F304032

General Info

Members Datasets Scaffolds Average Seq Length
198 119 396 369

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10000010|Ga0070710_1000001078
Length 374
Sequence MSATTSAPSRAARVERVRASAYEIPTAMPQESDGTLVWRSTGVLVVEVAGGGETGLGYGYCDAAAARLVEQTLAGLVEGTDALAPPAAWARMQVGIRQLGHEGLAAMAVSAVDIALWDLKARLLGVALCDALPRFHDAVPAYGSGGFTSYADAELREQLGGWAAQGFRSVKMKVGRDPDADPGRVAAARAAVGDDVELMVDANGAYRDVPQALAWAERFVRELGVTWLEEPVSSRNVSGLRQVREHAPAGMAIAAGEYGWTLADAERLLDAEAVDVLQADVSRCGGITNLLRIDGLCKAHERPFSAHCVPAVMAHAGCALEALMHTEFFFDHARAERMLFDGVVDPVDGLLRPDRSRPGLGLELKRSDAERWAA

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 3.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.59
Rhizosphere 84.85
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10000010 3300005437 Bacteria 141733
2 Ga0070683_100014809 3300005329 Bacteria 6835
3 Ga0070683_100017641 3300005329 Bacteria 6307
4 Ga0070683_100021553 3300005329 Bacteria 5752
5 Ga0070670_100017438 3300005331 Bacteria 6159
6 Ga0070680_100044228 3300005336 Bacteria 3619
7 Ga0070680_100114066 3300005336 Unclassified 2251
8 Ga0070682_100101835 3300005337 Bacteria 1897
9 Ga0070660_100095483 3300005339 Unclassified 2350
10 Ga0070660_100137451 3300005339 Bacteria 1958
11 Ga0070671_100069783 3300005355 Bacteria 2931
12 Ga0070673_100054557 3300005364 Bacteria 3144
13 Ga0070659_100138169 3300005366 Bacteria 1983
14 Ga0070714_100074054 3300005435 Bacteria 2951
15 Ga0070663_100176636 3300005455 Bacteria 1654
16 Ga0070681_10000202 3300005458 Bacteria 46492
17 Ga0070681_10033389 3300005458 Bacteria 5167
18 Ga0070681_10258885 3300005458 Bacteria 1652
19 Ga0068867_100008859 3300005459 Bacteria 7098
20 Ga0070679_100002864 3300005530 Bacteria 15681
21 Ga0070679_100022132 3300005530 Bacteria 6211
22 Ga0070679_100313184 3300005530 Bacteria 1519
23 Ga0070684_100029970 3300005535 Unclassified 4618
24 Ga0070684_100047439 3300005535 Bacteria 3722
25 Ga0068853_100069524 3300005539 Unclassified 3063
26 Ga0068855_100011219 3300005563 Bacteria 10821
27 Ga0068855_100014118 3300005563 Bacteria 9624
28 Ga0068855_100208176 3300005563 Bacteria 2199
29 Ga0068857_100002641 3300005577 Bacteria 14719
30 Ga0068854_100007155 3300005578 Bacteria 7127
31 Ga0068856_100001637 3300005614 Bacteria 23461
32 Ga0068856_100011191 3300005614 Bacteria 8707
33 Ga0068856_100034627 3300005614 Bacteria 4946
34 Ga0070702_100090105 3300005615 Bacteria 1858
35 Ga0068859_100019103 3300005617 Bacteria 6883
36 Ga0068866_10006235 3300005718 Bacteria 4964
37 Ga0068863_100025925 3300005841 Bacteria 5594
38 Ga0070717_10021884 3300006028 Bacteria 5044
39 Ga0070717_10037277 3300006028 Bacteria 3948
40 Ga0070717_10088459 3300006028 Bacteria 2611
41 Ga0070712_100136442 3300006175 Bacteria 1866
42 Ga0068865_100017955 3300006881 Bacteria 4559
43 Ga0097620_100019104 3300006931 Bacteria 6883
44 Ga0105240_10002390 3300009093 Bacteria 30265
45 Ga0105240_10020091 3300009093 Bacteria 8915
46 Ga0105240_10211332 3300009093 Unclassified 2267
47 Ga0105242_10109454 3300009176 Unclassified 2352
48 Ga0105237_10016888 3300009545 Bacteria 7574
49 Ga0105238_10004153 3300009551 Bacteria 14369
50 Ga0105239_10067455 3300010375 Bacteria 3930
51 Ga0105239_10128070 3300010375 Unclassified 2822
52 Ga0157370_10005943 3300013104 Bacteria 13597
53 Ga0157370_10010288 3300013104 Bacteria 9869
54 Ga0157370_10018615 3300013104 Bacteria 6983
55 Ga0157369_10001760 3300013105 Bacteria 26244
56 Ga0157369_10005225 3300013105 Bacteria 15149
57 Ga0157369_10017395 3300013105 Bacteria 8080
58 Ga0157374_10002867 3300013296 Bacteria 14465
59 Ga0157378_10006501 3300013297 Bacteria 10218
60 Ga0157372_10001755 3300013307 Bacteria 23514
61 Ga0157372_10004617 3300013307 Bacteria 14645
