F304180

General Info

Members Datasets Scaffolds Average Seq Length
198 141 396 129

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100000680|Ga0068863_10000068036
Length 147
Sequence LKAGGIAVQPVPSDKGPEVPPAPDLAIRLRRAAFNRALAETDVDAIAPILAQDAILVTGTDSAVIAGRKAQLLTWKREFAAPTRTIYTRTPETILASPVEPIALEHGHWQGIAATTGQPLASGAYTAKWRLIGADWVIEAEIYLTLA

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
69 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
70 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
71 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
72 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
73 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
74 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
91 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
110 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
117 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
118 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
119 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
120 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
121 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
122 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
123 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
124 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
127 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
131 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
133 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
134 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
136 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
137 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
138 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
139 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
140 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
141 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0.51
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.29
Nodule 0.51
Rhizoplane 4.55
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100000680 3300005841 Bacteria 34407
2 SwRhRL2b_contig_1217568 2162886007 Bacteria 14971
3 SwRhRL2b_contig_1534311 2162886007 Bacteria 6722
4 SwRhRL2b_contig_662347 2162886007 Bacteria 2644
5 JGI25159J45721_1006461 3300002987 Bacteria 3504
6 JGI25151J46595_10000248 3300003187 Bacteria 62929
7 JGI25153J46596_10021554 3300003215 Bacteria 2399
8 rootL2_10025339 3300003322 Bacteria 4916
9 rootH1_10159962 3300003323 Bacteria 2005
10 JGI25160J50197_1007719 3300003354 Bacteria 4179
11 Ga0065165_1001320 3300005262 Bacteria 27647
12 Ga0065165_1033802 3300005262 Bacteria 1588
13 Ga0065704_10000551 3300005289 Bacteria 62542
14 Ga0065707_10517733 3300005295 Bacteria 744
15 Ga0070690_100367864 3300005330 Bacteria 1048
16 Ga0070666_10019229 3300005335 Bacteria 4406
17 Ga0070668_100001151 3300005347 Bacteria 18634
18 Ga0068853_100864604 3300005539 Bacteria 868
19 Ga0070665_100080125 3300005548 Bacteria 3271
20 Ga0070665_100172004 3300005548 Bacteria 2167
21 Ga0068855_101361683 3300005563 Bacteria 733
22 Ga0068857_101087657 3300005577 Bacteria 772
23 Ga0068854_100199773 3300005578 Bacteria 1571
24 Ga0068852_100176584 3300005616 Bacteria 2006
25 Ga0068859_100002646 3300005617 Bacteria 18230
26 Ga0068859_100061338 3300005617 Bacteria 3790
27 Ga0068858_100607028 3300005842 Bacteria 1062
28 Ga0068860_100021794 3300005843 Bacteria 6198
29 Ga0068860_100043902 3300005843 Bacteria 4262
30 Ga0068862_100000118 3300005844 Bacteria 92548
