bacteria 842
150 Ga0451807_1708769 3300041486 Bacteria 2555
151 Ga0451839_0774253 3300041496 Bacteria 652
152 Ga0439433_0051000 3300041999 Bacteria 976
153 Ga0495590_0008205 3300046457 Bacteria 3996
154 Ga0495638_0026060 3300046460 Bacteria 3794
155 Ga0495638_0080090 3300046460 Bacteria 1985
156 Ga0495638_0281775 3300046460 Bacteria 903
157 Ga0495584_0570160 3300046491 Bacteria 577
158 Ga0495616_0021831 3300046513 Bacteria 3461
159 Ga0495632_0191467 3300046519 Bacteria 934
160 Ga0495668_0082478 3300046616 Bacteria 1764
161 Ga0495625_0052313 3300046660 Bacteria 2925
162 Ga0495625_0118386 3300046660 Bacteria 1804
163 Ga0495649_0310171 3300046694 Bacteria 802
164 Ga0495686_0095012 3300047472 Bacteria 1806
165 Ga0495686_0230547 3300047472 Bacteria 1049
166 Ga0496108_0294296 3300048911 Bacteria 1414
167 Ga0495682_0136584 3300049460 Bacteria 876
168 Ga0501031_0364838 3300049568 Bacteria 935
169 Ga0501036_1549567 3300049572 Bacteria 536
170 Ga0501067_0004484 3300049583 Bacteria 7701
171 Ga0501068_0022958 3300049584 Bacteria 3653
172 Ga0501069_0196041 3300049585 Bacteria 1169
173 Ga0501071_0005176 3300049587 Bacteria 8357
174 Ga0501071_1539999 3300049587 Bacteria 513
175 Ga0501072_0206942 3300049588 Bacteria 1564
176 Ga0501073_0002885 3300049589 Bacteria 12883
177 Ga0501074_0005962 3300049590 Bacteria 8790
178 Ga0501075_0398679 3300049591 Bacteria 1049
179 Ga0501076_0021717 3300049592 Bacteria 4927
180 Ga0501077_0027402 3300049593 Bacteria 3618
181 Ga0501077_0369586 3300049593 Unclassified 916
182 Ga0501079_0005678 3300049741 Bacteria 9315
183 Ga0501080_0003706 3300049742 Bacteria 13481
184 Ga0501083_0062113 3300049744 Bacteria 2493
185 nmdc:mga0k408_638_c1 3300050493 Bacteria 19317
186 nmdc:mga05p37_1134506_c1 3300050507 Unclassified 815
187 nmdc:mga0qj67_106569_c1 3300050509 Bacteria 2261
188 nmdc:mga06r32_1061255_c1 3300050510 Bacteria 760
189 nmdc:mga06r32_1419237_c1 3300050510 Bacteria 636
190 Ga0501084_0008484 3300054114 Bacteria 8498
191 Ga0590071_001593 3300059421 Bacteria 5947
192 Ga0501082_0056435 3300060353 Bacteria 3383
193 Ga0530510_0117931 3300061734 Bacteria 1947
194 2644120194 2643221621 Bacteria 6212786
195 2841915679 2841911363 Bacteria 6173697
196 2841920881 2841917233 Bacteria 6173500
197 2857538851 2857537821 Bacteria 5248181
198 2894514226 2894510363 Bacteria 5121143
199 Ga0501084_1165083
200 rootH1_10142220
201 rootL2_10074119
202 JGI25405J52794_10031041
203 Ga0070676_10070842
204 Ga0070677_10065336
205 Ga0068869_100886192
206 Ga0070666_10404952
207 Ga0070682_100009408
208 Ga0070682_100137302
209 Ga0070682_100368764
210 Ga0070687_100593494
211 Ga0070692_10154144
212 Ga0070668_100240070
213 Ga0070668_101119027
214 Ga0070669_100000063
215 Ga0070669_100173093
216 Ga0070675_100039454
217 Ga0070675_100098842
218 Ga0070675_100232848
219 Ga0070671_100929996
220 Ga0070674_100033665
221 Ga0070674_100038359
222 Ga0070673_100107413
223 Ga0070673_100241219
224 Ga0070688_100052782
225 Ga0070701_10844347
226 Ga0070701_11101644
227 Ga0070705_100807062
228 Ga0070700_100024056
229 Ga0070678_100079560
230 Ga0070662_100843918
231 Ga0068867_101081713
232 Ga0068867_101497861
233 Ga0070685_10042495
234 Ga0070685_10070153
235 Ga0070685_10812922
236 Ga0070672_100044862
237 Ga0070672_100282172
238 Ga0070686_100221425
239 Ga0070686_100891669
240 Ga0070665_100229361
241 Ga0070704_100373685
242 Ga0068854_100849775
243 Ga0070702_100285448
244 Ga0070702_100997059
245 Ga0068864_100723158
246 Ga0068861_100088744
247 Ga0068861_100190536
248 Ga0068863_100097396
249 Ga0068863_100549322
250 Ga0068858_101174947
251 Ga0068860_100312595
252 Ga0068862_100342595
253 Ga0068862_101348212
254 Ga0081455_10003315
255 Ga0081455_10077704
256 Ga0081539_10017513
257 Ga0075366_10003834
258 Ga0075366_11067330
259 Ga0097621_100083070
260 Ga0097621_100139540
261 Ga0068871_100091126
262 Ga0068871_100746305
263 Ga0075430_100119769
264 Ga0075430_100524490
265 Ga0075431_101426560
266 Ga0075433_10104552
267 Ga0068865_100405262
268 Ga0068865_101199819
269 Ga0097620_101625492
270 Ga0111539_10100324
271 Ga0105243_10433231
272 Ga0105242_10117353
273 Ga0105238_11606407
274 Ga0105249_11014613
