F304716

General Info

Members Datasets Scaffolds Average Seq Length
198 133 396 183

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0035912|Ga0395899_0035912_362_1012
Length 216
Sequence MRLPQTIWQSLLTGRKVQRVFQNGNGGKRVIISNKEFHMNELTYTIRSSIETDAKGLSELRLQIDGETENLDRERGEAFIDVSGFEQLIHTDTISPRNLFLVAVADKSIVGFSRCEGTYLERFSHKVEFGVCVLKDFWGYGIGKNLLKESIAWADSVGIKKIALSVLETNTKAIELYIRHGFEIEGILKNDKILSDGLYYNTFVMGRFNDTQRNRC

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
12 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
24 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
25 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
28 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
29 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
30 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
31 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
32 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
33 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
34 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
35 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
36 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
37 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
38 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
39 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
40 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
41 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
42 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
43 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
44 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
45 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
46 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
47 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
48 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
49 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
50 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
51 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
52 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
53 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
54 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
55 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
56 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
57 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
58 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
59 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
60 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
61 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
62 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
63 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
64 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
65 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
66 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
67 2643221731 Bacillus sp. Root147 Isolate Unclassified
68 2684622632 Bacillus cereus 905 Isolate Unclassified
69 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
70 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
71 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
72 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
73 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
74 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
75 2738541295 Bacillus sp. OK085 Isolate Unclassified
76 2738541358 Bacillus sp. OV752 Isolate Unclassified
77 2738543006 Bacillus sp. OK077 Isolate Unclassified
78 2738543017 Bacillus sp. OV186 Isolate Unclassified
79 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
80 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
81 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
82 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
83 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
84 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
85 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
86 2842882022 Bacillus sp. R-71893 Isolate Unclassified
87 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
88 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
89 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
90 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
91 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
92 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
93 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
94 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
95 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
96 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
97 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
98 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
99 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
100 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
101 2919720352 Priestia megaterium 4340 Isolate Unclassified
102 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
103 2929004312 Priestia megaterium 1104 Isolate Unclassified
