F304645

General Info

Members Datasets Scaffolds Average Seq Length
198 170 139 135

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10049991|Ga0307406_100499912
Length 142
Sequence MTVTIYHNPECGTSRNTLAMIRQSGVEPIVIEYLKNPPSRERIMELVSAAGMTLRQAIRQKDTPYEELGLAEVADSVLLDALEKHPILLNRPFVETPIGTRLCRPSEVVLDILENPDIGPFTKEDGEVIIDAAGKRVAPKAI

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
3 2512875024 Mesorhizobium loti R88b Isolate Nodule
4 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
5 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
6 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
7 2643221580 Devosia sp. Root635 Isolate Unclassified
8 2643221591 Devosia sp. Root685 Isolate Unclassified
9 2643221674 Devosia sp. Root436 Isolate Unclassified
10 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2751185800 Brucella pituitosa AA2 Isolate Unclassified
12 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
13 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
14 2854911287 Brucella lupini LUP21 Isolate Unclassified
15 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
16 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
17 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
18 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
19 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
20 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
21 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
22 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
23 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
24 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
25 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
26 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
27 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
28 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
29 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
30 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
31 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
32 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
33 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
34 2919513703 Luteimonas sp. 3794 Isolate Unclassified
35 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
36 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
37 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
38 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
39 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
40 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
41 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
42 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
43 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
44 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
45 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
46 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
47 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
48 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
49 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
50 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
51 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
52 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
53 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
