F304084

General Info

Members Datasets Scaffolds Average Seq Length
198 137 396 162

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_101442540|Ga0068867_1014425401
Length 185
Sequence LEREIVGETATVFRIERATATTFTRMSTLEATAPAFVEMAHRIVWASVATVAPNGSPTSRILHPFWQWDGTELVGWIATANASVKGRHLAANPMVSVSYWAPNHDTCVADCRATFHSDPETRAWLWDTIKAAPPPLGFDPTLIAGWDAPTSEGFQALRLDPSRVRVFPGTMLLKGEGDVLSWRRP

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
81 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
87 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 8.59
Rhizosphere 73.74
Stem 0
Stem Tuber 0
Unclassified 17.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_101442540 3300005459 Bacteria 639
2 rootH1_10172920 3300003316 Bacteria 1267
3 Ga0070676_10138174 3300005328 Unclassified 1548
4 Ga0068869_100399670 3300005334 Bacteria 1130
5 Ga0070689_100172109 3300005340 Bacteria 1755
6 Ga0070669_100127877 3300005353 Unclassified 1946
7 Ga0070674_100175516 3300005356 Unclassified 1637
8 Ga0070700_100079148 3300005441 Bacteria 2118
9 Ga0070681_10573323 3300005458 Unclassified 1042
10 Ga0068867_100020257 3300005459 Bacteria 4739
11 Ga0070698_100556163 3300005471 Bacteria 1087
12 Ga0070699_101105309 3300005518 Bacteria 727
13 Ga0070672_100302191 3300005543 Bacteria 1357
14 Ga0070686_100764509 3300005544 Bacteria 776
15 Ga0070696_100236148 3300005546 Unclassified 1377
16 Ga0070702_100056344 3300005615 Bacteria 2270
17 Ga0068861_100698672 3300005719 Bacteria 942
18 Ga0068861_101625182 3300005719 Unclassified 637
19 Ga0068870_10358306 3300005840 Bacteria 938
20 Ga0068862_100501454 3300005844 Bacteria 1152
21 Ga0081455_10014470 3300005937 Bacteria 7731
22 Ga0081455_10093442 3300005937 Bacteria 2432
23 Ga0081538_10000014 3300005981 Bacteria 151008
24 Ga0075365_10000146 3300006038 Bacteria 22288
25 Ga0075365_10067054 3300006038 Bacteria 2409
26 Ga0075365_10077141 3300006038 Unclassified 2251
27 Ga0075368_10216853 3300006042 Bacteria 812
28 Ga0075363_100084898 3300006048 Unclassified 1736
29 Ga0075363_100110105 3300006048 Bacteria 1530
30 Ga0075364_10007339 3300006051 Bacteria 6542
31 Ga0075364_10019859 3300006051 Bacteria 4223
32 Ga0075364_10159169 3300006051 Bacteria 1524
33 Ga0075364_10536063 3300006051 Unclassified 800
34 Ga0075364_10893685 3300006051 Unclassified 605
35 Ga0075362_10001787 3300006177 Bacteria 7007
36 Ga0075362_10009344 3300006177 Bacteria 3789
37 Ga0075367_10052365 3300006178 Bacteria 2416
38 Ga0075367_10246062 3300006178 Bacteria 1121
39 Ga0075369_10072740 3300006186 Bacteria 1515
40 Ga0075369_10230153 3300006186 Bacteria 859
41 Ga0097621_100702352 3300006237 Bacteria 931
42 Ga0075370_10398012 3300006353 Bacteria 826
43 Ga0068871_100201786 3300006358 Unclassified 1717
44 Ga0068871_101462261 3300006358 Unclassified 645
45 Ga0075428_100015808 3300006844 Bacteria 8357
46 Ga0075428_100216659 3300006844 Bacteria 2068
47 Ga0075428_101875412 3300006844 Bacteria 623
48 Ga0075430_100011477 3300006846 Bacteria 7526
49 Ga0075430_100235142 3300006846 Bacteria 1519
50 Ga0075430_100267223 3300006846 Bacteria 1416
51 Ga0075431_100001772 3300006847 Bacteria 20344
52 Ga0075431_100121833 3300006847 Unclassified 2691
53 Ga0075431_100289429 3300006847 Bacteria 1657
54 Ga0075431_101030369 3300006847 Bacteria 789
55 Ga0075433_10856240 3300006852 Unclassified 793
