F304196

General Info

Members Datasets Scaffolds Average Seq Length
198 153 396 167

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10059257|Ga0081455_100592572
Length 205
Sequence VSREYEFKFSPGPYFRLPDVSSVPGLRVDPPDTLRLQAVYYDSDDFRLARTGASLRYRDPEGWTVKLPIAQNSALFSLLGTTYGGNGTTTFALPDLRGRLPLHQGNGFILAETGGAEEITLTVPQIPAHSHPFLASGDSTNTLNPGGGLLGAPLTATPFFAATPNLPLAPQAISSIGGSQPHTNFQPYLCVNYIIALNGIYPSPN

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
100 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
101 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
118 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
129 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.87
Metatranscriptomes 13.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.61
Nodule 0
Rhizoplane 2.02
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10059257 3300005937 Bacteria 3234
2 MBSR1b_contig_509442 2162886012 Bacteria 2293
3 Ga0070658_10005615 3300005327 Bacteria 10172
4 Ga0070690_100603655 3300005330 Bacteria 833
5 Ga0068869_100020166 3300005334 Bacteria 4567
6 Ga0068869_100071739 3300005334 Bacteria 2565
7 Ga0068868_100020007 3300005338 Bacteria 5022
8 Ga0070689_101367372 3300005340 Bacteria 639
9 Ga0070692_10032682 3300005345 Bacteria 2617
10 Ga0070669_100031760 3300005353 Bacteria 3814
11 Ga0070669_100236011 3300005353 Bacteria 1451
12 Ga0070675_100637131 3300005354 Bacteria 968
13 Ga0070674_100136369 3300005356 Bacteria 1836
14 Ga0070673_100166572 3300005364 Bacteria 1878
15 Ga0070705_100000033 3300005440 Bacteria 68216
16 Ga0070694_100332253 3300005444 Bacteria 1173
17 Ga0070708_100015857 3300005445 Bacteria 6232
18 Ga0070678_100092891 3300005456 Bacteria 2319
19 Ga0070706_100076328 3300005467 Bacteria 3101
20 Ga0070707_100055856 3300005468 Bacteria 3785
21 Ga0070707_100132860 3300005468 Bacteria 2421
22 Ga0070707_100361463 3300005468 Bacteria 1410
23 Ga0070707_100661480 3300005468 Bacteria 1007
24 Ga0070698_100001126 3300005471 Bacteria 29553
25 Ga0070699_100004366 3300005518 Bacteria 12492
26 Ga0070699_100263673 3300005518 Bacteria 1541
27 Ga0070684_100232407 3300005535 Bacteria 1684
28 Ga0070672_100912698 3300005543 Bacteria 776
29 Ga0070686_100627011 3300005544 Bacteria 850
30 Ga0070686_100929607 3300005544 Bacteria 709
31 Ga0070696_100144952 3300005546 Bacteria 1739
32 Ga0070665_100075724 3300005548 Bacteria 3372
33 Ga0070704_100157794 3300005549 Bacteria 1791
34 Ga0068855_101266618 3300005563 Bacteria 764
35 Ga0070664_100191748 3300005564 Viruses 1821
36 Ga0068857_100366008 3300005577 Bacteria 1337
37 Ga0068854_100001463 3300005578 Bacteria 14304
38 Ga0068854_100058068 3300005578 Bacteria 2792
39 Ga0068854_100116804 3300005578 Bacteria 2020
40 Ga0068852_100144557 3300005616 Bacteria 2205
41 Ga0068859_100035785 3300005617 Bacteria 4983
42 Ga0068859_101383777 3300005617 Bacteria 776
43 Ga0068859_101817051 3300005617 Bacteria 673
44 Ga0068864_100002012 3300005618 Bacteria 16756
45 Ga0068861_100428479 3300005719 Bacteria 1180
46 Ga0068858_100033310 3300005842 Bacteria 4783