54 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
55 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
56 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
163 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
166 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
167 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
168 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
169 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
170 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.2
Metatranscriptomes 0
Isolates 29.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.59
Nodule 20.71
Rhizoplane 7.07
Rhizosphere 44.44
Stem 0
Stem Tuber 0
Unclassified 19.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000512 3300002704 Bacteria 9236
2 rootH2_10102548 3300003320 Bacteria 3886
3 rootH1_10193609 3300003323 Bacteria 1910
4 Ga0055542_1008351 3300003762 Bacteria 2033
5 Ga0070658_10049376 3300005327 Bacteria 3408
6 Ga0070658_10137866 3300005327 Bacteria 2037
7 Ga0070676_10038683 3300005328 Bacteria 2756
8 Ga0070683_100153023 3300005329 Bacteria 2187
9 Ga0068868_100352893 3300005338 Bacteria 1260
10 Ga0070660_100010526 3300005339 Bacteria 6535
11 Ga0070668_100017910 3300005347 Bacteria 5313
12 Ga0070675_100171344 3300005354 Bacteria 1872
13 Ga0070674_100023271 3300005356 Bacteria 4007
14 Ga0070673_100234007 3300005364 Bacteria 1595
15 Ga0070659_100026549 3300005366 Bacteria 4457
16 Ga0070659_100260450 3300005366 Bacteria 1439
17 Ga0070667_100036984 3300005367 Bacteria 4093
18 Ga0070663_100535835 3300005455 Bacteria 977
19 Ga0070678_100588847 3300005456 Bacteria 992
20 Ga0068867_100202799 3300005459 Bacteria 1589
21 Ga0068867_100548389 3300005459 Bacteria 1001
22 Ga0068853_100008693 3300005539 Bacteria 8167
23 Ga0068853_100204272 3300005539 Bacteria 1799
24 Ga0070672_100523433 3300005543 Bacteria 1027
25 Ga0070665_100460446 3300005548 Bacteria 1282
26 Ga0070665_101362728 3300005548 Bacteria 719
27 Ga0068855_101120936 3300005563 Bacteria 821
28 Ga0068854_100028886 3300005578 Bacteria 3835
29 Ga0068856_100225914 3300005614 Bacteria 1887
30 Ga0068852_100031518 3300005616 Bacteria 4376
31 Ga0068858_100680604 3300005842 Bacteria 1000
32 Ga0075365_10013049 3300006038 Bacteria 4955
33 Ga0075365_10464160 3300006038 Bacteria 894
34 Ga0075364_10036069 3300006051 Bacteria 3197
35 Ga0070712_100211013 3300006175 Bacteria 1531
36 Ga0075370_10316424 3300006353 Bacteria 929
37 Ga0068871_100464564 3300006358 Bacteria 1136
38 Ga0105240_11152495 3300009093 Bacteria 823
39 Ga0105245_11374122 3300009098 Bacteria 756
40 Ga0105245_12070264 3300009098 Bacteria 623
41 Ga0105242_10805919 3300009176 Bacteria 930
42 Ga0105248_11701443 3300009177 Bacteria 715
43 Ga0105237_10063403 3300009545 Bacteria 3693
44 Ga0105238_10572776 3300009551 Bacteria 1135
45 Ga0105238_11618945 3300009551 Bacteria 678
46 Ga0105239_10700336 3300010375 Bacteria 1158
47 Ga0157370_10355879 3300013104 Bacteria 1349
48 Ga0157370_11938100 3300013104 Bacteria 528
49 Ga0157374_10430388 3300013296 Bacteria 1319
50 Ga0157374_10563899 3300013296 Bacteria 1147
51 Ga0182007_10179882 3300015262 Bacteria 731
52 Ga0209026_1000083 3300025250 Bacteria 190199
53 Ga0209148_1010750 3300025254 Bacteria 1726
54 Ga0209759_1000310 3300025256 Bacteria 65918
55 Ga0207680_11118168 3300025903 Bacteria 563