31 Ga0068862_100109758 3300005844 Bacteria 2420
32 Ga0075363_100027059 3300006048 Bacteria 2938
33 Ga0075364_10120460 3300006051 Bacteria 1756
34 Ga0075432_10000288 3300006058 Bacteria 14002
35 Ga0075362_10003677 3300006177 Bacteria 5413
36 Ga0075367_10089686 3300006178 Bacteria 1869
37 Ga0075369_10000928 3300006186 Bacteria 9726
38 Ga0075366_10088415 3300006195 Bacteria 1855
39 Ga0075366_10116301 3300006195 Bacteria 1610
40 Ga0075370_10028892 3300006353 Bacteria 3085
41 Ga0075370_10149680 3300006353 Bacteria 1368
42 Ga0075370_10176493 3300006353 Bacteria 1257
43 Ga0075370_10267767 3300006353 Unclassified 1014
44 Ga0075370_10444262 3300006353 Bacteria 780
45 Ga0097620_100002646 3300006931 Bacteria 18230
46 Ga0097620_100061339 3300006931 Bacteria 3790
47 Ga0079104_1022981 3300006946 Bacteria 1667
48 Ga0105251_10077463 3300009011 Bacteria 1542
49 Ga0105250_10036551 3300009092 Bacteria 1971
50 Ga0105247_10004324 3300009101 Bacteria 9076
51 Ga0105247_11166789 3300009101 Bacteria 611
52 Ga0105241_12492980 3300009174 Bacteria 518
53 Ga0105248_11590122 3300009177 Bacteria 740
54 Ga0105249_10000119 3300009553 Bacteria 107840
55 Ga0105249_10039819 3300009553 Bacteria 4267
56 Ga0105239_12069325 3300010375 Bacteria 661
57 Ga0163162_10018238 3300013306 Bacteria 6874
58 Ga0157380_10313880 3300014326 Bacteria 1450
59 Ga0163161_10010927 3300017792 Bacteria 6292
60 Ga0163161_10460767 3300017792 Bacteria 1029
61 Ga0209147_102367 3300025229 Bacteria 4769
62 Ga0209130_1000931 3300025284 Bacteria 23415
63 Ga0209025_1000053 3300025294 Bacteria 317600
64 Ga0209025_1159231 3300025294 Bacteria 611
65 Ga0209758_1002415 3300025297 Bacteria 19142
66 Ga0207426_1000196 3300025302 Bacteria 146687
67 Ga0207696_1010089 3300025711 Bacteria 3484
68 Ga0207713_1089406 3300025735 Bacteria 1086
69 Ga0207667_10966375 3300025949 Bacteria 840
70 Ga0207712_10000048 3300025961 Bacteria 160050
71 Ga0207668_10002477 3300025972 Bacteria 10780
72 Ga0207640_10006274 3300025981 Bacteria 6520
73 Ga0207703_10286741 3300026035 Bacteria 1497
74 Ga0207703_10688536 3300026035 Bacteria 972
75 Ga0207641_10005526 3300026088 Bacteria 10784
76 Ga0207698_10369178 3300026142 Bacteria 1361
77 Ga0209813_10000278 3300027866 Bacteria 14405
78 Ga0207428_10036091 3300027907 Bacteria 4036
79 Ga0268266_10039751 3300028379 Bacteria 4007
80 Ga0268266_10075187 3300028379 Bacteria 2934
81 Ga0268266_10890725 3300028379 Bacteria 860
82 Ga0268265_10000139 3300028380 Bacteria 92561
83 Ga0268265_10230594 3300028380 Bacteria 1627
84 Ga0268264_10008920 3300028381 Bacteria 8320
85 Ga0268264_10252786 3300028381 Bacteria 1638
86 Ga0307513_10052417 3300031456 Bacteria 4394
87 Ga0307411_10702498 3300032005 Bacteria 881
88 Ga0373927_0493437 3300035695 Bacteria 809
89 Ga0373947_0377237 3300035725 Bacteria 954
90 Ga0451806_335346 3300041462 Bacteria 1884
91 Ga0451804_0006869 3300041463 Bacteria 1021
92 Ga0451807_1489998 3300041486 Bacteria 3062
93 Ga0451849_0394813 3300041505 Bacteria 1105
94 Ga0451849_0767539 3300041505 Bacteria 601
95 Ga0439431_0012397 3300041997 Bacteria 1959
96 Ga0439445_0089667 3300042004 Bacteria 865
97 Ga0439445_0276131 3300042004 Bacteria 504
98 Ga0495617_012952 3300046452 Bacteria 2842
99 Ga0495627_000304 3300046453 Bacteria 48657
100 Ga0495627_000618 3300046453 Bacteria 28257
101 Ga0495627_050352 3300046453 Bacteria 1255
102 Ga0495638_0000018 3300046460 Bacteria 389696
103 Ga0495607_0187424 3300046501 Bacteria 1033
104 Ga0495583_0000187 3300046506 Bacteria 104971
105 Ga0495610_0000085 3300046512 Bacteria 112390