47 Ga0068860_100623305 3300005843 Bacteria 1085
48 Ga0068862_100499868 3300005844 Bacteria 1154
49 Ga0081539_10000413 3300005985 Bacteria 91117
50 Ga0075365_10406498 3300006038 Bacteria 961
51 Ga0075368_10001364 3300006042 Bacteria 7772
52 Ga0075363_100001017 3300006048 Bacteria 10063
53 Ga0075363_100760588 3300006048 Bacteria 587
54 Ga0075363_100826883 3300006048 Unclassified 564
55 Ga0075364_10231536 3300006051 Bacteria 1255
56 Ga0075364_10490409 3300006051 Bacteria 840
57 Ga0075367_10003744 3300006178 Bacteria 7320
58 Ga0075366_10281856 3300006195 Bacteria 1016
59 Ga0097621_100478827 3300006237 Viruses 1125
60 Ga0068871_100022990 3300006358 Unclassified 4813
61 Ga0075430_100155616 3300006846 Bacteria 1903
62 Ga0075431_100195262 3300006847 Bacteria 2072
63 Ga0075431_100288152 3300006847 Bacteria 1662
64 Ga0075433_10133402 3300006852 Bacteria 2207
65 Ga0075433_10534741 3300006852 Bacteria 1031
66 Ga0075429_100095944 3300006880 Bacteria 2586
67 Ga0068865_100116117 3300006881 Bacteria 1982
68 Ga0097620_100035784 3300006931 Bacteria 4983
69 Ga0097620_101383761 3300006931 Bacteria 776
70 Ga0097620_101816652 3300006931 Bacteria 673
71 Ga0075435_100431362 3300007076 Bacteria 1136
72 Ga0111539_10986113 3300009094 Bacteria 979
73 Ga0105242_10042162 3300009176 Bacteria 3683
74 Ga0105248_10022024 3300009177 Bacteria 7061
75 Ga0105248_10182188 3300009177 Bacteria 2367
76 Ga0105248_10255856 3300009177 Bacteria 1971
77 Ga0105248_11039774 3300009177 Bacteria 925
78 Ga0105239_10196727 3300010375 Bacteria 2258
79 Ga0105239_10849567 3300010375 Bacteria 1047
80 Ga0157374_10030955 3300013296 Bacteria 4860
81 Ga0157378_10009222 3300013297 Bacteria 8594
82 Ga0163162_10002597 3300013306 Bacteria 17117
83 Ga0157375_10042910 3300013308 Bacteria 4382
84 Ga0163163_10039198 3300014325 Bacteria 4623
85 Ga0163163_10179572 3300014325 Bacteria 2164
86 Ga0163163_11037597 3300014325 Bacteria 883
87 Ga0157377_10953541 3300014745 Bacteria 646
88 Ga0157377_11031181 3300014745 Bacteria 625
89 Ga0207697_10150581 3300025315 Viruses 1012
90 Ga0207680_10004480 3300025903 Bacteria 6627
91 Ga0207680_10505501 3300025903 Bacteria 861
92 Ga0207680_10749323 3300025903 Unclassified 700
93 Ga0207705_10255334 3300025909 Bacteria 1337
94 Ga0207705_10706965 3300025909 Bacteria 783
95 Ga0207684_10010404 3300025910 Bacteria 8190
96 Ga0207684_10073111 3300025910 Bacteria 2912
97 Ga0207646_10009596 3300025922 Bacteria 9548
98 Ga0207646_10011629 3300025922 Bacteria 8510
99 Ga0207646_10432419 3300025922 Bacteria 1188
100 Ga0207681_10703128 3300025923 Bacteria 840
101 Ga0207650_10000146 3300025925 Bacteria 85536
102 Ga0207659_10000004 3300025926 Bacteria 476977
103 Ga0207644_10346601 3300025931 Viruses 1205
104 Ga0207669_10584243 3300025937 Bacteria 906
105 Ga0207704_10231878 3300025938 Viruses 1373
106 Ga0207691_10325690 3300025940 Bacteria 1317
107 Ga0207711_10075779 3300025941 Viruses 2928
108 Ga0207711_10236136 3300025941 Bacteria 1675
109 Ga0207711_10560819 3300025941 Bacteria 1065