56 Ga0207647_10092371 3300025904 Bacteria 1804
57 Ga0207654_10135814 3300025911 Bacteria 1562
58 Ga0207657_10008109 3300025919 Bacteria 10710
59 Ga0207649_10024315 3300025920 Bacteria 3520
60 Ga0207687_11244378 3300025927 Bacteria 640
61 Ga0207706_10019898 3300025933 Bacteria 6034
62 Ga0207691_10452160 3300025940 Bacteria 1093
63 Ga0207711_11271603 3300025941 Bacteria 678
64 Ga0207651_10656386 3300025960 Bacteria 921
65 Ga0207640_10273276 3300025981 Bacteria 1323
66 Ga0207658_10072365 3300025986 Bacteria 2613
67 Ga0207677_10027534 3300026023 Bacteria 3582
68 Ga0207703_10838591 3300026035 Bacteria 879
69 Ga0207639_10051362 3300026041 Bacteria 3135
70 Ga0207639_10105585 3300026041 Bacteria 2285
71 Ga0207678_10504833 3300026067 Bacteria 1054
72 Ga0207648_10176445 3300026089 Bacteria 1890
73 Ga0207683_10515199 3300026121 Bacteria 1105
74 Ga0307515_10100161 3300028794 Bacteria 3511
75 Ga0265328_10006294 3300031239 Bacteria 5040
76 Ga0307405_10048998 3300031731 Bacteria 2609
77 Ga0307405_10107489 3300031731 Bacteria 1883
78 Ga0307413_10035214 3300031824 Bacteria 2869
79 Ga0307406_10049991 3300031901 Bacteria 2648
80 Ga0307412_10701715 3300031911 Bacteria 869
81 Ga0307414_10003119 3300032004 Bacteria 8794
82 Ga0307414_10016950 3300032004 Bacteria 4446
83 Ga0307414_10041312 3300032004 Bacteria 3123
84 Ga0307411_10358619 3300032005 Bacteria 1191
85 Ga0439436_0001156 3300041404 Bacteria 7494
86 Ga0439465_0042320 3300041413 Bacteria 1476
87 Ga0451841_1051608 3300041498 Bacteria 534
88 Ga0439445_0137850 3300042004 Bacteria 706
89 Ga0439434_0099177 3300042435 Bacteria 938
90 Ga0466965_0232003 3300044683 Bacteria 986
91 Ga0453684_1039889 3300044712 Bacteria 869
92 Ga0466960_0685177 3300044901 Bacteria 614
93 Ga0495638_0023743 3300046460 Bacteria 4005
94 Ga0496104_0005685 3300048907 Bacteria 10915
95 Ga0496104_0053361 3300048907 Bacteria 3819
96 Ga0496105_0008654 3300048908 Bacteria 7914
97 Ga0496108_0006962 3300048911 Bacteria 9151
98 Ga0496109_0001214 3300048912 Bacteria 21407
99 Ga0496110_0004773 3300048913 Bacteria 10558
100 Ga0496111_0209316 3300048914 Bacteria 1449
101 Ga0496111_0847439 3300048914 Bacteria 660
102 Ga0496112_0017214 3300048915 Bacteria 6786
103 Ga0496112_0383535 3300048915 Bacteria 1346
104 Ga0496112_1045468 3300048915 Bacteria 736
105 Ga0496113_0248263 3300048916 Bacteria 1420
106 Ga0496114_0681729 3300048917 Bacteria 902
107 Ga0496115_0353551 3300048918 Bacteria 1198
108 Ga0496116_0184137 3300048919 Bacteria 1114
109 Ga0496116_0382561 3300048919 Bacteria 630
110 Ga0496117_0288476 3300048920 Bacteria 875
111 Ga0496118_0160023 3300048921 Bacteria 1394
112 Ga0496121_0041297 3300048924 Bacteria 4034
113 Ga0496121_0224631 3300048924 Bacteria 1320
114 Ga0496122_0025142 3300048925 Bacteria 5185
115 Ga0496123_0401339 3300048926 Bacteria 624
116 Ga0496124_0101199 3300048927 Bacteria 2335
117 Ga0496124_0172414 3300048927 Bacteria 1674
118 Ga0496125_0000101 3300048928 Bacteria 202248
119 Ga0496125_0000332 3300048928 Bacteria 90664
120 Ga0496125_0000375 3300048928 Bacteria 83813
121 Ga0496125_0220469 3300048928 Bacteria 1223
122 Ga0496126_0179505 3300048929 Bacteria 1799
123 Ga0501034_0001547 3300049571 Bacteria 30190
124 Ga0501034_0387005 3300049571 Bacteria 1323
125 Ga0501034_0876799 3300049571 Bacteria 786