56 Ga0075429_100008723 3300006880 Bacteria 8818
57 Ga0068865_100031533 3300006881 Bacteria 3535
58 Ga0111539_10002891 3300009094 Bacteria 22802
59 Ga0111539_10264319 3300009094 Bacteria 2003
60 Ga0105245_10009794 3300009098 Bacteria 8349
61 Ga0105245_10275758 3300009098 Bacteria 1642
62 Ga0105245_10897815 3300009098 Bacteria 928
63 Ga0114129_10014167 3300009147 Bacteria 11360
64 Ga0114129_10830005 3300009147 Unclassified 1177
65 Ga0105243_10040248 3300009148 Bacteria 3648
66 Ga0105243_10272789 3300009148 Bacteria 1519
67 Ga0105241_10440932 3300009174 Bacteria 1150
68 Ga0105242_10005555 3300009176 Bacteria 9731
69 Ga0105248_10498820 3300009177 Bacteria 1372
70 Ga0105248_10996644 3300009177 Bacteria 946
71 Ga0105249_10202692 3300009553 Bacteria 1942
72 Ga0105246_10818227 3300011119 Bacteria 828
73 Ga0157378_10024920 3300013297 Bacteria 5268
74 Ga0157378_10926747 3300013297 Unclassified 903
75 Ga0163162_10316626 3300013306 Bacteria 1693
76 Ga0163162_11509259 3300013306 Bacteria 766
77 Ga0157375_10152139 3300013308 Unclassified 2450
78 Ga0157375_11225016 3300013308 Bacteria 881
79 Ga0157380_10344793 3300014326 Bacteria 1391
80 Ga0157380_10560874 3300014326 Bacteria 1122
81 Ga0157379_10093551 3300014968 Bacteria 2697
82 Ga0157379_10298690 3300014968 Bacteria 1467
83 Ga0157379_10340449 3300014968 Bacteria 1372
84 Ga0157376_11585473 3300014969 Unclassified 689
85 Ga0163161_10200454 3300017792 Bacteria 1538
86 Ga0207642_10023590 3300025899 Unclassified 2460
87 Ga0207688_10079258 3300025901 Bacteria 1873
88 Ga0207707_10380985 3300025912 Unclassified 1212
89 Ga0207681_10264072 3300025923 Bacteria 1349
90 Ga0207706_11467141 3300025933 Bacteria 558
91 Ga0207709_10143506 3300025935 Bacteria 1644
92 Ga0207670_10079980 3300025936 Bacteria 2283
93 Ga0207669_10071252 3300025937 Bacteria 2183
94 Ga0207691_10281014 3300025940 Bacteria 1432
95 Ga0207691_10375196 3300025940 Bacteria 1215
96 Ga0207711_10484004 3300025941 Bacteria 1153
97 Ga0207712_11080688 3300025961 Unclassified 714
98 Ga0207668_10745555 3300025972 Unclassified 864
99 Ga0207640_10974717 3300025981 Bacteria 744
100 Ga0207708_10184581 3300026075 Bacteria 1657
101 Ga0207648_10002835 3300026089 Bacteria 18384
102 Ga0207675_100316279 3300026118 Bacteria 1523
103 Ga0207675_100954033 3300026118 Bacteria 875
104 Ga0207683_10650207 3300026121 Bacteria 977
105 Ga0207428_10034941 3300027907 Bacteria 4113
106 Ga0207428_10129302 3300027907 Bacteria 1933
107 Ga0268264_10201792 3300028381 Unclassified 1820
108 Ga0316576_10575773 3300031727 Unclassified 823
109 Ga0307410_10870120 3300031852 Bacteria 770
110 Ga0307406_10478835 3300031901 Bacteria 1005
111 Ga0307409_100879965 3300031995 Bacteria 908
112 Ga0307416_100198234 3300032002 Bacteria 1902
113 Ga0307414_10922987 3300032004 Bacteria 801
114 Ga0373956_0010120 3300035119 Bacteria 3852
115 Ga0373931_0348918 3300035691 Unclassified 926
116 Ga0436362_0500530 3300039453 Bacteria 2553
117 Ga0451802_0755006 3300041460 Bacteria 538
118 Ga0451802_1267461 3300041460 Bacteria 1256
119 Ga0451853_0833411 3300041512 Bacteria 794
120 Ga0439448_0043410 3300042005 Bacteria 1459
121 Ga0439450_027175 3300042008 Bacteria 1266
122 Ga0439463_009265 3300042016 Bacteria 2422
123 Ga0439444_0013405 3300042437 Bacteria 1357
124 Ga0439464_0016263 3300042439 Bacteria 2010