106 Ga0495610_0021717 3300046512 Bacteria 3524
107 Ga0495632_0000384 3300046519 Bacteria 42202
108 Ga0495637_0006028 3300046520 Bacteria 6122
109 Ga0495637_0135716 3300046520 Bacteria 937
110 Ga0495643_0000048 3300046522 Bacteria 212788
111 Ga0495648_0000018 3300046524 Bacteria 282490
112 Ga0495648_0005345 3300046524 Bacteria 10700
113 Ga0495648_0072365 3300046524 Bacteria 1995
114 Ga0495609_0070806 3300046538 Bacteria 1533
115 Ga0495633_0035237 3300046558 Bacteria 2403
116 Ga0495633_0045053 3300046558 Bacteria 2089
117 Ga0495625_0085288 3300046660 Bacteria 2192
118 Ga0495625_0094417 3300046660 Bacteria 2064
119 Ga0495661_0055900 3300046665 Bacteria 2364
120 Ga0495671_0000011 3300046692 Bacteria 365582
121 Ga0495671_0011786 3300046692 Bacteria 4792
122 Ga0495672_0354015 3300047320 Bacteria 681
123 Ga0495673_0000013 3300047469 Bacteria 612902
124 Ga0495673_0138263 3300047469 Bacteria 952
125 Ga0495681_0000013 3300047470 Bacteria 189155
126 Ga0495686_0054844 3300047472 Bacteria 2494
127 Ga0496102_1479836 3300048905 Unclassified 598
128 Ga0496108_0002488 3300048911 Bacteria 14747
129 Ga0496109_0444471 3300048912 Bacteria 1225
130 Ga0496110_0006722 3300048913 Bacteria 9145
131 Ga0496111_0101895 3300048914 Bacteria 2110
132 Ga0496111_0192689 3300048914 Bacteria 1515
133 Ga0496118_0185415 3300048921 Bacteria 1251
134 Ga0496118_0193334 3300048921 Bacteria 1214
135 Ga0496118_0378027 3300048921 Bacteria 744
136 Ga0496120_0216396 3300048923 Bacteria 918
137 Ga0496121_0000190 3300048924 Bacteria 136607
138 Ga0496121_0001177 3300048924 Bacteria 45771
139 Ga0496121_0005342 3300048924 Bacteria 16517
140 Ga0496121_0316790 3300048924 Bacteria 1052
141 Ga0496122_0000507 3300048925 Bacteria 80433
142 Ga0496122_0008556 3300048925 Bacteria 11007
143 Ga0496122_0349015 3300048925 Bacteria 773
144 Ga0496123_0000484 3300048926 Bacteria 69108
145 Ga0496123_0086367 3300048926 Bacteria 1882
146 Ga0496124_0040742 3300048927 Bacteria 4015
147 Ga0496124_0082916 3300048927 Bacteria 2631
148 Ga0496124_0708792 3300048927 Bacteria 637
149 Ga0496125_0096418 3300048928 Bacteria 2195
150 Ga0496126_0009210 3300048929 Bacteria 10531
151 Ga0496126_0057484 3300048929 Bacteria 3511
152 Ga0496126_0058552 3300048929 Bacteria 3472
153 Ga0496126_0113519 3300048929 Bacteria 2358
154 Ga0495682_0160987 3300049460 Unclassified 799
155 Ga0501249_000368 3300049679 Bacteria 11857
156 Ga0501044_0045014 3300049823 Bacteria 4576
157 Ga0501044_0045912 3300049823 Bacteria 4525
158 nmdc:mga03683_1320_c1 3300050489 Bacteria 7342
159 nmdc:mga03n38_39593_c1 3300050490 Bacteria 2045
160 nmdc:mga00v17_24719_c1 3300050491 Bacteria 3487
161 nmdc:mga0k408_31953_c1 3300050493 Bacteria 1843
162 nmdc:mga06z11_33013_c1 3300050494 Bacteria 2529
163 nmdc:mga06z11_468949_c1 3300050494 Bacteria 762
164 nmdc:mga04h51_240_c1 3300050495 Bacteria 14405
165 nmdc:mga07m45_127452_c1 3300050496 Unclassified 1472
166 nmdc:mga07m45_33_c1 3300050496 Bacteria 75596
167 nmdc:mga07m45_412152_c1 3300050496 Bacteria 784
168 nmdc:mga0sz30_1165_c1 3300050516 Bacteria 9412
169 Ga0500647_0023090 3300053091 Bacteria 2915
170 Ga0500651_0315174 3300053093 Bacteria 894
171 Ga0500641_0017008 3300053096 Bacteria 2713
172 Ga0500556_0307484 3300053104 Bacteria 619
173 Ga0500594_0005144 3300053118 Bacteria 2893
174 Ga0500618_009303 3300053125 Bacteria 2688
175 Ga0500642_0000678 3300053130 Bacteria 10065
176 Ga0500655_000036 3300053133 Bacteria 38186
177 Ga0500655_010703 3300053133 Bacteria 1657
