F304259

General Info

Members Datasets Scaffolds Average Seq Length
198 139 198 131

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100350204|Ga0068871_1003502042
Length 159
Sequence LKSGRLPINLNWVFSWVRKNNFHFPRADFMEPIAVKIRSLIQLYEILPEHERLMVDVLRQIVKENLPANCKEKMSYNVPFFYGRKGICIVWPSTIPRGGIKQGVLFGFWYGKKLKDIDRYLVHGTNKQVFYKIYQRVEDINERAIVKLLKEAVKVDQQW

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
121 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
133 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
134 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 0
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10138269 3300005289 Bacteria 1546
2 Ga0065712_10405780 3300005290 Bacteria 726
3 Ga0070658_10039069 3300005327 Bacteria 3828
4 Ga0070683_100007500 3300005329 Bacteria 9221
5 Ga0070690_100024024 3300005330 Bacteria 3746
6 Ga0070670_100177331 3300005331 Bacteria 1849
7 Ga0070670_101676396 3300005331 Bacteria 585
8 Ga0070677_10159489 3300005333 Bacteria 1057
9 Ga0070666_10036419 3300005335 Bacteria 3266
10 Ga0070666_10238602 3300005335 Unclassified 1285
11 Ga0070666_10495276 3300005335 Bacteria 886
12 Ga0070680_100045106 3300005336 Bacteria 3583
13 Ga0070682_100008941 3300005337 Bacteria 5660
14 Ga0070682_100799034 3300005337 Bacteria 766
15 Ga0068868_100019409 3300005338 Bacteria 5094
16 Ga0070660_100243481 3300005339 Bacteria 1465
17 Ga0070689_100010582 3300005340 Bacteria 6576
18 Ga0070689_100097171 3300005340 Bacteria 2328
19 Ga0070661_100289477 3300005344 Bacteria 1272
20 Ga0070692_10660101 3300005345 Bacteria 699
21 Ga0070669_100642694 3300005353 Bacteria 892
22 Ga0070669_101201558 3300005353 Bacteria 655
23 Ga0070675_100015919 3300005354 Bacteria 5957
24 Ga0070675_100747355 3300005354 Bacteria 892
25 Ga0070673_100134956 3300005364 Bacteria 2076
26 Ga0070673_100753368 3300005364 Bacteria 897
27 Ga0070673_100923874 3300005364 Bacteria 810
28 Ga0070659_100006225 3300005366 Bacteria 8620
29 Ga0070667_100424130 3300005367 Bacteria 1213
30 Ga0070667_101014024 3300005367 Bacteria 775
31 Ga0070701_10932715 3300005438 Bacteria 601
32 Ga0070700_100109896 3300005441 Bacteria 1831
33 Ga0070700_100488335 3300005441 Bacteria 945
34 Ga0070663_100519333 3300005455 Bacteria 991
35 Ga0070678_100374547 3300005456 Bacteria 1230
36 Ga0070662_100212237 3300005457 Unclassified 1541
37 Ga0070662_100281290 3300005457 Bacteria 1346
38 Ga0070681_10194147 3300005458 Bacteria 1949
39 Ga0068867_100887654 3300005459 Bacteria 801
40 Ga0070685_10003353 3300005466 Bacteria 8151
41 Ga0070698_100020359 3300005471 Bacteria 6953
42 Ga0070698_100029369 3300005471 Bacteria 5708
43 Ga0070698_101532128 3300005471 Bacteria 618
44 Ga0070679_100079183 3300005530 Bacteria 3275
45 Ga0070684_100005929 3300005535 Bacteria 9409
46 Ga0070684_100048104 3300005535 Bacteria 3699
47 Ga0068853_100013639 3300005539 Bacteria 6640
48 Ga0068853_100095065 3300005539 Bacteria 2627
49 Ga0070672_100590073 3300005543 Bacteria 967
50 Ga0070696_101679409 3300005546 Bacteria 547
51 Ga0070693_100228336 3300005547 Bacteria 1223
52 Ga0070664_100007173 3300005564 Bacteria 8984
53 Ga0068857_101049560 3300005577 Bacteria 786
54 Ga0068854_100171667 3300005578 Bacteria 1688
55 Ga0068854_100294140 3300005578 Bacteria 1311
56 Ga0068856_100581178 3300005614 Bacteria 1141
57 Ga0070702_100993170 3300005615 Bacteria 664