125 Ga0495592_0572795 3300046454 Bacteria 692
126 Ga0495603_0431385 3300046455 Bacteria 755
127 Ga0495629_0046881 3300046459 Unclassified 3031
128 Ga0495582_0587739 3300046473 Unclassified 644
129 Ga0495618_0147776 3300046514 Bacteria 1502
130 Ga0495630_0053157 3300046517 Unclassified 3032
131 Ga0495630_0242294 3300046517 Bacteria 1378
132 Ga0495586_0036822 3300046535 Bacteria 2626
133 Ga0495634_0004723 3300046642 Bacteria 10602
134 Ga0495658_0460535 3300046683 Bacteria 813
135 Ga0495613_0011728 3300046689 Bacteria 6513
136 Ga0495680_0148256 3300047322 Bacteria 1712
137 Ga0495686_0002331 3300047472 Bacteria 18152
138 Ga0496101_0020774 3300048904 Bacteria 4503
139 Ga0496102_0060066 3300048905 Bacteria 3478
140 Ga0496103_0098188 3300048906 Bacteria 1852
141 Ga0496104_0145801 3300048907 Bacteria 2273
142 Ga0496105_0027983 3300048908 Bacteria 4609
143 Ga0496106_0075115 3300048909 Bacteria 2588
144 Ga0496108_1034513 3300048911 Bacteria 700
145 Ga0496109_0478884 3300048912 Bacteria 1175
146 Ga0496109_1685899 3300048912 Bacteria 568
147 Ga0496110_0918956 3300048913 Bacteria 781
148 Ga0496110_1013873 3300048913 Bacteria 738
149 Ga0496111_0147357 3300048914 Bacteria 1745
150 Ga0496114_0047715 3300048917 Bacteria 3562
151 Ga0496114_0339748 3300048917 Bacteria 1328
152 Ga0496114_0740678 3300048917 Bacteria 860
153 Ga0501032_0537072 3300049569 Bacteria 746
154 Ga0501034_0015015 3300049571 Bacteria 7966
155 Ga0501039_0434027 3300049575 Unclassified 1031
156 Ga0501040_0240700 3300049576 Bacteria 1290
157 Ga0501041_0156115 3300049577 Bacteria 1426
158 Ga0501042_0553249 3300049578 Bacteria 836
159 Ga0501048_0052442 3300049582 Bacteria 2903
160 Ga0501072_0267249 3300049588 Bacteria 1361
161 Ga0501072_0290554 3300049588 Bacteria 1300
162 Ga0501076_0506206 3300049592 Bacteria 995
163 Ga0501079_0675402 3300049741 Unclassified 813
164 Ga0501081_1071707 3300049743 Bacteria 610
165 nmdc:mga03683_13212_c1 3300050489 Bacteria 3033
166 nmdc:mga03683_9207_c1 3300050489 Bacteria 3502
167 nmdc:mga03n38_100498_c1 3300050490 Bacteria 1394
168 nmdc:mga03n38_84095_c1 3300050490 Bacteria 1502
169 nmdc:mga00v17_137564_c1 3300050491 Bacteria 1564
170 nmdc:mga00v17_438436_c1 3300050491 Bacteria 848
171 nmdc:mga00v17_458244_c1 3300050491 Unclassified 828
172 nmdc:mga00v17_6912_c1 3300050491 Bacteria 6032
173 nmdc:mga00v17_91414_c1 3300050491 Bacteria 1912
174 nmdc:mga0yw44_1314_c1 3300050492 Bacteria 9816
175 nmdc:mga0yw44_199159_c1 3300050492 Bacteria 1322
176 nmdc:mga0yw44_280336_c1 3300050492 Bacteria 1114
177 nmdc:mga0yw44_95734_c1 3300050492 Bacteria 1884
178 nmdc:mga04h51_213392_c1 3300050495 Bacteria 762
179 nmdc:mga05p37_853540_c1 3300050507 Unclassified 988
180 nmdc:mga09592_550182_c1 3300050508 Bacteria 991
181 nmdc:mga0qj67_149653_c1 3300050509 Bacteria 1894
182 nmdc:mga0qj67_32122_c1 3300050509 Bacteria 4093
183 nmdc:mga0qj67_367875_c1 3300050509 Bacteria 1161
184 nmdc:mga06r32_3155_c1 3300050510 Bacteria 14766
185 nmdc:mga06r32_785556_c1 3300050510 Bacteria 913
186 nmdc:mga06r32_880118_c1 3300050510 Bacteria 853
187 nmdc:mga08y16_149423_c1 3300050511 Bacteria 2429
188 nmdc:mga08y16_6225_c1 3300050511 Bacteria 12516
189 nmdc:mga0rr50_792785_c1 3300050513 Unclassified 808
190 nmdc:mga0a205_797831_c1 3300050515 Unclassified 792