104 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
105 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
106 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
107 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
108 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
109 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
110 2938917290 Bacillus sp. CR71 Isolate Unclassified
111 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
112 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
113 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
114 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
115 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
116 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
117 2965761152 Bacillus sp. COPE52 Isolate Unclassified
118 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
119 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
120 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
121 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
122 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
123 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
124 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
125 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
126 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
127 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
128 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
129 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
130 8022792930 Bacillus sp. Xin Isolate Rhizosphere
131 8023438354 Bacillus sp. BH2 Isolate Unclassified
132 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
133 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 61.11
Metatranscriptomes 1.01
Isolates 37.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.22
Nodule 1.52
Rhizoplane 9.6
Rhizosphere 30.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0035912 3300037312 Bacteria 3719
2 JGI25151J46595_10001172 3300003187 Bacteria 18859
3 JGI25151J46595_10003494 3300003187 Bacteria 8666
4 JGI25151J46595_10008874 3300003187 Bacteria 4803
5 JGI25151J46595_10016601 3300003187 Bacteria 3216
6 JGI25151J46595_10016693 3300003187 Bacteria 3204
7 JGI25151J46595_10016796 3300003187 Bacteria 3193
8 JGI25151J46595_10016836 3300003187 Bacteria 3189
9 JGI25151J46595_10018850 3300003187 Bacteria 2949
10 JGI25151J46595_10020348 3300003187 Bacteria 2799
11 JGI25151J46595_10020390 3300003187 Bacteria 2796
12 JGI25151J46595_10025070 3300003187 Bacteria 2432
13 JGI25151J46595_10075436 3300003187 Bacteria 1000
14 Ga0006562J51391_1011948 3300003578 Bacteria 2562
15 Ga0006562J51391_1026610 3300003578 Bacteria 1646
16 Ga0055532_1010693 3300003758 Bacteria 1093
17 Ga0055535_1007381 3300003761 Bacteria 2107
18 Ga0055528_1041369 3300003790 Bacteria 1027
19 Ga0055541_1000587 3300003841 Bacteria 9823
20 Ga0079104_1030826 3300006946 Bacteria 1335
21 Ga0105251_10030742 3300009011 Bacteria 2693
22 Ga0105251_10135683 3300009011 Bacteria 1114
23 Ga0105244_10016151 3300009036 Bacteria 4260
24 Ga0157374_10010222 3300013296 Bacteria 8071
25 Ga0209566_100042 3300025225 Bacteria 287384
26 Ga0209147_101090 3300025229 Bacteria 11375
27 Ga0209147_108265 3300025229 Bacteria 1301
28 Ga0209258_103444 3300025242 Bacteria 3411
29 Ga0209130_1000250 3300025284 Bacteria 68229
30 Ga0209130_1007580 3300025284 Bacteria 3326
31 Ga0209130_1012195 3300025284 Bacteria 2261
32 Ga0209676_1010044 3300025292 Bacteria 3997
33 Ga0209676_1097497 3300025292 Bacteria 633
34 Ga0209025_1000143 3300025294 Bacteria 181917
35 Ga0209025_1000774 3300025294 Bacteria 52999
36 Ga0209025_1000799 3300025294 Bacteria 51124
37 Ga0209025_1002323 3300025294 Bacteria 20551
38 Ga0209025_1002670 3300025294 Bacteria 18223
39 Ga0209025_1003457 3300025294 Bacteria 14921
40 Ga0209025_1005439 3300025294 Bacteria 10393
41 Ga0209025_1006966 3300025294 Bacteria 8587
42 Ga0209025_1008571 3300025294 Bacteria 7332
43 Ga0209025_1010690 3300025294 Bacteria 6177
44 Ga0209025_1012202 3300025294 Bacteria 5541
45 Ga0209025_1014911 3300025294 Bacteria 4735
46 Ga0209025_1017258 3300025294 Bacteria 4182
47 Ga0209025_1029368 3300025294 Bacteria 2662
48 Ga0209025_1031768 3300025294 Bacteria 2487
49 Ga0209025_1041116 3300025294 Bacteria 1986
50 Ga0209025_1049639 3300025294 Bacteria 1686
51 Ga0209025_1077971 3300025294 Bacteria 1139
52 Ga0207426_1011613 3300025302 Bacteria 3344
53 Ga0207696_1001660 3300025711 Bacteria 11638
54 Ga0207696_1005519 3300025711 Bacteria 5234
55 Ga0207655_1004758 3300025728 Bacteria 9471
56 Ga0207655_1010276 3300025728 Bacteria 5689
57 Ga0207655_1010960 3300025728 Bacteria 5446
58 Ga0207655_1144646 3300025728 Bacteria 759
59 Ga0207713_1003782 3300025735 Bacteria 10149
60 Ga0207713_1005104 3300025735 Bacteria 8322
61 Ga0207713_1022942 3300025735 Bacteria 2949
62 Ga0207713_1054358 3300025735 Bacteria 1570
63 Ga0207644_10150264 3300025931 Bacteria 1802
64 Ga0209281_1001573 3300027111 Bacteria 12470