178 Ga0500568_0075420 3300053139 Bacteria 1286
179 Ga0500568_0187657 3300053139 Bacteria 759
180 Ga0500577_0030309 3300053142 Bacteria 1882
181 Ga0500590_000400 3300053148 Bacteria 14502
182 Ga0500616_0002313 3300053153 Bacteria 16121
183 Ga0500622_0006430 3300053156 Bacteria 6813
184 Ga0500622_0103110 3300053156 Bacteria 1402
185 Ga0500622_0361664 3300053156 Bacteria 599
186 Ga0500624_000204 3300053157 Bacteria 22861
187 Ga0500639_126974 3300053163 Bacteria 1215
188 Ga0500636_0096149 3300053177 Bacteria 1690
189 Ga0500636_0379155 3300053177 Bacteria 664
190 Ga0500570_000250 3300053724 Bacteria 18136
191 Ga0587090_155382 3300059510 Bacteria 521
192 2585260700 2582581305 Bacteria 4895574
193 2739650033 2739367664 Bacteria 4114334
194 2740028506 2739367865 Bacteria 4114482
195 2821446742 2821443989 Bacteria 7658172
196 2844535755 2844533157 Bacteria 7517899
197 2919710635 2919709256 Bacteria 4318106
198 8054303081 8054302542 Bacteria 5698134
199 Ga0068863_100000680
200 SwRhRL2b_contig_1217568
201 SwRhRL2b_contig_1534311
202 SwRhRL2b_contig_662347
203 JGI25159J45721_1006461
204 JGI25151J46595_10000248
205 JGI25153J46596_10021554
206 rootL2_10025339
207 rootH1_10159962
208 JGI25160J50197_1007719
209 Ga0065165_1001320
210 Ga0065165_1033802
211 Ga0065704_10000551
212 Ga0065707_10517733
213 Ga0070690_100367864
214 Ga0070666_10019229
215 Ga0070668_100001151
216 Ga0068853_100864604
217 Ga0070665_100080125
218 Ga0070665_100172004
219 Ga0068855_101361683
220 Ga0068857_101087657
221 Ga0068854_100199773
222 Ga0068852_100176584
223 Ga0068859_100002646
224 Ga0068859_100061338
225 Ga0068858_100607028
226 Ga0068860_100021794
227 Ga0068860_100043902
228 Ga0068862_100000118
229 Ga0068862_100109758
230 Ga0075363_100027059
231 Ga0075364_10120460
232 Ga0075432_10000288
233 Ga0075362_10003677
234 Ga0075367_10089686
235 Ga0075369_10000928
236 Ga0075366_10088415
237 Ga0075366_10116301
238 Ga0075370_10028892
239 Ga0075370_10149680
240 Ga0075370_10176493
241 Ga0075370_10267767
242 Ga0075370_10444262
243 Ga0097620_100002646
244 Ga0097620_100061339
245 Ga0079104_1022981
246 Ga0105251_10077463
247 Ga0105250_10036551
248 Ga0105247_10004324
249 Ga0105247_11166789
250 Ga0105241_12492980
251 Ga0105248_11590122
252 Ga0105249_10000119
253 Ga0105249_10039819
254 Ga0105239_12069325
255 Ga0163162_10018238
256 Ga0157380_10313880
257 Ga0163161_10010927
258 Ga0163161_10460767
259 Ga0209147_102367
260 Ga0209130_1000931
261 Ga0209025_1000053
262 Ga0209025_1159231
263 Ga0209758_1002415
264 Ga0207426_1000196
265 Ga0207696_1010089
266 Ga0207713_1089406
267 Ga0207667_10966375
268 Ga0207712_10000048
269 Ga0207668_10002477
270 Ga0207640_10006274
271 Ga0207703_10286741
272 Ga0207703_10688536
273 Ga0207641_10005526
274 Ga0207698_10369178
275 Ga0209813_10000278
276 Ga0207428_10036091
277 Ga0268266_10039751
278 Ga0268266_10075187
279 Ga0268266_10890725
280 Ga0268265_10000139
281 Ga0268265_10230594
282 Ga0268264_10008920
283 Ga0268264_10252786
284 Ga0307513_10052417
285 Ga0307411_10702498
286 Ga0373927_0493437
287 Ga0373947_0377237
288 Ga0451806_335346
289 Ga0451804_0006869
290 Ga0451807_1489998
291 Ga0451849_0394813
292 Ga0451849_0767539
293 Ga0439431_0012397
294 Ga0439445_0089667
295 Ga0439445_0276131
296 Ga0495617_012952
297 Ga0495627_000304
298 Ga0495627_000618
299 Ga0495627_050352
300 Ga0495638_0000018
301 Ga0495607_0187424
302 Ga0495583_0000187
303 Ga0495610_0000085
304 Ga0495610_0021717
305 Ga0495632_0000384
306 Ga0495637_0006028
307 Ga0495637_0135716
308 Ga0495643_0000048