191 Ga0500616_0012838 3300053153 Bacteria 4886
192 Ga0501084_0302180 3300054114 Bacteria 1352
193 Ga0501084_0641381 3300054114 Bacteria 897
194 Ga0501084_0884843 3300054114 Bacteria 751
195 Ga0501082_0239581 3300060353 Bacteria 1579
196 Ga0501082_0262425 3300060353 Bacteria 1503
197 Ga0501082_0548792 3300060353 Bacteria 1011
198 Ga0530510_0446872 3300061734 Bacteria 977
199 Ga0068867_101442540
200 rootH1_10172920
201 Ga0070676_10138174
202 Ga0068869_100399670
203 Ga0070689_100172109
204 Ga0070669_100127877
205 Ga0070674_100175516
206 Ga0070700_100079148
207 Ga0070681_10573323
208 Ga0068867_100020257
209 Ga0070698_100556163
210 Ga0070699_101105309
211 Ga0070672_100302191
212 Ga0070686_100764509
213 Ga0070696_100236148
214 Ga0070702_100056344
215 Ga0068861_100698672
216 Ga0068861_101625182
217 Ga0068870_10358306
218 Ga0068862_100501454
219 Ga0081455_10014470
220 Ga0081455_10093442
221 Ga0081538_10000014
222 Ga0075365_10000146
223 Ga0075365_10067054
224 Ga0075365_10077141
225 Ga0075368_10216853
226 Ga0075363_100084898
227 Ga0075363_100110105
228 Ga0075364_10007339
229 Ga0075364_10019859
230 Ga0075364_10159169
231 Ga0075364_10536063
232 Ga0075364_10893685
233 Ga0075362_10001787
234 Ga0075362_10009344
235 Ga0075367_10052365
236 Ga0075367_10246062
237 Ga0075369_10072740
238 Ga0075369_10230153
239 Ga0097621_100702352
240 Ga0075370_10398012
241 Ga0068871_100201786
242 Ga0068871_101462261
243 Ga0075428_100015808
244 Ga0075428_100216659
245 Ga0075428_101875412
246 Ga0075430_100011477
247 Ga0075430_100235142
248 Ga0075430_100267223
249 Ga0075431_100001772
250 Ga0075431_100121833
251 Ga0075431_100289429
252 Ga0075431_101030369
253 Ga0075433_10856240
254 Ga0075429_100008723
255 Ga0068865_100031533
256 Ga0111539_10002891
257 Ga0111539_10264319
258 Ga0105245_10009794
259 Ga0105245_10275758
260 Ga0105245_10897815
261 Ga0114129_10014167
262 Ga0114129_10830005
263 Ga0105243_10040248
264 Ga0105243_10272789
265 Ga0105241_10440932
266 Ga0105242_10005555
267 Ga0105248_10498820
268 Ga0105248_10996644
269 Ga0105249_10202692
270 Ga0105246_10818227
271 Ga0157378_10024920
272 Ga0157378_10926747
273 Ga0163162_10316626
274 Ga0163162_11509259
275 Ga0157375_10152139
276 Ga0157375_11225016
277 Ga0157380_10344793
278 Ga0157380_10560874
279 Ga0157379_10093551
280 Ga0157379_10298690
281 Ga0157379_10340449
282 Ga0157376_11585473
283 Ga0163161_10200454
284 Ga0207642_10023590
285 Ga0207688_10079258
286 Ga0207707_10380985
287 Ga0207681_10264072
288 Ga0207706_11467141
289 Ga0207709_10143506
290 Ga0207670_10079980
291 Ga0207669_10071252
292 Ga0207691_10281014
293 Ga0207691_10375196
294 Ga0207711_10484004
295 Ga0207712_11080688
296 Ga0207668_10745555
297 Ga0207640_10974717
298 Ga0207708_10184581
299 Ga0207648_10002835
300 Ga0207675_100316279
301 Ga0207675_100954033
302 Ga0207683_10650207
303 Ga0207428_10034941
304 Ga0207428_10129302
305 Ga0268264_10201792
306 Ga0316576_10575773
307 Ga0307410_10870120
308 Ga0307406_10478835
309 Ga0307409_100879965
310 Ga0307416_100198234
311 Ga0307414_10922987
312 Ga0373956_0010120
313 Ga0373931_0348918
314 Ga0436362_0500530
315 Ga0451802_0755006
316 Ga0451802_1267461
317 Ga0451853_0833411
318 Ga0439448_0043410
319 Ga0439450_027175
320 Ga0439463_009265
321 Ga0439444_0013405
322 Ga0439464_0016263
323 Ga0495592_0572795
324 Ga0495603_0431385
