F304649

General Info

Members Datasets Scaffolds Average Seq Length
198 121 190 138

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10002585|Ga0307407_100025856
Length 151
Sequence MSAVVLFDGVCNFCDSSVNFIIEHDAEGYFKFAPLQSQEGERLANEYGFESPSAGSADEAGQSGSSEADDLIPIDSVILIEGGKAYTHSTAALRITRRLGMPWSLFYAFAVVPRSLRDYFYRLFARYRYRFFGRKDQCMLPSPEVRARFLT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2738543017 Bacillus sp. OV186 Isolate Unclassified
3 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
4 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
5 2857586860 Bacillus sp. R-71935 Isolate Unclassified
6 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
9 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
111 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
112 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
113 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
114 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
115 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
116 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
117 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
118 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
119 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
120 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.06
Nodule 0
Rhizoplane 1.01
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_85263 2162886012 Unclassified 833
2 JGI25151J46595_10003231 3300003187 Bacteria 9092
3 JGI25151J46595_10020266 3300003187 Bacteria 2806
4 Ga0055538_1000354 3300003751 Bacteria 19744
5 Ga0055536_1011889 3300003781 Bacteria 3285
6 Ga0065704_10091115 3300005289 Unclassified 2739
7 Ga0070683_100462303 3300005329 Unclassified 1211
8 Ga0070690_100582091 3300005330 Unclassified 848
9 Ga0070670_100067312 3300005331 Bacteria 3073
10 Ga0070670_100082122 3300005331 Bacteria 2769
11 Ga0070670_100667204 3300005331 Bacteria 933
12 Ga0070670_101035641 3300005331 Bacteria 747
13 Ga0068869_101230190 3300005334 Unclassified 659
14 Ga0070682_101576285 3300005337 Unclassified 567
15 Ga0070689_100273295 3300005340 Bacteria 1400
16 Ga0070687_100566844 3300005343 Unclassified 775
17 Ga0070661_100615264 3300005344 Bacteria 879
18 Ga0070661_100708510 3300005344 Bacteria 821
19 Ga0070692_10324064 3300005345 Unclassified 948
20 Ga0070669_100366401 3300005353 Bacteria 1173
21 Ga0070671_100117888 3300005355 Bacteria 2232
22 Ga0070671_100401484 3300005355 Bacteria 1172
23 Ga0070673_100947996 3300005364 Unclassified 800
24 Ga0070673_101177529 3300005364 Bacteria 718
25 Ga0070673_101263588 3300005364 Unclassified 693
26 Ga0070688_100041042 3300005365 Bacteria 2839
27 Ga0070659_101615403 3300005366 Unclassified 579
28 Ga0070667_100317309 3300005367 Bacteria 1406
29 Ga0070705_100454089 3300005440 Bacteria 962
30 Ga0070663_100608490 3300005455 Bacteria 920
31 Ga0070663_101318510 3300005455 Bacteria 637
32 Ga0070681_10055228 3300005458 Bacteria 3955
33 Ga0070685_10042446 3300005466 Bacteria 2596
34 Ga0068853_100214822 3300005539 Bacteria 1754
35 Ga0068853_100458798 3300005539 Bacteria 1199
36 Ga0070672_100378428 3300005543 Bacteria 1210
37 Ga0070696_101820030 3300005546 Bacteria 526
38 Ga0070664_100418953 3300005564 Unclassified 1226
39 Ga0068854_101118609 3300005578 Unclassified 702
40 Ga0068856_100572863 3300005614 Unclassified 1150
41 Ga0068852_100067225 3300005616 Unclassified 3133