110 Ga0207689_10036759 3300025942 Viruses 4065
111 Ga0207689_10506237 3300025942 Bacteria 1012
112 Ga0207651_10134986 3300025960 Bacteria 1896
113 Ga0207640_10005179 3300025981 Bacteria 7092
114 Ga0207640_10051380 3300025981 Bacteria 2679
115 Ga0207640_10220455 3300025981 Bacteria 1452
116 Ga0207703_10046359 3300026035 Bacteria 3500
117 Ga0207639_10875125 3300026041 Bacteria 839
118 Ga0207641_10101060 3300026088 Bacteria 2541
119 Ga0207676_10288281 3300026095 Bacteria 1493
120 Ga0207675_101178901 3300026118 Bacteria 786
121 Ga0207698_10125917 3300026142 Bacteria 2179
122 Ga0209971_1034461 3300027682 Bacteria 1216
123 Ga0209813_10001666 3300027866 Bacteria 4996
124 Ga0207428_10140776 3300027907 Bacteria 1841
125 Ga0268266_10873477 3300028379 Viruses 869
126 Ga0268264_10875022 3300028381 Bacteria 901
127 Ga0307413_10226784 3300031824 Bacteria 1369
128 Ga0307412_10172188 3300031911 Bacteria 1620
129 Ga0307416_100017243 3300032002 Bacteria 5046
130 Ga0307411_10102888 3300032005 Bacteria 2025
131 Ga0395899_0313427 3300037312 Bacteria 1059
132 Ga0395900_0392390 3300037418 Bacteria 1354
133 Ga0439465_0022594 3300041413 Bacteria 1976
134 Ga0451793_0499271 3300041452 Bacteria 1166
135 Ga0451800_0425777 3300041459 Bacteria 1075
136 Ga0439452_016541 3300042010 Bacteria 2002
137 Ga0450894_019121 3300042131 Bacteria 919
138 Ga0451577_0222194 3300042876 Bacteria 1707
139 Ga0453684_0352754 3300044712 Bacteria 1658
140 Ga0453684_0557125 3300044712 Bacteria 1262
141 Ga0496106_0008702 3300048909 Bacteria 7511
142 Ga0496107_0092270 3300048910 Bacteria 2214
143 Ga0501067_0003262 3300049583 Bacteria 8932
144 Ga0501068_0005173 3300049584 Bacteria 7117
145 Ga0501075_0005759 3300049591 Bacteria 8477
146 Ga0501076_0681214 3300049592 Bacteria 849
147 Ga0501077_0000996 3300049593 Bacteria 17075
148 Ga0501260_038672 3300049689 Bacteria 572
149 Ga0501045_0224878 3300049824 Bacteria 1397
150 nmdc:mga03n38_701610_c1 3300050490 Bacteria 583
151 nmdc:mga03n38_79358_c1 3300050490 Bacteria 1539
152 nmdc:mga00v17_546072_c1 3300050491 Bacteria 749
153 nmdc:mga0yw44_301236_c1 3300050492 Bacteria 1074
154 nmdc:mga0yw44_380364_c1 3300050492 Bacteria 953
155 nmdc:mga0k408_481554_c1 3300050493 Bacteria 736
156 nmdc:mga06z11_8029_c1 3300050494 Bacteria 4376
157 nmdc:mga04h51_14489_c1 3300050495 Bacteria 2254
158 nmdc:mga07m45_166082_c1 3300050496 Bacteria 1282
159 nmdc:mga05p37_223411_c2 3300050507 Bacteria 1413
160 nmdc:mga05p37_609700_c1 3300050507 Bacteria 1230
161 nmdc:mga09592_4728_c1 3300050508 Bacteria 11028
162 nmdc:mga0qj67_159412_c1 3300050509 Bacteria 1832
163 nmdc:mga06r32_19372_c1 3300050510 Bacteria 6243
164 nmdc:mga08y16_1451711_c1 3300050511 Bacteria 648
165 nmdc:mga08y16_197197_c1 3300050511 Bacteria 2087
166 nmdc:mga0n895_55338_c1 3300050512 Bacteria 3905
167 nmdc:mga0rr50_730332_c1 3300050513 Bacteria 845
168 nmdc:mga0a205_1088615_c1 3300050515 Unclassified 646
169 Ga0500643_016973 3300053087 Bacteria 2449
170 Ga0500604_0006981 3300053151 Bacteria 2990