58 Ga0068852_100094800 3300005616 Bacteria 2678
59 Ga0068852_100582401 3300005616 Unclassified 1122
60 Ga0068859_100247662 3300005617 Bacteria 1872
61 Ga0068859_101548360 3300005617 Bacteria 732
62 Ga0068864_100460543 3300005618 Bacteria 1217
63 Ga0068864_100659609 3300005618 Bacteria 1019
64 Ga0068864_102479203 3300005618 Bacteria 525
65 Ga0068866_10396775 3300005718 Bacteria 889
66 Ga0068861_100092743 3300005719 Bacteria 2386
67 Ga0068861_100147598 3300005719 Bacteria 1926
68 Ga0068851_10175630 3300005834 Bacteria 1184
69 Ga0068870_10639466 3300005840 Unclassified 727
70 Ga0068870_10732217 3300005840 Unclassified 685
71 Ga0068863_100302300 3300005841 Unclassified 1552
72 Ga0068863_100502179 3300005841 Unclassified 1194
73 Ga0068863_100576456 3300005841 Unclassified 1112
74 Ga0068858_100617509 3300005842 Bacteria 1052
75 Ga0068860_102608102 3300005843 Unclassified 524
76 Ga0068862_101590327 3300005844 Unclassified 660
77 Ga0097621_100387838 3300006237 Bacteria 1249
78 Ga0068871_100350204 3300006358 Unclassified 1306
79 Ga0068871_100391877 3300006358 Bacteria 1235
80 Ga0068871_100583069 3300006358 Bacteria 1015
81 Ga0075428_100027061 3300006844 Bacteria 6349
82 Ga0075428_100070425 3300006844 Bacteria 3823
83 Ga0075430_100005341 3300006846 Bacteria 10849
84 Ga0075431_100095444 3300006847 Unclassified 3070
85 Ga0075431_101440168 3300006847 Unclassified 648
86 Ga0075429_100002616 3300006880 Bacteria 15180
87 Ga0075429_100166579 3300006880 Bacteria 1930
88 Ga0068865_100685309 3300006881 Bacteria 874
89 Ga0097620_100247653 3300006931 Bacteria 1872
90 Ga0097620_100849930 3300006931 Unclassified 999
91 Ga0097620_101548817 3300006931 Bacteria 732
92 Ga0114129_13284378 3300009147 Unclassified 523
93 Ga0105243_10527134 3300009148 Bacteria 1124
94 Ga0105241_10825465 3300009174 Bacteria 856
95 Ga0105242_10827649 3300009176 Bacteria 919
96 Ga0105248_12381980 3300009177 Unclassified 603
97 Ga0105249_10010240 3300009553 Bacteria 8235
98 Ga0105249_10039710 3300009553 Bacteria 4273
99 Ga0105249_11340384 3300009553 Bacteria 787
100 Ga0105239_10629364 3300010375 Bacteria 1225
101 Ga0105239_11421801 3300010375 Unclassified 801
102 Ga0105239_13098659 3300010375 Bacteria 542
103 Ga0105246_10039515 3300011119 Unclassified 3179
104 Ga0105246_10169459 3300011119 Bacteria 1671
105 Ga0105246_10321410 3300011119 Bacteria 1258
106 Ga0157373_10007909 3300013100 Bacteria 7911
107 Ga0157371_10572895 3300013102 Bacteria 838
108 Ga0157369_10699747 3300013105 Bacteria 1044
109 Ga0157374_10388879 3300013296 Bacteria 1390
110 Ga0157374_12482946 3300013296 Bacteria 546
111 Ga0157378_10019869 3300013297 Bacteria 5905
112 Ga0163162_10230074 3300013306 Bacteria 1984
113 Ga0163162_10276034 3300013306 Bacteria 1813
114 Ga0163162_11081388 3300013306 Bacteria 908
115 Ga0157372_11090087 3300013307 Bacteria 924
116 Ga0157375_10283246 3300013308 Bacteria 1821
117 Ga0157375_10563639 3300013308 Bacteria 1300
118 Ga0157375_13355941 3300013308 Unclassified 533
119 Ga0157377_10310389 3300014745 Bacteria 1044
120 Ga0157379_10061916 3300014968 Bacteria 3347
121 Ga0157376_10393921 3300014969 Bacteria 1337
122 Ga0157376_10915244 3300014969 Bacteria 896
123 Ga0157376_11012545 3300014969 Bacteria 854
124 Ga0163161_10027196 3300017792 Bacteria 4057
125 Ga0163161_10106348 3300017792 Bacteria 2094
126 Ga0207697_10166026 3300025315 Unclassified 964
