F303825

General Info

Members Datasets Scaffolds Average Seq Length
198 123 187 268

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10078551|rootH2_100785512
Length 284
Sequence MRPPAASSDVPAFRLGARASLAGYGLRAFDTIGSTNAEALAAAQAGQGGPLWFTALQQTAGRGRRGRPWSTPHGNLAASLLLVPEVEPALAATLGFVAGVALNQALAAVLPKGRFRVGIDGADGEGTRIALKWPNDVLADGAKLAGILLEAQKLADGRPAIVIGFGVNVVAAPEGLPYPATSLAALGAGDVDAQTVFEALSNAWVEAFALWNSGRGIADVLARWRGSAAGIGAPVAVSRHGDVVRGIFETIDDSGRLVVRTDDDARIAITAGDVHFGAMATVAP

Samples

Sample ID Description Type Environment
1 2643221580 Devosia sp. Root635 Isolate Unclassified
2 2643221591 Devosia sp. Root685 Isolate Unclassified
3 2643221629 Devosia sp. Root105 Isolate Unclassified
4 2643221662 Devosia sp. Root413D1 Isolate Unclassified
5 2643221674 Devosia sp. Root436 Isolate Unclassified
6 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
7 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
8 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
9 2932401849 Devosia sp. 2618 Isolate Rhizosphere
10 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
11 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 0
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 1.01
Rhizosphere 82.83
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1001577 3300003214 Bacteria 11158
2 rootH1_10161832 3300003316 Bacteria 1156
3 rootH2_10001938 3300003320 Bacteria 1175
4 rootH2_10078551 3300003320 Bacteria 1564
5 rootH2_10098432 3300003320 Bacteria 1486
6 rootH1_10130395 3300003323 Bacteria 1168
7 Ga0070658_10007611 3300005327 Bacteria 8735
8 Ga0070658_10034452 3300005327 Bacteria 4073
9 Ga0070658_10164697 3300005327 Bacteria 1861
10 Ga0070683_100308705 3300005329 Bacteria 1505
11 Ga0068868_100430645 3300005338 Bacteria 1144
12 Ga0070660_100006687 3300005339 Bacteria 8001
13 Ga0070661_100001119 3300005344 Bacteria 18814
14 Ga0070661_100015009 3300005344 Bacteria 5466
15 Ga0070661_100017842 3300005344 Bacteria 5038
16 Ga0070661_100134558 3300005344 Bacteria 1859
17 Ga0070661_100144699 3300005344 Bacteria 1793
18 Ga0070668_100034948 3300005347 Bacteria 3831
19 Ga0070674_100028142 3300005356 Bacteria 3690
20 Ga0070659_100014445 3300005366 Bacteria 5901
21 Ga0070659_100145386 3300005366 Bacteria 1931
22 Ga0070659_100670465 3300005366 Bacteria 895
23 Ga0070662_100416375 3300005457 Bacteria 1111
24 Ga0070679_100306243 3300005530 Bacteria 1539
25 Ga0068853_100002042 3300005539 Bacteria 14954
26 Ga0068853_100022674 3300005539 Bacteria 5248
27 Ga0068853_100077745 3300005539 Bacteria 2899
28 Ga0068853_100121171 3300005539 Bacteria 2333
29 Ga0070665_100016479 3300005548 Bacteria 7410
30 Ga0068855_100139577 3300005563 Bacteria 2764
31 Ga0068855_100181201 3300005563 Bacteria 2381
32 Ga0070664_100178673 3300005564 Bacteria 1886
33 Ga0068857_100035257 3300005577 Bacteria 4431
34 Ga0068857_100357634 3300005577 Bacteria 1353
35 Ga0068854_100026099 3300005578 Bacteria 4012
36 Ga0068854_100032004 3300005578 Bacteria 3657
37 Ga0068856_100050277 3300005614 Bacteria 4109
38 Ga0068856_100105220 3300005614 Bacteria 2816
39 Ga0068856_100392393 3300005614 Bacteria 1408
40 Ga0068852_100050438 3300005616 Bacteria 3566
41 Ga0068852_100113105 3300005616 Bacteria 2471
42 Ga0068852_100144315 3300005616 Bacteria 2206
43 Ga0081455_10043348 3300005937 Bacteria 3936