275 Ga0105249_11421562
276 Ga0157374_10119186
277 Ga0157378_11271943
278 Ga0157378_12459485
279 Ga0163162_10019441
280 Ga0157375_10676539
281 Ga0157375_12979746
282 Ga0163163_10538895
283 Ga0163163_12139761
284 Ga0157380_10208176
285 Ga0157377_10644813
286 Ga0157376_10121566
287 Ga0157376_10588787
288 Ga0157376_11057747
289 Ga0163161_10067585
290 Ga0163161_10195822
291 Ga0207682_10019323
292 Ga0207645_10092447
293 Ga0207681_10000015
294 Ga0207681_10078979
295 Ga0207650_10528250
296 Ga0207659_10208323
297 Ga0207659_10333395
298 Ga0207644_10156700
299 Ga0207644_11487947
300 Ga0207686_10030834
301 Ga0207709_10387643
302 Ga0207670_10012199
303 Ga0207704_10039520
304 Ga0207704_10826386
305 Ga0207691_10050400
306 Ga0207691_10059974
307 Ga0207711_10905155
308 Ga0207689_10012194
309 Ga0207689_10127160
310 Ga0207651_10021906
311 Ga0207712_10847400
312 Ga0207677_10170510
313 Ga0207708_10216282
314 Ga0207648_10472235
315 Ga0207648_11277627
316 Ga0207675_100032135
317 Ga0207675_100137698
318 Ga0207675_101020481
319 Ga0207683_10058243
320 Ga0209966_1168314
321 Ga0207428_10018125
322 Ga0268266_10145843
323 Ga0268264_10212519
324 Ga0307513_10057767
325 Ga0307513_10164481
326 Ga0307513_10705328
327 Ga0307509_10028702
328 Ga0307509_10073471
329 Ga0307509_10520496
330 Ga0307408_101801010
331 Ga0307413_10004407
332 Ga0307413_10254916
333 Ga0307407_10346742
334 Ga0307412_10395898
335 Ga0307409_100026254
336 Ga0307409_101349164
337 Ga0307409_101668715
338 Ga0307416_100872148
339 Ga0307416_101581268
340 Ga0307416_102840380
341 Ga0307411_10774331
342 Ga0307415_100374886
343 Ga0373931_1112192
344 Ga0451787_475054
345 Ga0451800_1147039
346 Ga0451804_0451585
347 Ga0451804_0984718
348 Ga0451807_1708769
349 Ga0451839_0774253
350 Ga0439433_0051000
351 Ga0495590_0008205
352 Ga0495638_0026060
353 Ga0495638_0080090
354 Ga0495638_0281775
355 Ga0495584_0570160
356 Ga0495616_0021831
357 Ga0495632_0191467
358 Ga0495668_0082478
359 Ga0495625_0052313
360 Ga0495625_0118386
361 Ga0495649_0310171
362 Ga0495686_0095012
363 Ga0495686_0230547
364 Ga0496108_0294296
365 Ga0495682_0136584
366 Ga0501031_0364838
367 Ga0501036_1549567
368 Ga0501067_0004484
369 Ga0501068_0022958
370 Ga0501069_0196041
371 Ga0501071_0005176
372 Ga0501071_1539999
373 Ga0501072_0206942
374 Ga0501073_0002885
375 Ga0501074_0005962
376 Ga0501075_0398679
377 Ga0501076_0021717
378 Ga0501077_0027402
379 Ga0501077_0369586
380 Ga0501079_0005678
381 Ga0501080_0003706
382 Ga0501083_0062113
383 nmdc:mga0k408_638_c1
384 nmdc:mga05p37_1134506_c1
385 nmdc:mga0qj67_106569_c1
386 nmdc:mga06r32_1061255_c1
387 nmdc:mga06r32_1419237_c1
388 Ga0501084_0008484
389 Ga0590071_001593
390 Ga0501082_0056435
391 Ga0530510_0117931
392 2644120194
393 2841915679
394 2841920881
395 2857538851
396 2894514226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

21

64

0.93

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

142

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9604 2 129
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9101 2 137
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8926 2 129
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8845 2 137
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.8795 1 126
ID Description Score Start End Superfamily
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8912 73 129 3.30.720.110
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8875 2 132 3.10.180.10
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8809 2 132 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8773 73 129 3.30.720.110
4pavC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.841 2 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A858X9F5-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9967 1 129 GO:0051213
AF-A0A519HRW6-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9963 1 131 GO:0051213
AF-A0A4R1BNQ9-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9922 1 127 GO:0051213
AF-A0A534QNH1-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9913 5 127 GO:0051213
AF-A0A3C0KB78-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9905 1 86 GO:0051213

Map