171 Ga0501084_0514534 3300054114 Bacteria 1012
172 Ga0587093_007480 3300059478 Bacteria 1220
173 Ga0587066_036085 3300059490 Bacteria 908
174 Ga0587077_008579 3300059493 Bacteria 1526
175 Ga0587082_037407 3300059504 Bacteria 875
176 Ga0587083_0003545 3300059505 Bacteria 2082
177 Ga0587083_0013468 3300059505 Bacteria 1393
178 Ga0587085_003063 3300059506 Bacteria 1777
179 Ga0587086_007963 3300059507 Bacteria 1227
180 Ga0587092_011816 3300059512 Bacteria 1221
181 Ga0587094_043811 3300059513 Bacteria 738
182 Ga0587101_072159 3300059623 Bacteria 638
183 Ga0587109_013108 3300059624 Bacteria 1371
184 Ga0587115_027164 3300059626 Bacteria 832
185 Ga0587062_009007 3300059639 Bacteria 1205
186 Ga0587068_079524 3300059641 Bacteria 660
187 Ga0587072_021851 3300059643 Bacteria 1139
188 Ga0587076_008376 3300059645 Bacteria 1442
189 Ga0587078_007699 3300059646 Bacteria 1196
190 Ga0587079_012184 3300059647 Bacteria 1400
191 Ga0587102_034453 3300059649 Bacteria 631
192 Ga0587119_008609 3300059658 Bacteria 1126
193 Ga0587071_002128 3300060344 Bacteria 2632
194 Ga0587071_023756 3300060344 Bacteria 1140
195 Ga0587111_0002351 3300060346 Bacteria 2504
196 Ga0587111_0040022 3300060346 Bacteria 995
197 Ga0587111_0135098 3300060346 Bacteria 649
198 Ga0501082_0000131 3300060353 Bacteria 61433
199 Ga0081455_10059257
200 MBSR1b_contig_509442
201 Ga0070658_10005615
202 Ga0070690_100603655
203 Ga0068869_100020166
204 Ga0068869_100071739
205 Ga0068868_100020007
206 Ga0070689_101367372
207 Ga0070692_10032682
208 Ga0070669_100031760
209 Ga0070669_100236011
210 Ga0070675_100637131
211 Ga0070674_100136369
212 Ga0070673_100166572
213 Ga0070705_100000033
214 Ga0070694_100332253
215 Ga0070708_100015857
216 Ga0070678_100092891
217 Ga0070706_100076328
218 Ga0070707_100055856
219 Ga0070707_100132860
220 Ga0070707_100361463
221 Ga0070707_100661480
222 Ga0070698_100001126
223 Ga0070699_100004366
224 Ga0070699_100263673
225 Ga0070684_100232407
226 Ga0070672_100912698
227 Ga0070686_100627011
228 Ga0070686_100929607
229 Ga0070696_100144952
230 Ga0070665_100075724
231 Ga0070704_100157794
232 Ga0068855_101266618
233 Ga0070664_100191748
234 Ga0068857_100366008
235 Ga0068854_100001463
236 Ga0068854_100058068
237 Ga0068854_100116804
238 Ga0068852_100144557
239 Ga0068859_100035785
240 Ga0068859_101383777
241 Ga0068859_101817051
242 Ga0068864_100002012
243 Ga0068861_100428479
244 Ga0068858_100033310
245 Ga0068860_100623305
246 Ga0068862_100499868
247 Ga0081539_10000413
248 Ga0075365_10406498
249 Ga0075368_10001364
250 Ga0075363_100001017
251 Ga0075363_100760588
252 Ga0075363_100826883
253 Ga0075364_10231536
254 Ga0075364_10490409
255 Ga0075367_10003744
256 Ga0075366_10281856
257 Ga0097621_100478827
258 Ga0068871_100022990
259 Ga0075430_100155616
260 Ga0075431_100195262
261 Ga0075431_100288152
262 Ga0075433_10133402
263 Ga0075433_10534741
264 Ga0075429_100095944
265 Ga0068865_100116117
266 Ga0097620_100035784
267 Ga0097620_101383761
268 Ga0097620_101816652
269 Ga0075435_100431362
270 Ga0111539_10986113
271 Ga0105242_10042162