44 Ga0070717_10516647 3300006028 Unclassified 1080
45 Ga0075363_100185510 3300006048 Bacteria 1185
46 Ga0075363_100206506 3300006048 Bacteria 1123
47 Ga0075367_10003260 3300006178 Bacteria 7679
48 Ga0075366_10046013 3300006195 Bacteria 2585
49 Ga0075370_10006534 3300006353 Bacteria 5871
50 Ga0075370_10094006 3300006353 Bacteria 1731
51 Ga0105245_10394960 3300009098 Bacteria 1381
52 Ga0105241_10038165 3300009174 Bacteria 3621
53 Ga0105241_10142072 3300009174 Bacteria 1956
54 Ga0105237_10000821 3300009545 Bacteria 42486
55 Ga0105237_10361316 3300009545 Bacteria 1456
56 Ga0105238_10040712 3300009551 Bacteria 4708
57 Ga0105238_10102695 3300009551 Bacteria 2840
58 Ga0105238_10292532 3300009551 Bacteria 1611
59 Ga0105239_10005296 3300010375 Bacteria 15156
60 Ga0105239_10237386 3300010375 Bacteria 2046
61 Ga0105239_10243473 3300010375 Bacteria 2019
62 Ga0157371_10109099 3300013102 Bacteria 1964
63 Ga0157370_10073286 3300013104 Bacteria 3231
64 Ga0157369_10022874 3300013105 Bacteria 6970
65 Ga0157369_10145901 3300013105 Bacteria 2502
66 Ga0157378_10042120 3300013297 Bacteria 4051
67 Ga0157372_10103713 3300013307 Bacteria 3250
68 Ga0182005_1006771 3300015265 Bacteria 3475
69 Ga0209233_1000408 3300025261 Bacteria 34052
70 Ga0209233_1039697 3300025261 Bacteria 1029
71 Ga0207656_10026980 3300025321 Bacteria 2346
72 Ga0207645_10047125 3300025907 Bacteria 2752
73 Ga0207705_10023636 3300025909 Bacteria 4384
74 Ga0207695_10024716 3300025913 Bacteria 6747
75 Ga0207671_10000227 3300025914 Bacteria 84794
76 Ga0207657_10013829 3300025919 Bacteria 7898
77 Ga0207657_10096950 3300025919 Bacteria 2452
78 Ga0207657_10108258 3300025919 Bacteria 2297
79 Ga0207657_10185814 3300025919 Bacteria 1678
80 Ga0207649_10011878 3300025920 Bacteria 4818
81 Ga0207649_10055155 3300025920 Bacteria 2476
82 Ga0207649_10064374 3300025920 Bacteria 2318
83 Ga0207694_10098851 3300025924 Bacteria 2311
84 Ga0207694_10108226 3300025924 Bacteria 2209
85 Ga0207690_10240088 3300025932 Bacteria 1395
86 Ga0207704_10556166 3300025938 Unclassified 933
87 Ga0207661_10454238 3300025944 Bacteria 1167
88 Ga0207667_10012235 3300025949 Bacteria 9911
89 Ga0207667_10228323 3300025949 Bacteria 1906
90 Ga0207667_10352550 3300025949 Bacteria 1501
91 Ga0207668_10007054 3300025972 Bacteria 6664
92 Ga0207640_10003452 3300025981 Bacteria 8511
93 Ga0207640_10075374 3300025981 Bacteria 2286
94 Ga0207639_10002259 3300026041 Bacteria 12945
95 Ga0207639_10517434 3300026041 Bacteria 1092
96 Ga0207678_10093265 3300026067 Bacteria 2573
97 Ga0207678_10136927 3300026067 Bacteria 2089
98 Ga0207678_10168940 3300026067 Bacteria 1867
99 Ga0207702_10525240 3300026078 Bacteria 1156
100 Ga0207674_10014539 3300026116 Bacteria 8690
101 Ga0207674_10163716 3300026116 Bacteria 2178
102 Ga0207674_10588416 3300026116 Bacteria 1075
103 Ga0207698_10036859 3300026142 Bacteria 3595
104 Ga0207698_10148408 3300026142 Bacteria 2031
105 Ga0207698_10164888 3300026142 Bacteria 1943
106 Ga0207698_10193253 3300026142 Bacteria 1815
107 Ga0268266_10000677 3300028379 Bacteria 46024
108 Ga0268266_10230725 3300028379 Bacteria 1705
109 Ga0265334_10101135 3300028573 Bacteria 1043
110 Ga0265338_10017836 3300028800 Bacteria 7632
111 Ga0265324_10027764 3300029957 Bacteria 1998
112 Ga0265325_10009678 3300031241 Bacteria 5620
113 Ga0265339_10001947 3300031249 Bacteria 15168