127 Ga0207656_10134460 3300025321 Bacteria 1161
128 Ga0207680_10051092 3300025903 Unclassified 2471
129 Ga0207647_10351614 3300025904 Bacteria 834
130 Ga0207643_10416343 3300025908 Unclassified 851
131 Ga0207707_11367547 3300025912 Bacteria 566
132 Ga0207695_10060152 3300025913 Bacteria 3934
133 Ga0207660_10567460 3300025917 Bacteria 923
134 Ga0207662_10153666 3300025918 Bacteria 1466
135 Ga0207662_10265917 3300025918 Bacteria 1130
136 Ga0207657_10006305 3300025919 Bacteria 12325
137 Ga0207649_10234025 3300025920 Bacteria 1315
138 Ga0207652_10471061 3300025921 Bacteria 1131
139 Ga0207681_11252327 3300025923 Bacteria 623
140 Ga0207644_10059795 3300025931 Bacteria 2757
141 Ga0207690_10805865 3300025932 Bacteria 776
142 Ga0207706_10034204 3300025933 Bacteria 4521
143 Ga0207706_10241643 3300025933 Unclassified 1579
144 Ga0207686_10261606 3300025934 Bacteria 1269
145 Ga0207709_10456040 3300025935 Unclassified 989
146 Ga0207670_10082869 3300025936 Bacteria 2248
147 Ga0207704_10616941 3300025938 Bacteria 890
148 Ga0207691_11103227 3300025940 Bacteria 660
149 Ga0207711_11365644 3300025941 Unclassified 651
150 Ga0207689_10104297 3300025942 Bacteria 2330
151 Ga0207661_10285380 3300025944 Bacteria 1476
152 Ga0207661_10526544 3300025944 Bacteria 1081
153 Ga0207679_10317849 3300025945 Bacteria 1347
154 Ga0207667_10345734 3300025949 Bacteria 1517
155 Ga0207651_10599282 3300025960 Bacteria 963
156 Ga0207651_10915758 3300025960 Unclassified 781
157 Ga0207712_10005253 3300025961 Bacteria 8191
158 Ga0207712_10022045 3300025961 Bacteria 4189
159 Ga0207640_11492311 3300025981 Bacteria 607
160 Ga0207677_10294470 3300026023 Bacteria 1338
161 Ga0207702_10344051 3300026078 Bacteria 1425
162 Ga0207641_10083665 3300026088 Unclassified 2776
163 Ga0207641_10104267 3300026088 Bacteria 2503
164 Ga0207648_10612167 3300026089 Bacteria 1005
165 Ga0207648_11110887 3300026089 Bacteria 742
166 Ga0207648_11874048 3300026089 Bacteria 561
167 Ga0207674_10659896 3300026116 Bacteria 1010
168 Ga0207675_100060750 3300026118 Bacteria 3529
169 Ga0207675_100423612 3300026118 Bacteria 1315
170 Ga0207675_101984929 3300026118 Unclassified 599
171 Ga0207683_10194351 3300026121 Bacteria 1843
172 Ga0207698_10315787 3300026142 Bacteria 1461
173 Ga0207698_10514860 3300026142 Unclassified 1167
174 Ga0268265_12034901 3300028380 Unclassified 581
175 Ga0307415_101035656 3300032126 Bacteria 765
176 Ga0373927_0032801 3300035695 Unclassified 3382
177 Ga0439441_019160 3300042001 Bacteria 1242
178 Ga0439443_026107 3300042003 Bacteria 944
179 Ga0439460_0078470 3300042461 Bacteria 1033
180 Ga0466967_0600357 3300045976 Bacteria 1086
181 Ga0495592_0327222 3300046454 Unclassified 989
182 Ga0495638_0108786 3300046460 Bacteria 1648
183 Ga0495648_0029349 3300046524 Unclassified 3652
184 Ga0495621_0150870 3300046539 Bacteria 914
185 Ga0495611_0198112 3300046648 Bacteria 937
186 Ga0495657_0690519 3300046675 Unclassified 587
187 nmdc:mga09592_106167_c1 3300050508 Bacteria 2409
188 nmdc:mga09592_27596_c1 3300050508 Bacteria 4713
189 nmdc:mga06r32_1349116_c1 3300050510 Unclassified 656
190 Ga0500578_0337236 3300053086 Bacteria 885
191 Ga0500646_0004180 3300053090 Unclassified 3664
192 Ga0500583_0000286 3300053092 Bacteria 17541
193 Ga0500642_0235626 3300053130 Bacteria 844
194 Ga0500655_062634 3300053133 Bacteria 751