65 Ga0237817_10014 3300030083 Bacteria 74143
66 Ga0237817_10036 3300030083 Bacteria 47878
67 Ga0268256_1070459 3300030500 Bacteria 675
68 Ga0395899_0005840 3300037312 Bacteria 9553
69 Ga0395898_0977067 3300037466 Bacteria 783
70 Ga0237819_00049 3300038705 Bacteria 41263
71 Ga0237819_00929 3300038705 Bacteria 9033
72 Ga0466959_0034771 3300045049 Bacteria 3727
73 Ga0495584_0093998 3300046491 Bacteria 1513
74 Ga0495585_0068482 3300046492 Bacteria 1939
75 Ga0495661_0072341 3300046665 Bacteria 2012
76 Ga0495683_0015477 3300047323 Bacteria 3969
77 Ga0496100_0001026 3300048903 Bacteria 13500
78 Ga0496101_0002116 3300048904 Bacteria 12104
79 Ga0496102_0010099 3300048905 Bacteria 8120
80 Ga0496102_0452359 3300048905 Bacteria 1205
81 Ga0496103_0003437 3300048906 Bacteria 9680
82 Ga0496104_0009488 3300048907 Bacteria 8660
83 Ga0496105_0001473 3300048908 Bacteria 16602
84 Ga0496106_0001810 3300048909 Bacteria 15983
85 Ga0496107_0002429 3300048910 Bacteria 12072
86 Ga0496108_0002228 3300048911 Bacteria 15527
87 Ga0496109_0008489 3300048912 Bacteria 8732
88 Ga0496110_0005372 3300048913 Bacteria 10037
89 Ga0496110_0653204 3300048913 Bacteria 952
90 Ga0496111_0010775 3300048914 Bacteria 6145
91 Ga0496112_0027362 3300048915 Bacteria 5497
92 Ga0496113_0004001 3300048916 Bacteria 8961
93 Ga0496113_0310239 3300048916 Bacteria 1264
94 Ga0496114_1289014 3300048917 Bacteria 617
95 Ga0496116_0023203 3300048919 Bacteria 4626
96 Ga0496116_0030697 3300048919 Bacteria 3856
97 Ga0496117_0037655 3300048920 Bacteria 3600
98 Ga0496117_0079943 3300048920 Bacteria 2152
99 Ga0496119_0005367 3300048922 Bacteria 12321
100 Ga0496120_0000045 3300048923 Bacteria 191663
101 Ga0496121_0033751 3300048924 Bacteria 4623
102 Ga0496122_0000114 3300048925 Bacteria 183968
103 Ga0496122_0010419 3300048925 Bacteria 9589
104 Ga0496122_0048807 3300048925 Bacteria 3250
105 Ga0496122_0051664 3300048925 Bacteria 3120
106 Ga0496122_0145412 3300048925 Bacteria 1474
107 Ga0496123_0011791 3300048926 Bacteria 7529
108 Ga0496123_0025041 3300048926 Bacteria 4511
109 Ga0496123_0028095 3300048926 Bacteria 4173
110 Ga0496124_0001165 3300048927 Bacteria 41163
111 Ga0496124_0002971 3300048927 Bacteria 21250
112 Ga0496125_0001369 3300048928 Bacteria 35869
113 Ga0496125_0001981 3300048928 Bacteria 27856
114 Ga0496125_0008664 3300048928 Bacteria 10600
115 Ga0496125_0092264 3300048928 Bacteria 2265
116 Ga0496126_0000826 3300048929 Bacteria 55034
117 Ga0496126_0002349 3300048929 Bacteria 25865
118 Ga0496126_0012034 3300048929 Bacteria 8891
119 Ga0496126_0037659 3300048929 Bacteria 4510
120 Ga0496126_0037994 3300048929 Bacteria 4482
121 Ga0496126_0585334 3300048929 Bacteria 881
122 Ga0496126_0788434 3300048929 Bacteria 730
123 Ga0501217_111422 3300049661 Bacteria 787
124 2511179708 2510917027 Bacteria 5287437
125 2512639765 2512564013 Bacteria 6286191
126 2553392609 2551306519 Bacteria 5465154
127 2556063419 2554235469 Bacteria 3590176
128 2573039078 2571042588 Bacteria 5045676
129 2578336873 2576861424 Bacteria 5270569
130 2580934275 2579778775 Bacteria 5360914
131 2621275075 2619619294 Bacteria 5575484
132 2644716959 2643221731 Bacteria 5623886
133 2685150721 2684622632 Bacteria 5380049
134 2698322531 2695420987 Bacteria 6152737
135 2705994578 2703719227 Bacteria 5631989
136 2712198264 2711768088 Bacteria 3195027
137 2721505949 2718218445 Bacteria 5113413
138 2723601676 2721755693 Bacteria 6126117
139 2730137776 2728369359 Bacteria 5621728
140 2738816108 2738541295 Bacteria 5730091
141 2739155924 2738541358 Bacteria 5932299
142 2739208703 2738543006 Bacteria 5904091
143 2739269742 2738543017 Bacteria 4271950
144 2745169229 2744054657 Bacteria 5016802
145 2757566238 2757320391 Bacteria 4746095
146 2777838893 2775507192 Bacteria 4622234
147 2793182172 2791355222 Bacteria 5898266
148 2802440203 2802428803 Bacteria 5806948
149 2817617129 2816332336 Bacteria 5207640
150 2821117911 2821111986 Bacteria 6894338
151 2842886846 2842882022 Bacteria 6158489
152 2857467062 2857465823 Bacteria 6772595
153 2857592979 2857591370 Bacteria 6569758
154 2881637863 2881636855 Bacteria 5205297
155 2889042733 2889042446 Bacteria 7618936
156 2889277744 2889276214 Bacteria 5979355
157 2898909352 2898907183 Bacteria 4067722
158 2904167263 2904162308 Bacteria 7086713
159 2904525736 2904524088 Bacteria 5887454
160 2904600015 2904595352 Bacteria 6124848
161 2915601774 2915597211 Bacteria 6475886
162 2915606935 2915606848 Bacteria 6032732
163 2919145669 2919143609 Bacteria 6219228
164 2919165594 2919160200 Bacteria 6929020
165 2919426404 2919425241 Bacteria 8055701
166 2919721983 2919720352 Bacteria 5986006
167 2928512548 2928510474 Bacteria 4815308
168 2929007209 2929004312 Bacteria 5678476
169 2929186904 2929183550 Bacteria 6377511
170 2929209109 2929206907 Bacteria 5918291
171 2929236411 2929233124 Bacteria 5948380
172 2931386157 2931384279 Bacteria 7299545
173 2936342508 2936340661 Bacteria 5139038
174 2936364405 2936361878 Bacteria 5632809
175 2938920338 2938917290 Bacteria 5914775