62 Ga0157372_10010030 3300013307 Bacteria 10073
63 Ga0157372_10014912 3300013307 Bacteria 8321
64 Ga0163163_10033851 3300014325 Bacteria 4945
65 Ga0206356_10982283 3300020070 Bacteria 1988
66 Ga0206351_10044653 3300020077 Bacteria 3555
67 Ga0206350_11311795 3300020080 Bacteria 2969
68 Ga0206354_10523111 3300020081 Bacteria 4789
69 Ga0206353_11096773 3300020082 Bacteria 3771
70 Ga0213876_10034329 3300021384 Bacteria 2675
71 Ga0213875_10022167 3300021388 Unclassified 3038
72 Ga0224712_10006624 3300022467 Bacteria 3319
73 Ga0207692_10000006 3300025898 Bacteria 294686
74 Ga0207642_10091878 3300025899 Unclassified 1501
75 Ga0207647_10010257 3300025904 Bacteria 6619
76 Ga0207705_10132238 3300025909 Bacteria 1857
77 Ga0207707_10000177 3300025912 Bacteria 66169
78 Ga0207707_10000545 3300025912 Bacteria 38353
79 Ga0207695_10001651 3300025913 Bacteria 35945
80 Ga0207695_10007965 3300025913 Bacteria 13366
81 Ga0207671_10094895 3300025914 Unclassified 2252
82 Ga0207693_10145522 3300025915 Bacteria 1863
83 Ga0207660_10070471 3300025917 Unclassified 2542
84 Ga0207649_10044667 3300025920 Bacteria 2713
85 Ga0207652_10006019 3300025921 Bacteria 9820
86 Ga0207652_10255458 3300025921 Bacteria 1581
87 Ga0207694_10002808 3300025924 Bacteria 14063
88 Ga0207644_10148010 3300025931 Bacteria 1815
89 Ga0207661_10016383 3300025944 Bacteria 5466
90 Ga0207661_10021559 3300025944 Bacteria 4829
91 Ga0207679_10022533 3300025945 Bacteria 4291
92 Ga0207667_10000907 3300025949 Bacteria 37748
93 Ga0207667_10003533 3300025949 Bacteria 19325
94 Ga0207640_10171428 3300025981 Bacteria 1617
95 Ga0207639_10062998 3300026041 Unclassified 2869
96 Ga0207708_10082886 3300026075 Bacteria 2465
97 Ga0207702_10008704 3300026078 Bacteria 8559
98 Ga0207702_10137334 3300026078 Unclassified 2208
99 Ga0207702_10150339 3300026078 Bacteria 2117
100 Ga0207702_10165684 3300026078 Bacteria 2022
101 Ga0207641_10044707 3300026088 Bacteria 3725
102 Ga0207674_10003705 3300026116 Bacteria 18663
103 Ga0207698_10087461 3300026142 Unclassified 2538
104 Ga0268264_10224422 3300028381 Bacteria 1731
105 Ga0436364_0099322 3300037853 Plasmid 2890
106 Ga0436364_0154572 3300037853 Unclassified 1355
107 Ga0436364_0208444 3300037853 Unclassified 3387
108 Ga0436364_0246855 3300037853 Unclassified 1884
109 Ga0436364_0428853 3300037853 Unclassified 1835
110 Ga0436364_1145540 3300037853 Bacteria 4989
111 Ga0436364_1559510 3300037853 Bacteria 1561
112 Ga0436365_0312251 3300039437 Bacteria 16424
113 Ga0436365_0371963 3300039437 Bacteria 8922
114 Ga0436365_0865603 3300039437 Bacteria 2791
115 Ga0436363_0408059 3300039450 Bacteria 5850
116 Ga0466969_0000433 3300044656 Bacteria 22920
117 Ga0466966_0000122 3300044684 Bacteria 49028
118 Ga0466966_0003399 3300044684 Bacteria 10499
119 Ga0466966_0022714 3300044684 Bacteria 4113
120 Ga0466961_0000125 3300044693 Bacteria 51353
121 Ga0466961_0103732 3300044693 Bacteria 1790
122 Ga0466963_0002139 3300044694 Bacteria 10924
123 Ga0466963_0005414 3300044694 Bacteria 7474
124 Ga0466963_0009292 3300044694 Bacteria 5921
125 Ga0466963_0053394 3300044694 Bacteria 2683
126 Ga0466963_0074395 3300044694 Bacteria 2291
127 Ga0466963_0119087 3300044694 Bacteria 1816
128 Ga0466964_0000023 3300044706 Bacteria 33537
129 Ga0466971_0000113 3300044719 Bacteria 29117
130 Ga0466971_0053500 3300044719 Bacteria 1819
131 Ga0466971_0076556 3300044719 Bacteria 1522
132 Ga0466968_0012104 3300044735 Bacteria 3370
133 Ga0466968_0024371 3300044735 Bacteria 2471
134 Ga0466968_0055856 3300044735 Bacteria 1695
135 Ga0466970_0000537 3300044765 Bacteria 18495
136 Ga0466970_0011615 3300044765 Bacteria 4494
137 Ga0466957_0001138 3300044842 Bacteria 13782
138 Ga0466957_0001717 3300044842 Bacteria 11526