195 Ga0500568_0009657 3300053139 Bacteria 4570
196 Ga0500616_0079076 3300053153 Bacteria 1657
197 Ga0500616_0140703 3300053153 Bacteria 1128
198 Ga0500622_0002343 3300053156 Bacteria 13790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10039069 Ga0070658_100390692 127
2 3300005329 Ga0070683_100007500 Ga0070683_1000075002 127
3 3300005330 Ga0070690_100024024 Ga0070690_1000240243 127
4 3300005331 Ga0070670_100177331 Ga0070670_1001773312 127
5 3300005335 Ga0070666_10495276 Ga0070666_104952762 127
6 3300005336 Ga0070680_100045106 Ga0070680_1000451062 127
7 3300005337 Ga0070682_100008941 Ga0070682_1000089412 127
8 3300005338 Ga0068868_100019409 Ga0068868_1000194093 127
9 3300005339 Ga0070660_100243481 Ga0070660_1002434812 127
10 3300005344 Ga0070661_100289477 Ga0070661_1002894772 127
11 3300005345 Ga0070692_10660101 Ga0070692_106601011 127
12 3300005353 Ga0070669_100642694 Ga0070669_1006426941 127
13 3300005354 Ga0070675_100015919 Ga0070675_1000159192 127
14 3300005354 Ga0070675_100747355 Ga0070675_1007473552 127
15 3300005364 Ga0070673_100134956 Ga0070673_1001349562 127
16 3300005366 Ga0070659_100006225 Ga0070659_1000062252 127
17 3300005438 Ga0070701_10932715 Ga0070701_109327151 127
18 3300005455 Ga0070663_100519333 Ga0070663_1005193332 127
19 3300005456 Ga0070678_100374547 Ga0070678_1003745472 127
20 3300005457 Ga0070662_100281290 Ga0070662_1002812902 127
21 3300005458 Ga0070681_10194147 Ga0070681_101941471 127
22 3300005459 Ga0068867_100887654 Ga0068867_1008876542 127
23 3300005530 Ga0070679_100079183 Ga0070679_1000791832 127
24 3300005535 Ga0070684_100005929 Ga0070684_1000059295 127
25 3300005539 Ga0068853_100013639 Ga0068853_1000136396 127
26 3300005546 Ga0070696_101679409 Ga0070696_1016794091 127
27 3300005547 Ga0070693_100228336 Ga0070693_1002283362 127
28 3300005564 Ga0070664_100007173 Ga0070664_10000717310 127
29 3300005577 Ga0068857_101049560 Ga0068857_1010495602 127
30 3300005578 Ga0068854_100294140 Ga0068854_1002941402 127
31 3300005614 Ga0068856_100581178 Ga0068856_1005811782 127
32 3300005616 Ga0068852_100094800 Ga0068852_1000948002 127
33 3300005618 Ga0068864_100659609 Ga0068864_1006596092 127
34 3300005618 Ga0068864_102479203 Ga0068864_1024792031 127
35 3300005719 Ga0068861_100147598 Ga0068861_1001475982 127
36 3300005834 Ga0068851_10175630 Ga0068851_101756302 127
37 3300005842 Ga0068858_100617509 Ga0068858_1006175092 127
38 3300006237 Ga0097621_100387838 Ga0097621_1003878382 127
39 3300006358 Ga0068871_100391877 Ga0068871_1003918772 127
40 3300006358 Ga0068871_100583069 Ga0068871_1005830691 127
41 3300006844 Ga0075428_100027061 Ga0075428_1000270619 127
42 3300006846 Ga0075430_100005341 Ga0075430_1000053418 127
43 3300006847 Ga0075431_100095444 Ga0075431_1000954441 127
44 3300006880 Ga0075429_100166579 Ga0075429_1001665791 127
45 3300010375 Ga0105239_10629364 Ga0105239_106293642 127
46 3300011119 Ga0105246_10169459 Ga0105246_101694591 127
47 3300013100 Ga0157373_10007909 Ga0157373_100079092 127
48 3300013102 Ga0157371_10572895 Ga0157371_105728952 127
49 3300013105 Ga0157369_10699747 Ga0157369_106997472 127
50 3300013296 Ga0157374_10388879 Ga0157374_103888792 127
51 3300013296 Ga0157374_12482946 Ga0157374_124829462 127
52 3300013297 Ga0157378_10019869 Ga0157378_100198692 127
53 3300013306 Ga0163162_10276034 Ga0163162_102760342 127