42 Ga0068852_100344286 3300005616 Bacteria 1454
43 Ga0068852_102794464 3300005616 Unclassified 507
44 Ga0068859_100014502 3300005617 Bacteria 7911
45 Ga0068859_100580941 3300005617 Unclassified 1214
46 Ga0068864_100700132 3300005618 Bacteria 990
47 Ga0068864_102227481 3300005618 Unclassified 554
48 Ga0068851_10100637 3300005834 Bacteria 1533
49 Ga0068863_100420559 3300005841 Bacteria 1309
50 Ga0068858_100186396 3300005842 Bacteria 1960
51 Ga0068858_100328814 3300005842 Bacteria 1462
52 Ga0068871_100703329 3300006358 Unclassified 926
53 Ga0097620_100014502 3300006931 Bacteria 7911
54 Ga0097620_100580919 3300006931 Unclassified 1214
55 Ga0111539_10374768 3300009094 Bacteria 1657
56 Ga0105243_10702482 3300009148 Bacteria 986
57 Ga0105248_10947867 3300009177 Bacteria 972
58 Ga0105237_10637557 3300009545 Unclassified 1072
59 Ga0105238_11925721 3300009551 Unclassified 624
60 Ga0105249_10007039 3300009553 Bacteria 9812
61 Ga0105249_10255292 3300009553 Unclassified 1740
62 Ga0105239_10038622 3300010375 Bacteria 5232
63 Ga0157373_10145281 3300013100 Bacteria 1668
64 Ga0157373_11325743 3300013100 Unclassified 545
65 Ga0157373_11357689 3300013100 Bacteria 539
66 Ga0157371_10156105 3300013102 Bacteria 1628
67 Ga0157371_10866955 3300013102 Bacteria 683
68 Ga0157370_10021726 3300013104 Bacteria 6393
69 Ga0157370_10233290 3300013104 Bacteria 1703
70 Ga0157370_10338518 3300013104 Bacteria 1387
71 Ga0157369_10239413 3300013105 Bacteria 1896
72 Ga0157369_10885195 3300013105 Bacteria 916
73 Ga0163162_10116335 3300013306 Bacteria 2774
74 Ga0163162_10194910 3300013306 Bacteria 2154
75 Ga0163162_10459772 3300013306 Bacteria 1404
76 Ga0163162_10568041 3300013306 Bacteria 1262
77 Ga0163162_12102026 3300013306 Unclassified 648
78 Ga0157372_10001707 3300013307 Bacteria 23820
79 Ga0157372_11194782 3300013307 Bacteria 879
80 Ga0157375_10392263 3300013308 Bacteria 1555
81 Ga0163163_10002419 3300014325 Bacteria 15790
82 Ga0163163_10394131 3300014325 Bacteria 1443
83 Ga0157380_11865966 3300014326 Unclassified 661
84 Ga0157377_10160414 3300014745 Bacteria 1398
85 Ga0157376_10151547 3300014969 Bacteria 2091
86 Ga0157376_11015895 3300014969 Bacteria 852
87 Ga0163161_10263615 3300017792 Bacteria 1346
88 Ga0163161_10476380 3300017792 Bacteria 1013
89 Ga0209784_100054 3300025224 Bacteria 178541
90 Ga0209676_1000645 3300025292 Bacteria 50047
91 Ga0209676_1001268 3300025292 Bacteria 26245
92 Ga0209676_1015885 3300025292 Bacteria 2748
93 Ga0209676_1084860 3300025292 Bacteria 711
94 Ga0209025_1002897 3300025294 Bacteria 17128
95 Ga0209025_1016487 3300025294 Bacteria 4352
96 Ga0209025_1021624 3300025294 Bacteria 3455
97 Ga0207671_10048428 3300025914 Unclassified 3146
98 Ga0207671_11263119 3300025914 Unclassified 576
99 Ga0207662_10564599 3300025918 Unclassified 789
100 Ga0207649_10146388 3300025920 Bacteria 1622
101 Ga0207649_11103253 3300025920 Bacteria 626
102 Ga0207652_10117277 3300025921 Unclassified 2365
103 Ga0207650_10115493 3300025925 Unclassified 2083
104 Ga0207650_10119379 3300025925 Unclassified 2051
105 Ga0207650_10204396 3300025925 Bacteria 1583
106 Ga0207650_11254373 3300025925 Bacteria 631
107 Ga0207659_10439198 3300025926 Bacteria 1097
108 Ga0207644_10211899 3300025931 Unclassified 1532
109 Ga0207644_10436257 3300025931 Unclassified 1075
110 Ga0207706_10768451 3300025933 Unclassified 820
111 Ga0207670_10721318 3300025936 Unclassified 826
112 Ga0207661_11871985 3300025944 Unclassified 546