139 Ga0466957_0030132 3300044842 Bacteria 3239
140 Ga0466960_0071551 3300044901 Bacteria 1727
141 Ga0466959_0006719 3300045049 Bacteria 8006
142 Ga0466959_0008947 3300045049 Bacteria 7103
143 Ga0466959_0009932 3300045049 Bacteria 6787
144 Ga0466959_0020958 3300045049 Bacteria 4819
145 Ga0466958_0000598 3300045836 Bacteria 15372
146 Ga0466958_0007845 3300045836 Bacteria 5896
147 Ga0466958_0008935 3300045836 Bacteria 5567
148 Ga0466958_0014613 3300045836 Bacteria 4483
149 Ga0466958_0097230 3300045836 Bacteria 1827
150 Ga0466958_0109247 3300045836 Bacteria 1726
151 Ga0466958_0152435 3300045836 Bacteria 1458
152 Ga0466958_0181313 3300045836 Bacteria 1336
153 Ga0466967_0007010 3300045976 Bacteria 8069
154 Ga0466967_0013202 3300045976 Bacteria 6369
155 Ga0466967_0023666 3300045976 Bacteria 5038
156 Ga0466967_0024211 3300045976 Bacteria 4988
157 Ga0466967_0101270 3300045976 Bacteria 2633
158 Ga0466967_0153772 3300045976 Bacteria 2153
159 Ga0466967_0186315 3300045976 Bacteria 1960
160 Ga0496101_0017098 3300048904 Bacteria 4913
161 Ga0496101_0092906 3300048904 Bacteria 2247
162 Ga0496102_0426297 3300048905 Bacteria 1246
163 Ga0496104_0072544 3300048907 Bacteria 3274
164 Ga0496106_0037526 3300048909 Bacteria 3625
165 Ga0496107_0025753 3300048910 Bacteria 4166
166 Ga0496108_0003983 3300048911 Bacteria 11857
167 Ga0496108_0005978 3300048911 Bacteria 9861
168 Ga0496109_0004399 3300048912 Bacteria 11770
169 Ga0496110_0036365 3300048913 Bacteria 4275
170 Ga0496110_0337690 3300048913 Bacteria 1372
171 Ga0496111_0029934 3300048914 Bacteria 3869
172 Ga0496112_0070546 3300048915 Bacteria 3454
173 Ga0496112_0076255 3300048915 Bacteria 3316
174 Ga0496112_0193212 3300048915 Bacteria 1996
175 Ga0496113_0021040 3300048916 Bacteria 4597
176 Ga0496114_0029456 3300048917 Bacteria 4513
177 Ga0501031_0011359 3300049568 Bacteria 5798
178 Ga0501032_0014988 3300049569 Bacteria 5481
179 Ga0501033_0027821 3300049570 Bacteria 4249
180 Ga0501034_0036861 3300049571 Bacteria 4951
181 Ga0501036_0146398 3300049572 Bacteria 1992
182 Ga0501037_0042689 3300049573 Bacteria 3332
183 Ga0501043_0079329 3300049579 Bacteria 2579
184 Ga0501046_0015084 3300049580 Bacteria 6497
185 Ga0501067_0039896 3300049583 Bacteria 2607
186 Ga0501069_0010960 3300049585 Bacteria 4806
187 Ga0501070_0000463 3300049586 Bacteria 36856
188 Ga0501070_0012236 3300049586 Bacteria 7240
189 Ga0501072_0025054 3300049588 Bacteria 4645
190 Ga0501073_0004827 3300049589 Bacteria 10119
191 Ga0501079_0042058 3300049741 Bacteria 3529
192 Ga0501080_0029128 3300049742 Bacteria 5139
193 Ga0501083_0012325 3300049744 Bacteria 5982
194 Ga0501035_0017599 3300049822 Bacteria 6594
195 Ga0501044_0209172 3300049823 Bacteria 1906
196 Ga0501082_0134124 3300060353 Bacteria 2148
197 Ga0466962_0000116 3300061719 Bacteria 32294
198 Ga0466962_0095099 3300061719 Bacteria 1428
199 Ga0070710_10000010
200 Ga0070683_100014809
201 Ga0070683_100017641
202 Ga0070683_100021553
203 Ga0070670_100017438
204 Ga0070680_100044228
205 Ga0070680_100114066
206 Ga0070682_100101835
207 Ga0070660_100095483
208 Ga0070660_100137451
209 Ga0070671_100069783
210 Ga0070673_100054557
211 Ga0070659_100138169
212 Ga0070714_100074054
213 Ga0070663_100176636
214 Ga0070681_10000202
215 Ga0070681_10033389
216 Ga0070681_10258885
217 Ga0068867_100008859
218 Ga0070679_100002864
219 Ga0070679_100022132
220 Ga0070679_100313184
221 Ga0070684_100029970
222 Ga0070684_100047439
223 Ga0068853_100069524
224 Ga0068855_100011219
225 Ga0068855_100014118
226 Ga0068855_100208176
227 Ga0068857_100002641
228 Ga0068854_100007155
229 Ga0068856_100001637
230 Ga0068856_100011191
231 Ga0068856_100034627
232 Ga0070702_100090105
233 Ga0068859_100019103
234 Ga0068866_10006235