54 3300013307 Ga0157372_11090087 Ga0157372_110900872 127
55 3300014745 Ga0157377_10310389 Ga0157377_103103892 127
56 3300014969 Ga0157376_10915244 Ga0157376_109152442 127
57 3300025321 Ga0207656_10134460 Ga0207656_101344602 127
58 3300025904 Ga0207647_10351614 Ga0207647_103516142 127
59 3300025912 Ga0207707_11367547 Ga0207707_113675471 127
60 3300025917 Ga0207660_10567460 Ga0207660_105674601 127
61 3300025918 Ga0207662_10153666 Ga0207662_101536662 127
62 3300025919 Ga0207657_10006305 Ga0207657_100063053 127
63 3300025920 Ga0207649_10234025 Ga0207649_102340252 127
64 3300025921 Ga0207652_10471061 Ga0207652_104710612 127
65 3300025923 Ga0207681_11252327 Ga0207681_112523272 127
66 3300025931 Ga0207644_10059795 Ga0207644_100597952 127
67 3300025932 Ga0207690_10805865 Ga0207690_108058652 127
68 3300025933 Ga0207706_10034204 Ga0207706_100342042 127
69 3300025944 Ga0207661_10526544 Ga0207661_105265442 127
70 3300025945 Ga0207679_10317849 Ga0207679_103178492 127
71 3300025949 Ga0207667_10345734 Ga0207667_103457342 127
72 3300025981 Ga0207640_11492311 Ga0207640_114923112 127
73 3300026023 Ga0207677_10294470 Ga0207677_102944702 127
74 3300026078 Ga0207702_10344051 Ga0207702_103440511 127
75 3300026089 Ga0207648_10612167 Ga0207648_106121671 127
76 3300026089 Ga0207648_11874048 Ga0207648_118740481 127
77 3300026116 Ga0207674_10659896 Ga0207674_106598962 127
78 3300026118 Ga0207675_100423612 Ga0207675_1004236122 127
79 3300026142 Ga0207698_10315787 Ga0207698_103157872 127
80 3300045976 Ga0466967_0600357 Ga0466967_0600357_27_413 127
81 3300050508 nmdc:mga09592_27596_c1 nmdc:mga09592_27596_c1_3804_4193 127
82 3300005841 Ga0068863_100302300 Ga0068863_1003023002 128
83 3300026088 Ga0207641_10083665 Ga0207641_100836652 128
84 3300005335 Ga0070666_10036419 Ga0070666_100364194 129
85 3300005335 Ga0070666_10238602 Ga0070666_102386022 129
86 3300005337 Ga0070682_100799034 Ga0070682_1007990342 129
87 3300005441 Ga0070700_100109896 Ga0070700_1001098962 129
88 3300005441 Ga0070700_100488335 Ga0070700_1004883352 129
89 3300005457 Ga0070662_100212237 Ga0070662_1002122372 129
90 3300005471 Ga0070698_101532128 Ga0070698_1015321281 129
91 3300005535 Ga0070684_100048104 Ga0070684_1000481046 129
92 3300005539 Ga0068853_100095065 Ga0068853_1000950652 129
93 3300005578 Ga0068854_100171667 Ga0068854_1001716674 129
94 3300005616 Ga0068852_100582401 Ga0068852_1005824012 129
95 3300005617 Ga0068859_100247662 Ga0068859_1002476623 129
96 3300005617 Ga0068859_101548360 Ga0068859_1015483601 129
97 3300005618 Ga0068864_100460543 Ga0068864_1004605432 129
98 3300005718 Ga0068866_10396775 Ga0068866_103967751 129
99 3300005840 Ga0068870_10639466 Ga0068870_106394662 129
100 3300005843 Ga0068860_102608102 Ga0068860_1026081021 129
101 3300005844 Ga0068862_101590327 Ga0068862_1015903272 129
102 3300006358 Ga0068871_100350204 Ga0068871_1003502042 129
103 3300006881 Ga0068865_100685309 Ga0068865_1006853092 129
104 3300006931 Ga0097620_100247653 Ga0097620_1002476533 129
105 3300006931 Ga0097620_101548817 Ga0097620_1015488171 129
106 3300009148 Ga0105243_10527134 Ga0105243_105271342 129
107 3300009174 Ga0105241_10825465 Ga0105241_108254651 129
108 3300010375 Ga0105239_11421801 Ga0105239_114218012 129
109 3300010375 Ga0105239_13098659 Ga0105239_130986592 129
110 3300011119 Ga0105246_10321410 Ga0105246_103214102 129