325 Ga0495629_0046881
326 Ga0495582_0587739
327 Ga0495618_0147776
328 Ga0495630_0053157
329 Ga0495630_0242294
330 Ga0495586_0036822
331 Ga0495634_0004723
332 Ga0495658_0460535
333 Ga0495613_0011728
334 Ga0495680_0148256
335 Ga0495686_0002331
336 Ga0496101_0020774
337 Ga0496102_0060066
338 Ga0496103_0098188
339 Ga0496104_0145801
340 Ga0496105_0027983
341 Ga0496106_0075115
342 Ga0496108_1034513
343 Ga0496109_0478884
344 Ga0496109_1685899
345 Ga0496110_0918956
346 Ga0496110_1013873
347 Ga0496111_0147357
348 Ga0496114_0047715
349 Ga0496114_0339748
350 Ga0496114_0740678
351 Ga0501032_0537072
352 Ga0501034_0015015
353 Ga0501039_0434027
354 Ga0501040_0240700
355 Ga0501041_0156115
356 Ga0501042_0553249
357 Ga0501048_0052442
358 Ga0501072_0267249
359 Ga0501072_0290554
360 Ga0501076_0506206
361 Ga0501079_0675402
362 Ga0501081_1071707
363 nmdc:mga03683_13212_c1
364 nmdc:mga03683_9207_c1
365 nmdc:mga03n38_100498_c1
366 nmdc:mga03n38_84095_c1
367 nmdc:mga00v17_137564_c1
368 nmdc:mga00v17_438436_c1
369 nmdc:mga00v17_458244_c1
370 nmdc:mga00v17_6912_c1
371 nmdc:mga00v17_91414_c1
372 nmdc:mga0yw44_1314_c1
373 nmdc:mga0yw44_199159_c1
374 nmdc:mga0yw44_280336_c1
375 nmdc:mga0yw44_95734_c1
376 nmdc:mga04h51_213392_c1
377 nmdc:mga05p37_853540_c1
378 nmdc:mga09592_550182_c1
379 nmdc:mga0qj67_149653_c1
380 nmdc:mga0qj67_32122_c1
381 nmdc:mga0qj67_367875_c1
382 nmdc:mga06r32_3155_c1
383 nmdc:mga06r32_785556_c1
384 nmdc:mga06r32_880118_c1
385 nmdc:mga08y16_149423_c1
386 nmdc:mga08y16_6225_c1
387 nmdc:mga0rr50_792785_c1
388 nmdc:mga0a205_797831_c1
389 Ga0500616_0012838
390 Ga0501084_0302180
391 Ga0501084_0641381
392 Ga0501084_0884843
393 Ga0501082_0239581
394 Ga0501082_0262425
395 Ga0501082_0548792
396 Ga0530510_0446872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

32

120

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8313 7 142
2hq7-assembly1.cif.gz_B crystal structure of protein related to general stress protein 26(gs26) of b.subtilis (pyridoxinephosphate oxidase family) (np_350077.1) from clostridium acetobutylicum at 2.00 a resolution 0.8025 2 158
2fhq-assembly1.cif.gz_B crystal structure of general stress protein from bacteroides thetaiotaomicron 0.7979 2 159
2ig6-assembly1.cif.gz_A crystal structure of a nimc/nima family protein (ca_c2569) from clostridium acetobutylicum at 1.80 a resolution 0.7944 5 159
2fhq-assembly1.cif.gz_B crystal structure of general stress protein from bacteroides thetaiotaomicron 0.7927 2 159
ID Description Score Start End Superfamily
af_Q2FVN7_2_129_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8355 9 143 2.30.110.10
2fhqB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7945 9 159 2.30.110.10
af_Q2FVN7_2_129_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7878 9 143 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7777 9 153 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.777 15 139 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A537XWB4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9781 1 159
AF-A0A3B0VEL9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9773 1 159 GO:0004733
AF-A0A537XWB4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9721 1 159
AF-A0A2S8MZK6-F1-model_v4 deleted 0.9681 8 93
AF-A0A6I5DR26-F1-model_v4 deleted 0.9658 1 158

Map