272 Ga0105248_10022024
273 Ga0105248_10182188
274 Ga0105248_10255856
275 Ga0105248_11039774
276 Ga0105239_10196727
277 Ga0105239_10849567
278 Ga0157374_10030955
279 Ga0157378_10009222
280 Ga0163162_10002597
281 Ga0157375_10042910
282 Ga0163163_10039198
283 Ga0163163_10179572
284 Ga0163163_11037597
285 Ga0157377_10953541
286 Ga0157377_11031181
287 Ga0207697_10150581
288 Ga0207680_10004480
289 Ga0207680_10505501
290 Ga0207680_10749323
291 Ga0207705_10255334
292 Ga0207705_10706965
293 Ga0207684_10010404
294 Ga0207684_10073111
295 Ga0207646_10009596
296 Ga0207646_10011629
297 Ga0207646_10432419
298 Ga0207681_10703128
299 Ga0207650_10000146
300 Ga0207659_10000004
301 Ga0207644_10346601
302 Ga0207669_10584243
303 Ga0207704_10231878
304 Ga0207691_10325690
305 Ga0207711_10075779
306 Ga0207711_10236136
307 Ga0207711_10560819
308 Ga0207689_10036759
309 Ga0207689_10506237
310 Ga0207651_10134986
311 Ga0207640_10005179
312 Ga0207640_10051380
313 Ga0207640_10220455
314 Ga0207703_10046359
315 Ga0207639_10875125
316 Ga0207641_10101060
317 Ga0207676_10288281
318 Ga0207675_101178901
319 Ga0207698_10125917
320 Ga0209971_1034461
321 Ga0209813_10001666
322 Ga0207428_10140776
323 Ga0268266_10873477
324 Ga0268264_10875022
325 Ga0307413_10226784
326 Ga0307412_10172188
327 Ga0307416_100017243
328 Ga0307411_10102888
329 Ga0395899_0313427
330 Ga0395900_0392390
331 Ga0439465_0022594
332 Ga0451793_0499271
333 Ga0451800_0425777
334 Ga0439452_016541
335 Ga0450894_019121
336 Ga0451577_0222194
337 Ga0453684_0352754
338 Ga0453684_0557125
339 Ga0496106_0008702
340 Ga0496107_0092270
341 Ga0501067_0003262
342 Ga0501068_0005173
343 Ga0501075_0005759
344 Ga0501076_0681214
345 Ga0501077_0000996
346 Ga0501260_038672
347 Ga0501045_0224878
348 nmdc:mga03n38_701610_c1
349 nmdc:mga03n38_79358_c1
350 nmdc:mga00v17_546072_c1
351 nmdc:mga0yw44_301236_c1
352 nmdc:mga0yw44_380364_c1
353 nmdc:mga0k408_481554_c1
354 nmdc:mga06z11_8029_c1
355 nmdc:mga04h51_14489_c1
356 nmdc:mga07m45_166082_c1
357 nmdc:mga05p37_223411_c2
358 nmdc:mga05p37_609700_c1
359 nmdc:mga09592_4728_c1
360 nmdc:mga0qj67_159412_c1
361 nmdc:mga06r32_19372_c1
362 nmdc:mga08y16_1451711_c1
363 nmdc:mga08y16_197197_c1
364 nmdc:mga0n895_55338_c1
365 nmdc:mga0rr50_730332_c1
366 nmdc:mga0a205_1088615_c1
367 Ga0500643_016973
368 Ga0500604_0006981
369 Ga0501084_0514534
370 Ga0587093_007480
371 Ga0587066_036085
372 Ga0587077_008579
373 Ga0587082_037407
374 Ga0587083_0003545
375 Ga0587083_0013468
376 Ga0587085_003063
377 Ga0587086_007963
378 Ga0587092_011816
379 Ga0587094_043811
380 Ga0587101_072159
381 Ga0587109_013108
382 Ga0587115_027164
383 Ga0587062_009007
384 Ga0587068_079524
385 Ga0587072_021851
386 Ga0587076_008376
387 Ga0587078_007699
388 Ga0587079_012184
389 Ga0587102_034453
390 Ga0587119_008609
391 Ga0587071_002128
392 Ga0587071_023756
393 Ga0587111_0002351
394 Ga0587111_0040022
395 Ga0587111_0135098
396 Ga0501082_0000131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

56

101

0.92

PF01928

CYTH

CYTH domain

2

83

0.84

Map