113 Ga0207651_10972712 3300025960 Unclassified 758
114 Ga0207651_11524967 3300025960 Bacteria 602
115 Ga0207703_10137384 3300026035 Bacteria 2117
116 Ga0207703_10149502 3300026035 Bacteria 2035
117 Ga0207639_10013064 3300026041 Bacteria 5798
118 Ga0207678_10405261 3300026067 Bacteria 1181
119 Ga0207678_10570720 3300026067 Bacteria 990
120 Ga0207641_11238399 3300026088 Unclassified 746
121 Ga0207676_10122512 3300026095 Bacteria 2195
122 Ga0207676_12168869 3300026095 Unclassified 554
123 Ga0207675_101650622 3300026118 Bacteria 661
124 Ga0207683_10223519 3300026121 Bacteria 1716
125 Ga0207698_10493495 3300026142 Bacteria 1190
126 Ga0207698_10553457 3300026142 Bacteria 1128
127 Ga0207698_11187602 3300026142 Unclassified 777
128 Ga0268265_10364004 3300028380 Bacteria 1325
129 Ga0307408_100157857 3300031548 Bacteria 1798
130 Ga0307408_100236195 3300031548 Bacteria 1500
131 Ga0307408_100318050 3300031548 Bacteria 1310
132 Ga0307405_10002792 3300031731 Bacteria 7838
133 Ga0307405_10310685 3300031731 Bacteria 1200
134 Ga0307405_10387770 3300031731 Bacteria 1090
135 Ga0307413_10314495 3300031824 Bacteria 1193
136 Ga0307410_10042711 3300031852 Bacteria 2998
137 Ga0307410_10077444 3300031852 Bacteria 2324
138 Ga0307410_11432134 3300031852 Unclassified 607
139 Ga0307406_10009227 3300031901 Bacteria 5526
140 Ga0307406_10081086 3300031901 Bacteria 2156
141 Ga0307406_10624821 3300031901 Bacteria 891
142 Ga0307407_10002585 3300031903 Bacteria 7137
143 Ga0307407_10280528 3300031903 Bacteria 1154
144 Ga0307407_10313991 3300031903 Bacteria 1097
145 Ga0307407_10431902 3300031903 Unclassified 952
146 Ga0307407_10608292 3300031903 Bacteria 814
147 Ga0307412_10009072 3300031911 Bacteria 5699
148 Ga0307412_10716139 3300031911 Bacteria 861
149 Ga0307412_11224935 3300031911 Bacteria 673
150 Ga0307409_100236277 3300031995 Bacteria 1660
151 Ga0307409_100303823 3300031995 Bacteria 1486
152 Ga0307409_100733221 3300031995 Bacteria 990
153 Ga0307416_100048244 3300032002 Unclassified 3377
154 Ga0307416_102412796 3300032002 Unclassified 625
155 Ga0307414_10135123 3300032004 Unclassified 1922
156 Ga0307414_10149419 3300032004 Unclassified 1841
157 Ga0307414_10194101 3300032004 Unclassified 1646
158 Ga0307414_10312440 3300032004 Unclassified 1334
159 Ga0307411_10018389 3300032005 Unclassified 4007
160 Ga0307411_10081436 3300032005 Bacteria 2229
161 Ga0307411_10891517 3300032005 Unclassified 790
162 Ga0307411_10947420 3300032005 Unclassified 768
163 Ga0307411_11367143 3300032005 Bacteria 647
164 Ga0307415_100024477 3300032126 Bacteria 3770
165 Ga0307415_100820851 3300032126 Unclassified 850
166 Ga0307415_101117285 3300032126 Bacteria 739
167 Ga0307415_101223362 3300032126 Bacteria 708
168 Ga0395905_0091219 3300037471 Bacteria 2857
169 Ga0436365_1150921 3300039437 Bacteria 653
170 Ga0436363_1153540 3300039450 Bacteria 681
171 Ga0451791_1166875 3300041451 Unclassified 591
172 Ga0451802_0302193 3300041460 Bacteria 644
173 Ga0453684_0014808 3300044712 Bacteria 12422
174 Ga0453684_0609110 3300044712 Bacteria 1196
175 Ga0466960_0090236 3300044901 Bacteria 1561
176 Ga0495598_0007795 3300046537 Bacteria 2470
177 Ga0495645_0534814 3300046543 Bacteria 728
178 Ga0501202_065323 3300049652 Unclassified 830
179 Ga0501207_112942 3300049654 Unclassified 557
180 Ga0501235_100729 3300049669 Unclassified 705
181 Ga0501235_148725 3300049669 Bacteria 605