176 2939703994 2939702853 Bacteria 5139229
177 2945995228 2945991243 Bacteria 7008369
178 2946057946 2946053406 Bacteria 6978655
179 2947429432 2947426588 Bacteria 5357194
180 2960321038 2960319331 Bacteria 5502575
181 2960380122 2960375949 Bacteria 5361395
182 2965763951 2965761152 Bacteria 5806513
183 2968562114 2968558590 Bacteria 6956864
184 2971405881 2971403814 Bacteria 7370929
185 2971515463 2971511577 Bacteria 5404012
186 2977255710 2977254563 Bacteria 4828420
187 2979086375 2979083700 Bacteria 5894929
188 2980179965 2980176882 Bacteria 5397533
189 2988230350 2988225383 Bacteria 7221625
190 2990276343 2990275345 Bacteria 4887158
191 2996707392 2996706504 Bacteria 5757485
192 3001898727 3001892409 Bacteria 6328293
193 648168224 648028048 Bacteria 5394884
194 8022625050 8022621104 Bacteria 5241040
195 8022795567 8022792930 Bacteria 5693794
196 8023442046 8023438354 Bacteria 5779374
197 8057476893 8057473075 Bacteria 5892720
198 8057585256 8057582654 Bacteria 5218944
199 Ga0395899_0035912
200 JGI25151J46595_10001172
201 JGI25151J46595_10003494
202 JGI25151J46595_10008874
203 JGI25151J46595_10016601
204 JGI25151J46595_10016693
205 JGI25151J46595_10016796
206 JGI25151J46595_10016836
207 JGI25151J46595_10018850
208 JGI25151J46595_10020348
209 JGI25151J46595_10020390
210 JGI25151J46595_10025070
211 JGI25151J46595_10075436
212 Ga0006562J51391_1011948
213 Ga0006562J51391_1026610
214 Ga0055532_1010693
215 Ga0055535_1007381
216 Ga0055528_1041369
217 Ga0055541_1000587
218 Ga0079104_1030826
219 Ga0105251_10030742
220 Ga0105251_10135683
221 Ga0105244_10016151
222 Ga0157374_10010222
223 Ga0209566_100042
224 Ga0209147_101090
225 Ga0209147_108265
226 Ga0209258_103444
227 Ga0209130_1000250
228 Ga0209130_1007580
229 Ga0209130_1012195
230 Ga0209676_1010044
231 Ga0209676_1097497
232 Ga0209025_1000143
233 Ga0209025_1000774
234 Ga0209025_1000799
235 Ga0209025_1002323
236 Ga0209025_1002670
237 Ga0209025_1003457
238 Ga0209025_1005439
239 Ga0209025_1006966
240 Ga0209025_1008571
241 Ga0209025_1010690
242 Ga0209025_1012202
243 Ga0209025_1014911
244 Ga0209025_1017258
245 Ga0209025_1029368
246 Ga0209025_1031768
247 Ga0209025_1041116
248 Ga0209025_1049639
249 Ga0209025_1077971
250 Ga0207426_1011613
251 Ga0207696_1001660
252 Ga0207696_1005519
253 Ga0207655_1004758
254 Ga0207655_1010276
255 Ga0207655_1010960
256 Ga0207655_1144646
257 Ga0207713_1003782
258 Ga0207713_1005104
259 Ga0207713_1022942
260 Ga0207713_1054358
261 Ga0207644_10150264
262 Ga0209281_1001573
263 Ga0237817_10014
264 Ga0237817_10036
265 Ga0268256_1070459
266 Ga0395899_0005840
267 Ga0395898_0977067
268 Ga0237819_00049
269 Ga0237819_00929
270 Ga0466959_0034771
271 Ga0495584_0093998
272 Ga0495585_0068482
273 Ga0495661_0072341
274 Ga0495683_0015477
275 Ga0496100_0001026
276 Ga0496101_0002116
277 Ga0496102_0010099
278 Ga0496102_0452359
279 Ga0496103_0003437
280 Ga0496104_0009488
281 Ga0496105_0001473
282 Ga0496106_0001810
283 Ga0496107_0002429
284 Ga0496108_0002228
285 Ga0496109_0008489
286 Ga0496110_0005372
287 Ga0496110_0653204
288 Ga0496111_0010775
289 Ga0496112_0027362
290 Ga0496113_0004001
291 Ga0496113_0310239
292 Ga0496114_1289014
293 Ga0496116_0023203
294 Ga0496116_0030697
295 Ga0496117_0037655
296 Ga0496117_0079943
297 Ga0496119_0005367
298 Ga0496120_0000045
299 Ga0496121_0033751
300 Ga0496122_0000114
301 Ga0496122_0010419
302 Ga0496122_0048807
303 Ga0496122_0051664
304 Ga0496122_0145412
305 Ga0496123_0011791
306 Ga0496123_0025041
307 Ga0496123_0028095
308 Ga0496124_0001165
309 Ga0496124_0002971
310 Ga0496125_0001369
311 Ga0496125_0001981
312 Ga0496125_0008664
313 Ga0496125_0092264
314 Ga0496126_0000826
315 Ga0496126_0002349
316 Ga0496126_0012034
317 Ga0496126_0037659
318 Ga0496126_0037994
319 Ga0496126_0585334
320 Ga0496126_0788434
321 Ga0501217_111422
322 2511179708
323 2512639765
324 2553392609
325 2556063419
326 2573039078
327 2578336873
328 2580934275
329 2621275075
330 2644716959
331 2685150721
332 2698322531
333 2705994578
334 2712198264
335 2721505949
336 2723601676
337 2730137776
338 2738816108
339 2739155924
340 2739208703
341 2739269742
342 2745169229
343 2757566238
344 2777838893
345 2793182172
346 2802440203
347 2817617129
348 2821117911
349 2842886846
350 2857467062
351 2857592979
352 2881637863
353 2889042733
354 2889277744
355 2898909352
356 2904167263
357 2904525736
358 2904600015
359 2915601774
360 2915606935
361 2919145669
362 2919165594
363 2919426404
364 2919721983
365 2928512548
366 2929007209
367 2929186904
368 2929209109
369 2929236411
370 2931386157
371 2936342508
372 2936364405
373 2938920338
374 2939703994
375 2945995228
376 2946057946
377 2947429432
378 2960321038
379 2960380122
380 2965763951
381 2968562114
382 2971405881
383 2971515463
384 2977255710
385 2979086375
386 2980179965
387 2988230350
388 2990276343
389 2996707392
390 3001898727
391 648168224
392 8022625050
393 8022795567
394 8023442046
395 8057476893
396 8057585256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