114 Ga0265331_10027749 3300031250 Bacteria 2836
115 Ga0265316_10401074 3300031344 Bacteria 988
116 Ga0265313_10000032 3300031595 Bacteria 128964
117 Ga0265314_10090789 3300031711 Bacteria 1989
118 Ga0307516_10101814 3300031730 Bacteria 2688
119 Ga0307413_10048573 3300031824 Bacteria 2537
120 Ga0307412_10182556 3300031911 Bacteria 1580
121 Ga0307412_10238068 3300031911 Bacteria 1406
122 Ga0307409_100352847 3300031995 Bacteria 1389
123 Ga0307416_100838559 3300032002 Bacteria 1017
124 Ga0307414_10003935 3300032004 Bacteria 8007
125 Ga0307414_10010499 3300032004 Bacteria 5379
126 Ga0307414_10171586 3300032004 Bacteria 1735
127 Ga0373934_0019349 3300035086 Bacteria 2613
128 Ga0373931_0047618 3300035691 Bacteria 2270
129 Ga0373937_0363468 3300036401 Bacteria 1372
130 Ga0395899_0017812 3300037312 Bacteria 5408
131 Ga0395899_0273444 3300037312 Bacteria 1151
132 Ga0395900_0115812 3300037418 Bacteria 2750
133 Ga0395901_0072930 3300038443 Bacteria 3579
134 Ga0395901_0401130 3300038443 Bacteria 1409
135 Ga0439465_0032050 3300041413 Bacteria 1676
136 Ga0439465_0122554 3300041413 Bacteria 912
137 Ga0451807_0915695 3300041486 Bacteria 1485
138 Ga0439445_0020043 3300042004 Bacteria 1671
139 Ga0466965_0121026 3300044683 Bacteria 1352
140 Ga0466957_0126378 3300044842 Bacteria 1634
141 Ga0495672_0054004 3300047320 Bacteria 2351
142 Ga0495686_0137111 3300047472 Bacteria 1446
143 Ga0496106_0153068 3300048909 Bacteria 1820
144 Ga0496125_0003219 3300048928 Bacteria 20151
145 Ga0496125_0271629 3300048928 Bacteria 1056
146 Ga0501031_0158132 3300049568 Bacteria 1481
147 Ga0501032_0022459 3300049569 Bacteria 4372
148 Ga0501033_0043623 3300049570 Bacteria 3340
149 Ga0501033_0077194 3300049570 Bacteria 2444
150 Ga0501033_0168299 3300049570 Bacteria 1575
151 Ga0501034_0005818 3300049571 Bacteria 13410
152 Ga0501034_0009001 3300049571 Bacteria 10485
153 Ga0501034_0016680 3300049571 Bacteria 7530
154 Ga0501034_0071611 3300049571 Bacteria 3476
155 Ga0501034_0076968 3300049571 Bacteria 3342
156 Ga0501034_0086424 3300049571 Bacteria 3137
157 Ga0501034_0134867 3300049571 Bacteria 2450
158 Ga0501034_0550173 3300049571 Bacteria 1063
159 Ga0501036_0002298 3300049572 Bacteria 14945
160 Ga0501037_0022604 3300049573 Bacteria 4650
161 Ga0501038_0008234 3300049574 Bacteria 9596
162 Ga0501039_0020535 3300049575 Bacteria 5062
163 Ga0501043_0231055 3300049579 Bacteria 1428
164 Ga0501046_0054017 3300049580 Bacteria 3162
165 Ga0501047_0142635 3300049581 Bacteria 2273
166 Ga0501047_0192705 3300049581 Bacteria 1901
167 Ga0501047_0312203 3300049581 Bacteria 1412
168 Ga0501070_0009673 3300049586 Bacteria 8152
169 Ga0501070_0015398 3300049586 Bacteria 6433
170 Ga0501070_0023772 3300049586 Bacteria 5136
171 Ga0501070_0291643 3300049586 Bacteria 1330
172 Ga0501080_0089786 3300049742 Bacteria 2855
173 Ga0501080_0238226 3300049742 Bacteria 1661
174 Ga0501035_0029639 3300049822 Bacteria 4990
175 Ga0501035_0050469 3300049822 Bacteria 3728
176 Ga0501044_0023213 3300049823 Bacteria 6601
177 Ga0501044_0246874 3300049823 Bacteria 1728
178 Ga0501044_0484754 3300049823 Bacteria 1139
179 nmdc:mga03683_10024_c1 3300050489 Bacteria 3386
180 nmdc:mga03683_27527_c1 3300050489 Bacteria 2252
181 nmdc:mga0k408_14604_c1 3300050493 Bacteria 3962
182 nmdc:mga07m45_63298_c1 3300050496 Bacteria 2098