182 Ga0501242_009640 3300049674 Bacteria 1145
183 Ga0501249_024607 3300049679 Bacteria 1327
184 Ga0501221_063606 3300049704 Unclassified 858
185 Ga0501229_049192 3300049706 Unclassified 619
186 Ga0501263_007799 3300049760 Bacteria 1265
187 Ga0501267_011912 3300049764 Bacteria 891
188 Ga0501268_005930 3300049765 Unclassified 1773
189 Ga0501273_067058 3300049770 Bacteria 576
190 Ga0530510_0418661 3300061734 Bacteria 1011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0609110 Ga0453684_0609110_780_1109 109
2 3300039437 Ga0436365_1150921 Ga0436365_1150921_225_566 113
3 3300025294 Ga0209025_1021624 Ga0209025_10216243 121
4 3300041460 Ga0451802_0302193 Ga0451802_0302193_21_389 122
5 3300031995 Ga0307409_100303823 Ga0307409_1003038232 125
6 3300032002 Ga0307416_102412796 Ga0307416_1024127962 125
7 3300005289 Ga0065704_10091115 Ga0065704_100911152 126
8 3300031903 Ga0307407_10608292 Ga0307407_106082922 126
9 3300032005 Ga0307411_11367143 Ga0307411_113671431 126
10 3300049669 Ga0501235_148725 Ga0501235_148725_196_576 126
11 iso_pu_bacteria 2788500588 2791214532 126
12 iso_pu_bacteria 2818991451 2819628400 126
13 iso_pu_bacteria 2881644220 2881644596 126
14 iso_pu_bacteria 2884791551 2884793207 126
15 iso_pu_bacteria 2904606771 2904609871 126
16 iso_pu_bacteria 3006984091 3006985990 126
17 3300005616 Ga0068852_100344286 Ga0068852_1003442862 128
18 3300006358 Ga0068871_100703329 Ga0068871_1007033291 128
19 3300026142 Ga0207698_10553457 Ga0207698_105534572 128
20 iso_pu_bacteria 2738543017 2739270257 128
21 iso_pu_bacteria 2857586860 2857590452 128
22 3300003187 JGI25151J46595_10020266 JGI25151J46595_100202662 129
23 3300003751 Ga0055538_1000354 Ga0055538_100035422 129
24 3300003781 Ga0055536_1011889 Ga0055536_10118893 129
25 3300025224 Ga0209784_100054 Ga0209784_10005462 129
26 3300025292 Ga0209676_1001268 Ga0209676_100126825 129
27 3300025292 Ga0209676_1015885 Ga0209676_10158852 129
28 3300025292 Ga0209676_1084860 Ga0209676_10848601 129
29 3300025294 Ga0209025_1016487 Ga0209025_10164874 129
30 3300031548 Ga0307408_100318050 Ga0307408_1003180502 129
31 3300003187 JGI25151J46595_10003231 JGI25151J46595_100032314 130
32 3300005331 Ga0070670_100667204 Ga0070670_1006672041 130
33 3300005564 Ga0070664_100418953 Ga0070664_1004189532 130
34 3300005618 Ga0068864_102227481 Ga0068864_1022274812 130
35 3300013104 Ga0157370_10338518 Ga0157370_103385182 130
36 3300013105 Ga0157369_10885195 Ga0157369_108851951 130
37 3300013306 Ga0163162_10116335 Ga0163162_101163353 130
38 3300014969 Ga0157376_10151547 Ga0157376_101515472 130
39 3300017792 Ga0163161_10263615 Ga0163161_102636152 130
40 3300025292 Ga0209676_1000645 Ga0209676_100064550 130
41 3300025294 Ga0209025_1002897 Ga0209025_100289714 130
42 3300025925 Ga0207650_10119379 Ga0207650_101193793 130
43 3300026095 Ga0207676_12168869 Ga0207676_121688691 130
44 3300026121 Ga0207683_10223519 Ga0207683_102235193 130
45 3300026142 Ga0207698_11187602 Ga0207698_111876022 130
46 3300031731 Ga0307405_10387770 Ga0307405_103877702 130
47 3300031901 Ga0307406_10009227 Ga0307406_100092274 130
48 3300031901 Ga0307406_10624821 Ga0307406_106248211 130
49 3300031911 Ga0307412_10716139 Ga0307412_107161392 130
50 3300039450 Ga0436363_1153540 Ga0436363_1153540_67_459 130
51 3300005331 Ga0070670_100067312 Ga0070670_1000673124 131
52 3300005344 Ga0070661_100615264 Ga0070661_1006152643 131
53 3300005455 Ga0070663_101318510 Ga0070663_1013185101 131