309 Ga0495648_0000018
310 Ga0495648_0005345
311 Ga0495648_0072365
312 Ga0495609_0070806
313 Ga0495633_0035237
314 Ga0495633_0045053
315 Ga0495625_0085288
316 Ga0495625_0094417
317 Ga0495661_0055900
318 Ga0495671_0000011
319 Ga0495671_0011786
320 Ga0495672_0354015
321 Ga0495673_0000013
322 Ga0495673_0138263
323 Ga0495681_0000013
324 Ga0495686_0054844
325 Ga0496102_1479836
326 Ga0496108_0002488
327 Ga0496109_0444471
328 Ga0496110_0006722
329 Ga0496111_0101895
330 Ga0496111_0192689
331 Ga0496118_0185415
332 Ga0496118_0193334
333 Ga0496118_0378027
334 Ga0496120_0216396
335 Ga0496121_0000190
336 Ga0496121_0001177
337 Ga0496121_0005342
338 Ga0496121_0316790
339 Ga0496122_0000507
340 Ga0496122_0008556
341 Ga0496122_0349015
342 Ga0496123_0000484
343 Ga0496123_0086367
344 Ga0496124_0040742
345 Ga0496124_0082916
346 Ga0496124_0708792
347 Ga0496125_0096418
348 Ga0496126_0009210
349 Ga0496126_0057484
350 Ga0496126_0058552
351 Ga0496126_0113519
352 Ga0495682_0160987
353 Ga0501249_000368
354 Ga0501044_0045014
355 Ga0501044_0045912
356 nmdc:mga03683_1320_c1
357 nmdc:mga03n38_39593_c1
358 nmdc:mga00v17_24719_c1
359 nmdc:mga0k408_31953_c1
360 nmdc:mga06z11_33013_c1
361 nmdc:mga06z11_468949_c1
362 nmdc:mga04h51_240_c1
363 nmdc:mga07m45_127452_c1
364 nmdc:mga07m45_33_c1
365 nmdc:mga07m45_412152_c1
366 nmdc:mga0sz30_1165_c1
367 Ga0500647_0023090
368 Ga0500651_0315174
369 Ga0500641_0017008
370 Ga0500556_0307484
371 Ga0500594_0005144
372 Ga0500618_009303
373 Ga0500642_0000678
374 Ga0500655_000036
375 Ga0500655_010703
376 Ga0500568_0075420
377 Ga0500568_0187657
378 Ga0500577_0030309
379 Ga0500590_000400
380 Ga0500616_0002313
381 Ga0500622_0006430
382 Ga0500622_0103110
383 Ga0500622_0361664
384 Ga0500624_000204
385 Ga0500639_126974
386 Ga0500636_0096149
387 Ga0500636_0379155
388 Ga0500570_000250
389 Ga0587090_155382
390 2585260700
391 2739650033
392 2740028506
393 2821446742
394 2844535755
395 2919710635
396 8054303081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

27

138

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2chc-assembly1.cif.gz_C structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.8512 22 145
3cu3-assembly1.cif.gz_A-2 crystal structure of a domain of unknown function with a cystatin-like fold (npun_r1993) from nostoc punctiforme pcc 73102 at 2.00 a resolution 0.8462 19 145
4ovm-assembly3.cif.gz_F crystal structure of sgcj protein from streptomyces carzinostaticus 0.8444 19 145
5ieo-assembly1.cif.gz_A structure of cdl2.3a, a computationally designed vitamin-d3 binder 0.8397 19 145
6w3f-assembly2.cif.gz_B rd1ntf2_05_i64f_a80g_t94p_d101k_l106w 0.8373 24 142
ID Description Score Start End Superfamily
af_A0A078BPG0_5_119_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8868 23 141 3.10.450.50
af_A0A078BPG0_5_119_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8586 23 141 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8413 22 145 3.10.450.50
3cu3A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8374 19 145 3.10.450.50
2rgqA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8337 22 144 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7M2X4S3-F1-model_v4 Nuclear transport factor 2 family protein 0.9948 23 145
AF-A0A519QCQ4-F1-model_v4 DUF4440 domain-containing protein 0.9896 42 145
AF-A0A4Q3ABW1-F1-model_v4 Nuclear transport factor 2 family protein 0.9814 19 122
AF-A0A1B3MZG0-F1-model_v4 Uncharacterized protein 0.9804 19 120
AF-A0A519QCQ4-F1-model_v4 DUF4440 domain-containing protein 0.9709 42 145

Map