183 Ga0500593_000050 3300053117 Bacteria 42339
184 Ga0500568_0000001 3300053139 Bacteria 988705
185 Ga0500568_0006183 3300053139 Bacteria 6054
186 Ga0500616_0004932 3300053153 Bacteria 9266
187 Ga0500634_0000044 3300053161 Bacteria 56580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100838559 Ga0307416_1008385592 218
2 iso_pu_bacteria 2861691609 2861694954 235
3 3300049823 Ga0501044_0246874 Ga0501044_0246874_441_1187 241
4 3300035086 Ga0373934_0019349 Ga0373934_0019349_1039_1794 242
5 3300036401 Ga0373937_0363468 Ga0373937_0363468_320_1075 242
6 3300006028 Ga0070717_10516647 Ga0070717_105166472 244
7 3300047472 Ga0495686_0137111 Ga0495686_0137111_164_928 247
8 3300049569 Ga0501032_0022459 Ga0501032_0022459_115_924 247
9 3300049570 Ga0501033_0077194 Ga0501033_0077194_115_924 247
10 3300049572 Ga0501036_0002298 Ga0501036_0002298_7885_8694 247
11 3300049573 Ga0501037_0022604 Ga0501037_0022604_3556_4365 247
12 3300049574 Ga0501038_0008234 Ga0501038_0008234_1231_2040 247
13 3300049575 Ga0501039_0020535 Ga0501039_0020535_952_1761 247
14 3300049579 Ga0501043_0231055 Ga0501043_0231055_59_868 247
15 3300049581 Ga0501047_0312203 Ga0501047_0312203_39_848 247
16 3300049586 Ga0501070_0023772 Ga0501070_0023772_2429_3238 247
17 iso_pu_bacteria 2996336353 2996340925 247
18 3300006048 Ga0075363_100206506 Ga0075363_1002065061 248
19 3300006178 Ga0075367_10003260 Ga0075367_100032608 248
20 3300006195 Ga0075366_10046013 Ga0075366_100460133 248
21 3300006353 Ga0075370_10006534 Ga0075370_100065344 248
22 3300013297 Ga0157378_10042120 Ga0157378_100421202 248
23 3300025949 Ga0207667_10352550 Ga0207667_103525501 248
24 3300050489 nmdc:mga03683_27527_c1 nmdc:mga03683_27527_c1_1238_2050 248
25 3300050493 nmdc:mga0k408_14604_c1 nmdc:mga0k408_14604_c1_1700_2512 248
26 3300050496 nmdc:mga07m45_63298_c1 nmdc:mga07m45_63298_c1_1045_1857 248
27 3300003316 rootH1_10161832 rootH1_101618322 249
28 3300005329 Ga0070683_100308705 Ga0070683_1003087051 249
29 3300005344 Ga0070661_100001119 Ga0070661_1000011199 249
30 3300005539 Ga0068853_100002042 Ga0068853_1000020422 249
31 3300005578 Ga0068854_100032004 Ga0068854_1000320042 249
32 3300005614 Ga0068856_100105220 Ga0068856_1001052202 249
33 3300005616 Ga0068852_100050438 Ga0068852_1000504382 249
34 3300009174 Ga0105241_10038165 Ga0105241_100381653 249
35 3300009551 Ga0105238_10102695 Ga0105238_101026952 249
36 3300010375 Ga0105239_10237386 Ga0105239_102373862 249
37 3300025321 Ga0207656_10026980 Ga0207656_100269801 249
38 3300025920 Ga0207649_10055155 Ga0207649_100551552 249
39 3300025924 Ga0207694_10098851 Ga0207694_100988512 249
40 3300025944 Ga0207661_10454238 Ga0207661_104542382 249
41 3300025981 Ga0207640_10003452 Ga0207640_100034524 249
42 3300026142 Ga0207698_10164888 Ga0207698_101648882 249
43 3300031344 Ga0265316_10401074 Ga0265316_104010741 251
44 3300003323 rootH1_10130395 rootH1_101303952 252
45 3300025907 Ga0207645_10047125 Ga0207645_100471253 252
46 3300031995 Ga0307409_100352847 Ga0307409_1003528472 252
47 3300049571 Ga0501034_0005818 Ga0501034_0005818_4164_4988 252
48 3300005327 Ga0070658_10164697 Ga0070658_101646972 253
49 3300005338 Ga0068868_100430645 Ga0068868_1004306452 253
50 3300005344 Ga0070661_100144699 Ga0070661_1001446992 253
51 3300005356 Ga0070674_100028142 Ga0070674_1000281422 253