126 Ga0501036_0662284 3300049572 Bacteria 864
127 Ga0501043_1306612 3300049579 Bacteria 506
128 Ga0501035_0039586 3300049822 Bacteria 4265
129 nmdc:mga03683_192562_c1 3300050489 Bacteria 933
130 nmdc:mga00v17_610770_c1 3300050491 Bacteria 703
131 nmdc:mga0yw44_102466_c1 3300050492 Bacteria 1825
132 nmdc:mga0yw44_654090_c1 3300050492 Bacteria 714
133 nmdc:mga07m45_198531_c1 3300050496 Bacteria 1167
134 Ga0500562_095123 3300053108 Bacteria 810
135 Ga0500604_0000991 3300053151 Bacteria 7899
136 Ga0500616_0026997 3300053153 Bacteria 3174
137 Ga0500616_0056128 3300053153 Bacteria 2056
138 Ga0500624_132687 3300053157 Bacteria 529
139 Ga0500634_0037370 3300053161 Bacteria 2641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053108 Ga0500562_095123 Ga0500562_095123_48_395 115
2 3300003323 rootH1_10193609 rootH1_101936094 119
3 3300005328 Ga0070676_10038683 Ga0070676_100386835 121
4 3300005354 Ga0070675_100171344 Ga0070675_1001713443 121
5 3300005356 Ga0070674_100023271 Ga0070674_1000232715 121
6 3300005364 Ga0070673_100234007 Ga0070673_1002340073 121
7 3300005456 Ga0070678_100588847 Ga0070678_1005888471 121
8 3300005459 Ga0068867_100548389 Ga0068867_1005483892 121
9 3300005543 Ga0070672_100523433 Ga0070672_1005234332 121
10 3300005548 Ga0070665_100460446 Ga0070665_1004604462 121
11 3300009176 Ga0105242_10805919 Ga0105242_108059191 121
12 3300010375 Ga0105239_10700336 Ga0105239_107003362 121
13 3300025940 Ga0207691_10452160 Ga0207691_104521602 121
14 3300025960 Ga0207651_10656386 Ga0207651_106563862 121
15 3300049579 Ga0501043_1306612 Ga0501043_1306612_99_464 121
16 3300050492 nmdc:mga0yw44_654090_c1 nmdc:mga0yw44_654090_c1_46_411 121
17 3300005327 Ga0070658_10049376 Ga0070658_100493764 122
18 3300005329 Ga0070683_100153023 Ga0070683_1001530234 122
19 3300005338 Ga0068868_100352893 Ga0068868_1003528932 122
20 3300005339 Ga0070660_100010526 Ga0070660_1000105267 122
21 3300005455 Ga0070663_100535835 Ga0070663_1005358351 122
22 3300005459 Ga0068867_100202799 Ga0068867_1002027992 122
23 3300005539 Ga0068853_100008693 Ga0068853_1000086934 122
24 3300005578 Ga0068854_100028886 Ga0068854_1000288862 122
25 3300005616 Ga0068852_100031518 Ga0068852_1000315185 122
26 3300006358 Ga0068871_100464564 Ga0068871_1004645642 122
27 3300025911 Ga0207654_10135814 Ga0207654_101358143 122
28 3300025919 Ga0207657_10008109 Ga0207657_1000810910 122
29 3300025981 Ga0207640_10273276 Ga0207640_102732762 122
30 3300026023 Ga0207677_10027534 Ga0207677_100275342 122
31 3300026041 Ga0207639_10105585 Ga0207639_101055854 122
32 3300026067 Ga0207678_10504833 Ga0207678_105048332 122
33 3300026089 Ga0207648_10176445 Ga0207648_101764452 122
34 3300049571 Ga0501034_0001547 Ga0501034_0001547_15953_16345 124
35 3300049571 Ga0501034_0876799 Ga0501034_0876799_289_702 126
36 3300041413 Ga0439465_0042320 Ga0439465_0042320_689_1108 129
37 3300005842 Ga0068858_100680604 Ga0068858_1006806042 130
38 3300009177 Ga0105248_11701443 Ga0105248_117014431 130
39 3300025941 Ga0207711_11271603 Ga0207711_112716031 130
40 3300026035 Ga0207703_10838591 Ga0207703_108385912 130
41 iso_pu_bacteria 2919513703 2919516749 130
42 iso_pu_bacteria 2643221580 2643911150 133
43 iso_pu_bacteria 2751185800 2753361020 133
44 iso_pu_bacteria 2758568016 2758637747 133
45 iso_pu_bacteria 2854911287 2854915451 133