235 Ga0068863_100025925
236 Ga0070717_10021884
237 Ga0070717_10037277
238 Ga0070717_10088459
239 Ga0070712_100136442
240 Ga0068865_100017955
241 Ga0097620_100019104
242 Ga0105240_10002390
243 Ga0105240_10020091
244 Ga0105240_10211332
245 Ga0105242_10109454
246 Ga0105237_10016888
247 Ga0105238_10004153
248 Ga0105239_10067455
249 Ga0105239_10128070
250 Ga0157370_10005943
251 Ga0157370_10010288
252 Ga0157370_10018615
253 Ga0157369_10001760
254 Ga0157369_10005225
255 Ga0157369_10017395
256 Ga0157374_10002867
257 Ga0157378_10006501
258 Ga0157372_10001755
259 Ga0157372_10004617
260 Ga0157372_10010030
261 Ga0157372_10014912
262 Ga0163163_10033851
263 Ga0206356_10982283
264 Ga0206351_10044653
265 Ga0206350_11311795
266 Ga0206354_10523111
267 Ga0206353_11096773
268 Ga0213876_10034329
269 Ga0213875_10022167
270 Ga0224712_10006624
271 Ga0207692_10000006
272 Ga0207642_10091878
273 Ga0207647_10010257
274 Ga0207705_10132238
275 Ga0207707_10000177
276 Ga0207707_10000545
277 Ga0207695_10001651
278 Ga0207695_10007965
279 Ga0207671_10094895
280 Ga0207693_10145522
281 Ga0207660_10070471
282 Ga0207649_10044667
283 Ga0207652_10006019
284 Ga0207652_10255458
285 Ga0207694_10002808
286 Ga0207644_10148010
287 Ga0207661_10016383
288 Ga0207661_10021559
289 Ga0207679_10022533
290 Ga0207667_10000907
291 Ga0207667_10003533
292 Ga0207640_10171428
293 Ga0207639_10062998
294 Ga0207708_10082886
295 Ga0207702_10008704
296 Ga0207702_10137334
297 Ga0207702_10150339
298 Ga0207702_10165684
299 Ga0207641_10044707
300 Ga0207674_10003705
301 Ga0207698_10087461
302 Ga0268264_10224422
303 Ga0436364_0099322
304 Ga0436364_0154572
305 Ga0436364_0208444
306 Ga0436364_0246855
307 Ga0436364_0428853
308 Ga0436364_1145540
309 Ga0436364_1559510
310 Ga0436365_0312251
311 Ga0436365_0371963
312 Ga0436365_0865603
313 Ga0436363_0408059
314 Ga0466969_0000433
315 Ga0466966_0000122
316 Ga0466966_0003399
317 Ga0466966_0022714
318 Ga0466961_0000125
319 Ga0466961_0103732
320 Ga0466963_0002139
321 Ga0466963_0005414
322 Ga0466963_0009292
323 Ga0466963_0053394
324 Ga0466963_0074395
325 Ga0466963_0119087
326 Ga0466964_0000023
327 Ga0466971_0000113
328 Ga0466971_0053500
329 Ga0466971_0076556
330 Ga0466968_0012104
331 Ga0466968_0024371
332 Ga0466968_0055856
333 Ga0466970_0000537
334 Ga0466970_0011615
335 Ga0466957_0001138
336 Ga0466957_0001717
337 Ga0466957_0030132
338 Ga0466960_0071551
339 Ga0466959_0006719
340 Ga0466959_0008947
341 Ga0466959_0009932
342 Ga0466959_0020958
343 Ga0466958_0000598
344 Ga0466958_0007845
345 Ga0466958_0008935
346 Ga0466958_0014613
347 Ga0466958_0097230
348 Ga0466958_0109247
349 Ga0466958_0152435
350 Ga0466958_0181313
351 Ga0466967_0007010
352 Ga0466967_0013202
353 Ga0466967_0023666
354 Ga0466967_0024211
355 Ga0466967_0101270
356 Ga0466967_0153772
357 Ga0466967_0186315
358 Ga0496101_0017098
359 Ga0496101_0092906
360 Ga0496102_0426297
361 Ga0496104_0072544
362 Ga0496106_0037526
363 Ga0496107_0025753
364 Ga0496108_0003983
365 Ga0496108_0005978
366 Ga0496109_0004399
367 Ga0496110_0036365
368 Ga0496110_0337690
369 Ga0496111_0029934
370 Ga0496112_0070546
371 Ga0496112_0076255
372 Ga0496112_0193212
373 Ga0496113_0021040
374 Ga0496114_0029456
375 Ga0501031_0011359
376 Ga0501032_0014988
377 Ga0501033_0027821
378 Ga0501034_0036861
379 Ga0501036_0146398
380 Ga0501037_0042689
381 Ga0501043_0079329
382 Ga0501046_0015084
383 Ga0501067_0039896
384 Ga0501069_0010960
385 Ga0501070_0000463
386 Ga0501070_0012236
387 Ga0501072_0025054
388 Ga0501073_0004827
389 Ga0501079_0042058
390 Ga0501080_0029128
391 Ga0501083_0012325
392 Ga0501035_0017599
393 Ga0501044_0209172
394 Ga0501082_0134124
395 Ga0466962_0000116
396 Ga0466962_0095099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