111 3300013306 Ga0163162_11081388 Ga0163162_110813882 129
112 3300013308 Ga0157375_10283246 Ga0157375_102832462 129
113 3300013308 Ga0157375_13355941 Ga0157375_133559411 129
114 3300014969 Ga0157376_11012545 Ga0157376_110125452 129
115 3300025903 Ga0207680_10051092 Ga0207680_100510922 129
116 3300025913 Ga0207695_10060152 Ga0207695_100601523 129
117 3300025933 Ga0207706_10241643 Ga0207706_102416432 129
118 3300025934 Ga0207686_10261606 Ga0207686_102616062 129
119 3300025935 Ga0207709_10456040 Ga0207709_104560402 129
120 3300025938 Ga0207704_10616941 Ga0207704_106169411 129
121 3300025942 Ga0207689_10104297 Ga0207689_101042974 129
122 3300025944 Ga0207661_10285380 Ga0207661_102853802 129
123 3300026142 Ga0207698_10514860 Ga0207698_105148602 129
124 3300028380 Ga0268265_12034901 Ga0268265_120349011 129
125 3300032126 Ga0307415_101035656 Ga0307415_1010356562 129
126 3300035695 Ga0373927_0032801 Ga0373927_0032801_1211_1630 129
127 3300046454 Ga0495592_0327222 Ga0495592_0327222_228_623 129
128 3300046460 Ga0495638_0108786 Ga0495638_0108786_510_911 129
129 3300046524 Ga0495648_0029349 Ga0495648_0029349_1506_1907 129
130 3300046648 Ga0495611_0198112 Ga0495611_0198112_91_492 129
131 3300046675 Ga0495657_0690519 Ga0495657_0690519_124_534 129
132 3300053086 Ga0500578_0337236 Ga0500578_0337236_438_839 129
133 3300053090 Ga0500646_0004180 Ga0500646_0004180_1344_1745 129
134 3300053092 Ga0500583_0000286 Ga0500583_0000286_10727_11128 129
135 3300053130 Ga0500642_0235626 Ga0500642_0235626_56_457 129
136 3300053133 Ga0500655_062634 Ga0500655_062634_296_691 129
137 3300053139 Ga0500568_0009657 Ga0500568_0009657_2671_3072 129
138 3300053153 Ga0500616_0079076 Ga0500616_0079076_194_595 129
139 3300053153 Ga0500616_0140703 Ga0500616_0140703_238_639 129
140 3300053156 Ga0500622_0002343 Ga0500622_0002343_619_1020 129
141 3300005289 Ga0065704_10138269 Ga0065704_101382693 130
142 3300005290 Ga0065712_10405780 Ga0065712_104057801 130
143 3300005331 Ga0070670_101676396 Ga0070670_1016763961 130
144 3300005333 Ga0070677_10159489 Ga0070677_101594892 130
145 3300005340 Ga0070689_100010582 Ga0070689_1000105825 130
146 3300005340 Ga0070689_100097171 Ga0070689_1000971714 130
147 3300005353 Ga0070669_101201558 Ga0070669_1012015581 130
148 3300005364 Ga0070673_100753368 Ga0070673_1007533682 130
149 3300005364 Ga0070673_100923874 Ga0070673_1009238742 130
150 3300005367 Ga0070667_100424130 Ga0070667_1004241302 130
151 3300005367 Ga0070667_101014024 Ga0070667_1010140241 130
152 3300005466 Ga0070685_10003353 Ga0070685_100033534 130
153 3300005471 Ga0070698_100020359 Ga0070698_10002035910 130
154 3300005471 Ga0070698_100029369 Ga0070698_1000293698 130
155 3300005543 Ga0070672_100590073 Ga0070672_1005900732 130
156 3300005615 Ga0070702_100993170 Ga0070702_1009931702 130
157 3300005719 Ga0068861_100092743 Ga0068861_1000927432 130
158 3300005840 Ga0068870_10732217 Ga0068870_107322171 130
159 3300005841 Ga0068863_100502179 Ga0068863_1005021791 130
160 3300005841 Ga0068863_100576456 Ga0068863_1005764562 130
161 3300006844 Ga0075428_100070425 Ga0075428_1000704253 130
162 3300006847 Ga0075431_101440168 Ga0075431_1014401682 130
163 3300006880 Ga0075429_100002616 Ga0075429_10000261623 130
164 3300006931 Ga0097620_100849930 Ga0097620_1008499301 130
165 3300009147 Ga0114129_13284378 Ga0114129_132843781 130
166 3300009176 Ga0105242_10827649 Ga0105242_108276492 130