54 3300005539 Ga0068853_100214822 Ga0068853_1002148222 131
55 3300005834 Ga0068851_10100637 Ga0068851_101006372 131
56 3300013100 Ga0157373_11357689 Ga0157373_113576891 131
57 3300013102 Ga0157371_10156105 Ga0157371_101561052 131
58 3300013102 Ga0157371_10866955 Ga0157371_108669552 131
59 3300013307 Ga0157372_10001707 Ga0157372_1000170717 131
60 3300013307 Ga0157372_11194782 Ga0157372_111947822 131
61 3300014325 Ga0163163_10002419 Ga0163163_1000241915 131
62 3300025925 Ga0207650_11254373 Ga0207650_112543731 131
63 3300026041 Ga0207639_10013064 Ga0207639_100130643 131
64 3300026067 Ga0207678_10570720 Ga0207678_105707202 131
65 3300037471 Ga0395905_0091219 Ga0395905_0091219_1731_2132 131
66 3300041451 Ga0451791_1166875 Ga0451791_1166875_70_465 131
67 3300044712 Ga0453684_0014808 Ga0453684_0014808_10437_10844 131
68 3300044901 Ga0466960_0090236 Ga0466960_0090236_1128_1529 131
69 3300046537 Ga0495598_0007795 Ga0495598_0007795_129_530 131
70 3300061734 Ga0530510_0418661 Ga0530510_0418661_559_966 131
71 3300049652 Ga0501202_065323 Ga0501202_065323_11_415 134
72 3300005617 Ga0068859_100580941 Ga0068859_1005809412 135
73 3300005842 Ga0068858_100186396 Ga0068858_1001863962 135
74 3300006931 Ga0097620_100580919 Ga0097620_1005809192 135
75 3300009545 Ga0105237_10637557 Ga0105237_106375572 135
76 3300025914 Ga0207671_11263119 Ga0207671_112631191 135
77 3300026035 Ga0207703_10149502 Ga0207703_101495022 135
78 3300005340 Ga0070689_100273295 Ga0070689_1002732952 137
79 3300005343 Ga0070687_100566844 Ga0070687_1005668441 137
80 3300025918 Ga0207662_10564599 Ga0207662_105645992 137
81 3300009551 Ga0105238_11925721 Ga0105238_119257211 138
82 3300013100 Ga0157373_11325743 Ga0157373_113257431 138
83 3300025914 Ga0207671_10048428 Ga0207671_100484283 138
84 3300025920 Ga0207649_11103253 Ga0207649_111032531 138
85 3300005345 Ga0070692_10324064 Ga0070692_103240642 139
86 3300005458 Ga0070681_10055228 Ga0070681_100552284 139
87 3300005353 Ga0070669_100366401 Ga0070669_1003664013 140
88 3300005440 Ga0070705_100454089 Ga0070705_1004540893 140
89 3300005455 Ga0070663_100608490 Ga0070663_1006084902 140
90 3300005546 Ga0070696_101820030 Ga0070696_1018200301 140
91 3300009148 Ga0105243_10702482 Ga0105243_107024821 140
92 3300009553 Ga0105249_10255292 Ga0105249_102552922 140
93 3300026067 Ga0207678_10405261 Ga0207678_104052612 140
94 3300005331 Ga0070670_100082122 Ga0070670_1000821223 141
95 3300005355 Ga0070671_100401484 Ga0070671_1004014842 141
96 3300005365 Ga0070688_100041042 Ga0070688_1000410423 141
97 3300005466 Ga0070685_10042446 Ga0070685_100424463 141
98 3300005617 Ga0068859_100014502 Ga0068859_1000145023 141
99 3300005841 Ga0068863_100420559 Ga0068863_1004205592 141
100 3300005842 Ga0068858_100328814 Ga0068858_1003288142 141
101 3300006931 Ga0097620_100014502 Ga0097620_1000145023 141
102 3300009553 Ga0105249_10007039 Ga0105249_100070396 141
103 3300013306 Ga0163162_10194910 Ga0163162_101949102 141
104 3300014325 Ga0163163_10394131 Ga0163163_103941312 141
105 3300014326 Ga0157380_11865966 Ga0157380_118659661 141
106 3300014745 Ga0157377_10160414 Ga0157377_101604142 141
107 3300025925 Ga0207650_10204396 Ga0207650_102043963 141
108 3300025926 Ga0207659_10439198 Ga0207659_104391982 141
109 3300025931 Ga0207644_10436257 Ga0207644_104362572 141
110 3300025936 Ga0207670_10721318 Ga0207670_107213182 141
111 3300026035 Ga0207703_10137384 Ga0207703_101373841 141