154

369

0.94

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

17

132

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cyj-assembly1.cif.gz_A crystal structure of a mandelate racemase/muconate lactonizing enzyme-like protein from rubrobacter xylanophilus 0.9855 16 374
3cyj-assembly1.cif.gz_A crystal structure of a mandelate racemase/muconate lactonizing enzyme-like protein from rubrobacter xylanophilus 0.98 16 374
3ck5-assembly1.cif.gz_A crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.9453 17 374
3ck5-assembly1.cif.gz_A crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.9402 17 374
4hnc-assembly1.cif.gz_B p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid 0.9382 15 374
ID Description Score Start End Superfamily
3cyjD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9874 16 126 3.30.390.10
3cyjD02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9773 128 365 3.20.20.120
3cyjD02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9733 128 365 3.20.20.120
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9401 129 365 3.20.20.120
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9372 129 365 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A4Y9QKV4-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.9936 169 374 GO:0000287
GO:0016052
GO:0016836
AF-A0A2V6FX75-F1-model_v4 Mandelate racemase 0.9928 13 183 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A1V3XYE1-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme-like protein 0.9926 57 372 GO:0000287
GO:0009234
GO:0016052
GO:0016836
AF-A0A6G3D5B6-F1-model_v4 Mandelate racemase 0.9895 81 372 GO:0000287
GO:0016052
GO:0016836
AF-A0A534TBP2-F1-model_v4 Mandelate racemase 0.989 15 374 GO:0000287
GO:0009063
GO:0016052
GO:0016836

Map