46 3300009098 Ga0105245_11374122 Ga0105245_113741222 134
47 3300013104 Ga0157370_10355879 Ga0157370_103558792 134
48 3300025920 Ga0207649_10024315 Ga0207649_100243152 134
49 3300025927 Ga0207687_11244378 Ga0207687_112443781 134
50 3300048920 Ga0496117_0288476 Ga0496117_0288476_291_695 134
51 3300048921 Ga0496118_0160023 Ga0496118_0160023_766_1170 134
52 iso_pu_bacteria 2965062239 2965067103 134
53 3300041498 Ga0451841_1051608 Ga0451841_1051608_48_455 135
54 3300053153 Ga0500616_0056128 Ga0500616_0056128_390_797 135
55 iso_pu_bacteria 2856342000 2856344624 135
56 iso_pu_bacteria 2888343758 2888344805 135
57 iso_pu_bacteria 2924754689 2924758584 135
58 iso_pu_bacteria 2970524798 2970526537 135
59 iso_pu_bacteria 2970540015 2970545020 135
60 iso_pu_bacteria 8004395343 8004399338 135
61 3300026121 Ga0207683_10515199 Ga0207683_105151991 136
62 3300044712 Ga0453684_1039889 Ga0453684_1039889_372_785 136
63 3300050489 nmdc:mga03683_192562_c1 nmdc:mga03683_192562_c1_440_895 136
64 iso_pu_bacteria 2509276018 2509372938 136
65 iso_pu_bacteria 2512875016 2512931925 136
66 iso_pu_bacteria 2512875024 2512959872 136
67 iso_pu_bacteria 2513237164 2514036105 136
68 iso_pu_bacteria 2513237305 2514419508 136
69 iso_pu_bacteria 2588253730 2588517780 136
70 iso_pu_bacteria 2643221591 2643965484 136
71 iso_pu_bacteria 2643221674 2644411388 136
72 iso_pu_bacteria 2721755686 2723577384 136
73 iso_pu_bacteria 2841734538 2841736834 136
74 iso_pu_bacteria 2869162929 2869167505 136
75 iso_pu_bacteria 2869249662 2869256654 136
76 iso_pu_bacteria 2869264136 2869268312 136
77 iso_pu_bacteria 2871459585 2871461145 136
78 iso_pu_bacteria 2871474448 2871480510 136
79 iso_pu_bacteria 2874123672 2874127536 136
80 iso_pu_bacteria 2874131515 2874135929 136
81 iso_pu_bacteria 2876363079 2876368913 136
82 iso_pu_bacteria 2878788777 2878795035 136
83 iso_pu_bacteria 2882632389 2882635043 136
84 iso_pu_bacteria 2885312484 2885313688 136
85 iso_pu_bacteria 2903448605 2903450862 136
86 iso_pu_bacteria 2903521522 2903527911 136
87 iso_pu_bacteria 2903528002 2903529777 136
88 iso_pu_bacteria 2906363423 2906370061 136
89 iso_pu_bacteria 2906370794 2906371324 136
90 iso_pu_bacteria 2906393657 2906396464 136
91 iso_pu_bacteria 2937836603 2937841314 136
92 iso_pu_bacteria 2937848649 2937852625 136
93 iso_pu_bacteria 2958071322 2958073112 136
94 iso_pu_bacteria 2958122699 2958124946 136
95 iso_pu_bacteria 2963644680 2963647283 136
96 iso_pu_bacteria 2965040258 2965045562 136
97 iso_pu_bacteria 2965089291 2965093953 136
98 iso_pu_bacteria 2968083720 2968087882 136
99 iso_pu_bacteria 2977872689 2977877444 136
100 iso_pu_bacteria 2977915119 2977918557 136
101 iso_pu_bacteria 2977922695 2977924964 136
102 iso_pu_bacteria 2977950692 2977956463 136
103 iso_pu_bacteria 2977986579 2977989563 136
104 iso_pu_bacteria 3004195979 3004198797 136
105 iso_pu_bacteria 3004211236 3004211976 136
106 iso_pu_bacteria 3004218560 3004224641 136
107 iso_pu_bacteria 3004334049 3004334966 136
108 iso_pu_bacteria 637000159 637075022 136
109 iso_pu_bacteria 8004633249 8004635247 136
110 iso_pu_bacteria 8055617313 8055618360 136
111 3300025250 Ga0209026_1000083 Ga0209026_100008392 137
112 3300025256 Ga0209759_1000310 Ga0209759_100031060 137
113 3300048925 Ga0496122_0025142 Ga0496122_0025142_2688_3101 137