112 3300026088 Ga0207641_11238399 Ga0207641_112383992 141
113 3300026095 Ga0207676_10122512 Ga0207676_101225122 141
114 3300005344 Ga0070661_100708510 Ga0070661_1007085102 142
115 3300005614 Ga0068856_100572863 Ga0068856_1005728632 142
116 3300009094 Ga0111539_10374768 Ga0111539_103747682 142
117 3300028380 Ga0268265_10364004 Ga0268265_103640042 142
118 3300031903 Ga0307407_10280528 Ga0307407_102805281 142
119 3300031903 Ga0307407_10431902 Ga0307407_104319021 142
120 3300032005 Ga0307411_10891517 Ga0307411_108915171 142
121 3300032005 Ga0307411_10947420 Ga0307411_109474201 142
122 3300032126 Ga0307415_101117285 Ga0307415_1011172851 142
123 2162886012 MBSR1b_contig_85263 MBSR1b_0974.00007120 143
124 3300005329 Ga0070683_100462303 Ga0070683_1004623032 143
125 3300005330 Ga0070690_100582091 Ga0070690_1005820912 143
126 3300005331 Ga0070670_101035641 Ga0070670_1010356411 143
127 3300005334 Ga0068869_101230190 Ga0068869_1012301901 143
128 3300005337 Ga0070682_101576285 Ga0070682_1015762851 143
129 3300005355 Ga0070671_100117888 Ga0070671_1001178882 143
130 3300005364 Ga0070673_100947996 Ga0070673_1009479961 143
131 3300005364 Ga0070673_101177529 Ga0070673_1011775291 143
132 3300005364 Ga0070673_101263588 Ga0070673_1012635881 143
133 3300005366 Ga0070659_101615403 Ga0070659_1016154031 143
134 3300005367 Ga0070667_100317309 Ga0070667_1003173092 143
135 3300005539 Ga0068853_100458798 Ga0068853_1004587982 143
136 3300005543 Ga0070672_100378428 Ga0070672_1003784282 143
137 3300005578 Ga0068854_101118609 Ga0068854_1011186091 143
138 3300005616 Ga0068852_100067225 Ga0068852_1000672253 143
139 3300005616 Ga0068852_102794464 Ga0068852_1027944641 143
140 3300005618 Ga0068864_100700132 Ga0068864_1007001322 143
141 3300009177 Ga0105248_10947867 Ga0105248_109478671 143
142 3300010375 Ga0105239_10038622 Ga0105239_100386222 143
143 3300013100 Ga0157373_10145281 Ga0157373_101452812 143
144 3300013104 Ga0157370_10021726 Ga0157370_100217262 143
145 3300013104 Ga0157370_10233290 Ga0157370_102332902 143
146 3300013105 Ga0157369_10239413 Ga0157369_102394132 143
147 3300013306 Ga0163162_10459772 Ga0163162_104597722 143
148 3300013306 Ga0163162_10568041 Ga0163162_105680412 143
149 3300013306 Ga0163162_12102026 Ga0163162_121020261 143
150 3300013308 Ga0157375_10392263 Ga0157375_103922632 143
151 3300014969 Ga0157376_11015895 Ga0157376_110158952 143
152 3300017792 Ga0163161_10476380 Ga0163161_104763802 143
153 3300025920 Ga0207649_10146388 Ga0207649_101463882 143
154 3300025921 Ga0207652_10117277 Ga0207652_101172772 143
155 3300025925 Ga0207650_10115493 Ga0207650_101154931 143
156 3300025931 Ga0207644_10211899 Ga0207644_102118992 143
157 3300025933 Ga0207706_10768451 Ga0207706_107684512 143
158 3300025944 Ga0207661_11871985 Ga0207661_118719851 143
159 3300025960 Ga0207651_10972712 Ga0207651_109727121 143
160 3300025960 Ga0207651_11524967 Ga0207651_115249672 143
161 3300026118 Ga0207675_101650622 Ga0207675_1016506221 143
162 3300026142 Ga0207698_10493495 Ga0207698_104934952 143
163 3300031548 Ga0307408_100157857 Ga0307408_1001578572 143
164 3300031548 Ga0307408_100236195 Ga0307408_1002361951 143
165 3300031731 Ga0307405_10002792 Ga0307405_100027922 143
166 3300031731 Ga0307405_10310685 Ga0307405_103106853 143
167 3300031824 Ga0307413_10314495 Ga0307413_103144952 143
168 3300031852 Ga0307410_10042711 Ga0307410_100427112 143