65

182

0.86

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

46

200

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

96

184

0.81

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

65

190

0.81

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

42

183

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i79-assembly1.cif.gz_E the crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae 0.9517 15 179
2i79-assembly3.cif.gz_D the crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae 0.9449 15 181
2i79-assembly3.cif.gz_D the crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae 0.934 15 181
2i79-assembly1.cif.gz_E the crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae 0.9299 15 179
2ge3-assembly1.cif.gz_B crystal structure of probable acetyltransferase from agrobacterium tumefaciens 0.9063 15 181
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9527 131 180 3.40.630.30
2i79E00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9517 15 179 3.40.630.30
2i79E00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9299 15 179 3.40.630.30
af_Q2G0E2_3_168_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9246 17 181 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9218 116 181 3.40.630.30
ID Description Score Start End GO Terms
AF-A9VHQ6-F1-model_v4 GCN5-related N-acetyltransferase 0.981 1 181 GO:0016747
AF-A0A0C2YAB8-F1-model_v4 deleted 0.9775 71 181
AF-A9VHQ6-F1-model_v4 GCN5-related N-acetyltransferase 0.9757 1 181 GO:0016747
AF-A0A385YX90-F1-model_v4 GNAT family N-acetyltransferase 0.9716 13 181 GO:0016747
AF-A0A562K5N2-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9652 1 107

Map