167 3300009177 Ga0105248_12381980 Ga0105248_123819802 130
168 3300009553 Ga0105249_10010240 Ga0105249_100102403 130
169 3300009553 Ga0105249_10039710 Ga0105249_100397103 130
170 3300009553 Ga0105249_11340384 Ga0105249_113403842 130
171 3300011119 Ga0105246_10039515 Ga0105246_100395155 130
172 3300013306 Ga0163162_10230074 Ga0163162_102300743 130
173 3300013308 Ga0157375_10563639 Ga0157375_105636392 130
174 3300014968 Ga0157379_10061916 Ga0157379_100619162 130
175 3300014969 Ga0157376_10393921 Ga0157376_103939212 130
176 3300017792 Ga0163161_10027196 Ga0163161_100271963 130
177 3300017792 Ga0163161_10106348 Ga0163161_101063482 130
178 3300025315 Ga0207697_10166026 Ga0207697_101660262 130
179 3300025908 Ga0207643_10416343 Ga0207643_104163431 130
180 3300025918 Ga0207662_10265917 Ga0207662_102659171 130
181 3300025936 Ga0207670_10082869 Ga0207670_100828691 130
182 3300025940 Ga0207691_11103227 Ga0207691_111032271 130
183 3300025941 Ga0207711_11365644 Ga0207711_113656442 130
184 3300025960 Ga0207651_10599282 Ga0207651_105992822 130
185 3300025960 Ga0207651_10915758 Ga0207651_109157581 130
186 3300025961 Ga0207712_10005253 Ga0207712_100052533 130
187 3300025961 Ga0207712_10022045 Ga0207712_100220452 130
188 3300026088 Ga0207641_10104267 Ga0207641_101042674 130
189 3300026089 Ga0207648_11110887 Ga0207648_111108871 130
190 3300026118 Ga0207675_100060750 Ga0207675_1000607502 130
191 3300026118 Ga0207675_101984929 Ga0207675_1019849291 130
192 3300026121 Ga0207683_10194351 Ga0207683_101943511 130
193 3300042001 Ga0439441_019160 Ga0439441_019160_342_734 130
194 3300042003 Ga0439443_026107 Ga0439443_026107_304_696 130
195 3300042461 Ga0439460_0078470 Ga0439460_0078470_625_1017 130
196 3300046539 Ga0495621_0150870 Ga0495621_0150870_118_513 130
197 3300050508 nmdc:mga09592_106167_c1 nmdc:mga09592_106167_c1_1486_1893 130
198 3300050510 nmdc:mga06r32_1349116_c1 nmdc:mga06r32_1349116_c1_177_584 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

51

153

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7164 12 126
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6434 12 126
1hi9-assembly1.cif.gz_A zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease. 0.5692 75 125
5jlt-assembly3.cif.gz_D the crystal structure of the bacteriophage t4 mota c-terminal domain in complex with dsdna reveals a novel protein-dna recognition motif 0.5045 18 117
2i8d-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution 0.4934 10 130
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8073 12 124 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7688 12 124 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6874 12 126 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6629 12 126 3.90.1150.200
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6367 27 127 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7Y5E6V1-F1-model_v4 YdhG-like domain-containing protein 0.9898 5 130
AF-W6UHA1-F1-model_v4 YdhG-like domain-containing protein 0.9851 6 127
AF-A0A5J5IF46-F1-model_v4 DUF1801 domain-containing protein 0.982 18 127
AF-A0A838T7Y2-F1-model_v4 DUF1801 domain-containing protein 0.9812 1 127
AF-A0A537JP88-F1-model_v4 DUF1801 domain-containing protein 0.9695 3 130

Feature Viewer

pLDDT pTM Quality
89.42 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map