169 3300031852 Ga0307410_10077444 Ga0307410_100774442 143
170 3300031852 Ga0307410_11432134 Ga0307410_114321342 143
171 3300031901 Ga0307406_10081086 Ga0307406_100810861 143
172 3300031903 Ga0307407_10002585 Ga0307407_100025856 143
173 3300031903 Ga0307407_10313991 Ga0307407_103139911 143
174 3300031911 Ga0307412_10009072 Ga0307412_100090722 143
175 3300031911 Ga0307412_11224935 Ga0307412_112249352 143
176 3300031995 Ga0307409_100236277 Ga0307409_1002362773 143
177 3300031995 Ga0307409_100733221 Ga0307409_1007332211 143
178 3300032002 Ga0307416_100048244 Ga0307416_1000482443 143
179 3300032004 Ga0307414_10135123 Ga0307414_101351232 143
180 3300032004 Ga0307414_10149419 Ga0307414_101494192 143
181 3300032004 Ga0307414_10194101 Ga0307414_101941012 143
182 3300032004 Ga0307414_10312440 Ga0307414_103124401 143
183 3300032005 Ga0307411_10018389 Ga0307411_100183891 143
184 3300032005 Ga0307411_10081436 Ga0307411_100814363 143
185 3300032126 Ga0307415_100024477 Ga0307415_1000244772 143
186 3300032126 Ga0307415_100820851 Ga0307415_1008208511 143
187 3300032126 Ga0307415_101223362 Ga0307415_1012233622 143
188 3300046543 Ga0495645_0534814 Ga0495645_0534814_55_486 143
189 3300049654 Ga0501207_112942 Ga0501207_112942_56_487 143
190 3300049669 Ga0501235_100729 Ga0501235_100729_66_521 143
191 3300049674 Ga0501242_009640 Ga0501242_009640_672_1127 143
192 3300049679 Ga0501249_024607 Ga0501249_024607_735_1166 143
193 3300049704 Ga0501221_063606 Ga0501221_063606_91_546 143
194 3300049706 Ga0501229_049192 Ga0501229_049192_32_487 143
195 3300049760 Ga0501263_007799 Ga0501263_007799_584_1015 143
196 3300049764 Ga0501267_011912 Ga0501267_011912_434_865 143
197 3300049765 Ga0501268_005930 Ga0501268_005930_23_454 143
198 3300049770 Ga0501273_067058 Ga0501273_067058_105_536 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04134

DCC1-like

DCC1-like thiol-disulfide oxidoreductase

5

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c10-assembly1.cif.gz_A dithiol cgrx1 0.7122 2 79
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.7115 1 32
3hyp-assembly1.cif.gz_A crystal structure of bacteroides fragilis trxp_s105g mutant 0.7061 2 52
4fiw-assembly1.cif.gz_A x-ray crystal structure of corynebacterium glutamicum nrdh-redoxin at 1.5a 0.6638 2 79
2p5q-assembly2.cif.gz_D crystal structure of the poplar glutathione peroxidase 5 in the reduced form 0.6558 2 34
ID Description Score Start End Superfamily
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8119 6 125 3.40.30.10
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8035 6 125 3.40.30.10
af_A0A0R0FU59_17_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7924 9 126 3.40.30.10
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7922 6 125 3.40.30.10
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7842 6 125 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V8RU65-F1-model_v4 Thiol-disulfide oxidoreductase 0.9179 1 142 GO:0015035
AF-A0A1I1PFU8-F1-model_v4 Predicted thiol-disulfide oxidoreductase YuxK, DCC family 0.9113 32 143 GO:0015035
AF-A0A2V8RU65-F1-model_v4 Thiol-disulfide oxidoreductase 0.9111 1 142 GO:0015035
AF-A0A2G5RMC8-F1-model_v4 Thiol-disulfide oxidoreductase DCC family protein 0.9104 1 142 GO:0015035
GO:0016020
AF-A0A3M1TJZ4-F1-model_v4 DUF393 domain-containing protein 0.9094 3 142 GO:0015035

Feature Viewer

pLDDT pTM Quality
81.09 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map