114 3300048926 Ga0496123_0401339 Ga0496123_0401339_63_476 137
115 3300048928 Ga0496125_0000101 Ga0496125_0000101_83281_83694 137
116 3300025903 Ga0207680_11118168 Ga0207680_111181681 138
117 3300031239 Ga0265328_10006294 Ga0265328_100062945 138
118 3300048914 Ga0496111_0847439 Ga0496111_0847439_231_647 138
119 3300048915 Ga0496112_1045468 Ga0496112_1045468_125_541 138
120 3300005327 Ga0070658_10137866 Ga0070658_101378661 139
121 3300006175 Ga0070712_100211013 Ga0070712_1002110131 139
122 3300028794 Ga0307515_10100161 Ga0307515_101001612 139
123 3300048907 Ga0496104_0005685 Ga0496104_0005685_9095_9514 139
124 3300048908 Ga0496105_0008654 Ga0496105_0008654_1721_2140 139
125 3300048911 Ga0496108_0006962 Ga0496108_0006962_8385_8804 139
126 3300048912 Ga0496109_0001214 Ga0496109_0001214_2484_2903 139
127 3300048913 Ga0496110_0004773 Ga0496110_0004773_4862_5281 139
128 3300048915 Ga0496112_0017214 Ga0496112_0017214_328_747 139
129 3300048916 Ga0496113_0248263 Ga0496113_0248263_547_966 139
130 3300048928 Ga0496125_0220469 Ga0496125_0220469_122_547 139
131 3300049571 Ga0501034_0387005 Ga0501034_0387005_237_656 139
132 3300053161 Ga0500634_0037370 Ga0500634_0037370_414_833 139
133 3300003320 rootH2_10102548 rootH2_101025485 140
134 3300003762 Ga0055542_1008351 Ga0055542_10083512 140
135 3300005347 Ga0070668_100017910 Ga0070668_1000179107 140
136 3300005366 Ga0070659_100026549 Ga0070659_1000265493 140
137 3300005366 Ga0070659_100260450 Ga0070659_1002604502 140
138 3300005367 Ga0070667_100036984 Ga0070667_1000369843 140
139 3300005539 Ga0068853_100204272 Ga0068853_1002042723 140
140 3300005548 Ga0070665_101362728 Ga0070665_1013627281 140
141 3300005563 Ga0068855_101120936 Ga0068855_1011209362 140
142 3300005614 Ga0068856_100225914 Ga0068856_1002259143 140
143 3300006038 Ga0075365_10013049 Ga0075365_100130495 140
144 3300006038 Ga0075365_10464160 Ga0075365_104641602 140
145 3300006051 Ga0075364_10036069 Ga0075364_100360694 140
146 3300006353 Ga0075370_10316424 Ga0075370_103164242 140
147 3300009093 Ga0105240_11152495 Ga0105240_111524952 140
148 3300009098 Ga0105245_12070264 Ga0105245_120702642 140
149 3300009545 Ga0105237_10063403 Ga0105237_100634034 140
150 3300009551 Ga0105238_10572776 Ga0105238_105727763 140
151 3300009551 Ga0105238_11618945 Ga0105238_116189452 140
152 3300013104 Ga0157370_11938100 Ga0157370_119381001 140
153 3300013296 Ga0157374_10430388 Ga0157374_104303882 140
154 3300013296 Ga0157374_10563899 Ga0157374_105638992 140
155 3300015262 Ga0182007_10179882 Ga0182007_101798821 140
156 3300025254 Ga0209148_1010750 Ga0209148_10107502 140
157 3300025904 Ga0207647_10092371 Ga0207647_100923713 140
158 3300025933 Ga0207706_10019898 Ga0207706_100198984 140
159 3300025986 Ga0207658_10072365 Ga0207658_100723654 140
160 3300026041 Ga0207639_10051362 Ga0207639_100513625 140
161 3300031731 Ga0307405_10048998 Ga0307405_100489982 140
162 3300031731 Ga0307405_10107489 Ga0307405_101074891 140
163 3300031824 Ga0307413_10035214 Ga0307413_100352142 140
164 3300031911 Ga0307412_10701715 Ga0307412_107017152 140
165 3300032004 Ga0307414_10003119 Ga0307414_100031195 140
166 3300032004 Ga0307414_10016950 Ga0307414_100169506 140
167 3300032004 Ga0307414_10041312 Ga0307414_100413125 140
168 3300032005 Ga0307411_10358619 Ga0307411_103586192 140
169 3300042004 Ga0439445_0137850 Ga0439445_0137850_256_678 140
170 3300042435 Ga0439434_0099177 Ga0439434_0099177_13_435 140
171 3300044683 Ga0466965_0232003 Ga0466965_0232003_165_587 140
172 3300044901 Ga0466960_0685177 Ga0466960_0685177_129_551 140
173 3300048907 Ga0496104_0053361 Ga0496104_0053361_2584_3006 140
174 3300048914 Ga0496111_0209316 Ga0496111_0209316_476_898 140
175 3300048915 Ga0496112_0383535 Ga0496112_0383535_749_1171 140
176 3300048917 Ga0496114_0681729 Ga0496114_0681729_199_621 140
177 3300048918 Ga0496115_0353551 Ga0496115_0353551_244_666 140
178 3300048919 Ga0496116_0184137 Ga0496116_0184137_343_765 140
179 3300048919 Ga0496116_0382561 Ga0496116_0382561_76_498 140
180 3300048924 Ga0496121_0041297 Ga0496121_0041297_863_1285 140
181 3300048924 Ga0496121_0224631 Ga0496121_0224631_30_452 140
182 3300048927 Ga0496124_0101199 Ga0496124_0101199_626_1048 140
183 3300048927 Ga0496124_0172414 Ga0496124_0172414_243_665 140
184 3300048928 Ga0496125_0000332 Ga0496125_0000332_16521_16943 140
185 3300048928 Ga0496125_0000375 Ga0496125_0000375_3271_3693 140
186 3300048929 Ga0496126_0179505 Ga0496126_0179505_436_858 140
187 3300049572 Ga0501036_0662284 Ga0501036_0662284_212_634 140
188 3300049822 Ga0501035_0039586 Ga0501035_0039586_2274_2696 140
189 3300050491 nmdc:mga00v17_610770_c1 nmdc:mga00v17_610770_c1_261_683 140
190 3300050492 nmdc:mga0yw44_102466_c1 nmdc:mga0yw44_102466_c1_608_1030 140
191 3300050496 nmdc:mga07m45_198531_c1 nmdc:mga07m45_198531_c1_446_868 140
192 3300053151 Ga0500604_0000991 Ga0500604_0000991_5323_5745 140
193 3300053153 Ga0500616_0026997 Ga0500616_0026997_2284_2706 140
194 3300053157 Ga0500624_132687 Ga0500624_132687_16_438 140
195 3300031901 Ga0307406_10049991 Ga0307406_100499912 141
196 3300046460 Ga0495638_0023743 Ga0495638_0023743_3089_3514 141
197 3300002704 JGI25155J39150_1000512 JGI25155J39150_100051211 143
198 3300041404 Ga0439436_0001156 Ga0439436_0001156_4260_4706 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

6

112

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9448 3 139
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9443 3 139
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.944 3 139
1j9b-assembly1.cif.gz_A arsenate reductase+0.4m arsenite from e. coli 0.9439 3 139
1sk0-assembly1.cif.gz_A arsenate reductase r60a mutant +0.4m arsenite from e. coli 0.9435 3 139
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9439 3 139 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9369 3 114 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9307 3 139 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9135 3 114 3.40.30.10
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8808 3 31 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A2W4YC61-F1-model_v4 deleted 0.9962 4 92
AF-A0A2Z2GTY5-F1-model_v4 Arsenate reductase 0.9933 27 116 GO:0046685
AF-A0A1B3Z4G7-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9929 15 112 GO:0008794
GO:0046685
AF-A0A527ZCM3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9877 1 116 GO:0008794
GO:0046685
AF-A0A659UVR1-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9865 1 118 GO:0008794
GO:0046685

Feature Viewer

pLDDT pTM Quality
88.04 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map