52 3300005366 Ga0070659_100145386 Ga0070659_1001453862 253
53 3300005457 Ga0070662_100416375 Ga0070662_1004163752 253
54 3300005564 Ga0070664_100178673 Ga0070664_1001786732 253
55 3300005577 Ga0068857_100035257 Ga0068857_1000352575 253
56 3300009174 Ga0105241_10142072 Ga0105241_101420722 253
57 3300009551 Ga0105238_10040712 Ga0105238_100407125 253
58 3300025919 Ga0207657_10096950 Ga0207657_100969502 253
59 3300025919 Ga0207657_10108258 Ga0207657_101082582 253
60 3300025920 Ga0207649_10011878 Ga0207649_100118784 253
61 3300025938 Ga0207704_10556166 Ga0207704_105561661 253
62 3300025981 Ga0207640_10075374 Ga0207640_100753742 253
63 3300026116 Ga0207674_10014539 Ga0207674_100145392 253
64 3300026142 Ga0207698_10148408 Ga0207698_101484082 253
65 3300035691 Ga0373931_0047618 Ga0373931_0047618_1050_1874 253
66 3300041413 Ga0439465_0122554 Ga0439465_0122554_26_853 253
67 3300041486 Ga0451807_0915695 Ga0451807_0915695_94_921 253
68 3300042004 Ga0439445_0020043 Ga0439445_0020043_576_1403 253
69 3300044842 Ga0466957_0126378 Ga0466957_0126378_231_1055 253
70 3300005548 Ga0070665_100016479 Ga0070665_1000164796 254
71 3300005937 Ga0081455_10043348 Ga0081455_100433482 254
72 3300009545 Ga0105237_10000821 Ga0105237_1000082111 254
73 3300010375 Ga0105239_10005296 Ga0105239_100052966 254
74 3300025914 Ga0207671_10000227 Ga0207671_1000022781 254
75 3300028379 Ga0268266_10000677 Ga0268266_1000067727 254
76 3300048928 Ga0496125_0271629 Ga0496125_0271629_236_1021 254
77 3300003320 rootH2_10098432 rootH2_100984322 255
78 3300026067 Ga0207678_10093265 Ga0207678_100932652 259
79 3300047320 Ga0495672_0054004 Ga0495672_0054004_1148_1954 260
80 3300049568 Ga0501031_0158132 Ga0501031_0158132_71_901 261
81 3300049571 Ga0501034_0009001 Ga0501034_0009001_6183_6989 261
82 3300049571 Ga0501034_0550173 Ga0501034_0550173_86_892 261
83 iso_pu_bacteria 2889790730 2889794001 261
84 iso_pu_bacteria 2889914905 2889915748 261
85 3300006048 Ga0075363_100185510 Ga0075363_1001855102 263
86 3300006353 Ga0075370_10094006 Ga0075370_100940062 263
87 3300050489 nmdc:mga03683_10024_c1 nmdc:mga03683_10024_c1_660_1472 263
88 iso_pu_bacteria 2643221629 2644167505 263
89 iso_pu_bacteria 2643221662 2644347268 263
90 3300053161 Ga0500634_0000044 Ga0500634_0000044_55616_56446 264
91 3300053117 Ga0500593_000050 Ga0500593_000050_32840_33658 265
92 3300053139 Ga0500568_0000001 Ga0500568_0000001_409251_410069 265
93 iso_pu_bacteria 2643221580 2643912261 265
94 iso_pu_bacteria 2643221591 2643963454 265
95 iso_pu_bacteria 2643221674 2644410573 265
96 iso_pu_bacteria 2932401849 2932403307 265
97 3300005327 Ga0070658_10007611 Ga0070658_100076114 266
98 3300005344 Ga0070661_100017842 Ga0070661_1000178422 266
99 3300005344 Ga0070661_100134558 Ga0070661_1001345581 266
100 3300005366 Ga0070659_100014445 Ga0070659_1000144454 266
101 3300005539 Ga0068853_100077745 Ga0068853_1000777453 266
102 3300005539 Ga0068853_100121171 Ga0068853_1001211712 266
103 3300005563 Ga0068855_100139577 Ga0068855_1001395772 266
104 3300005578 Ga0068854_100026099 Ga0068854_1000260992 266
105 3300005614 Ga0068856_100050277 Ga0068856_1000502772 266
106 3300005616 Ga0068852_100113105 Ga0068852_1001131052 266
107 3300005616 Ga0068852_100144315 Ga0068852_1001443152 266
108 3300009551 Ga0105238_10292532 Ga0105238_102925321 266
109 3300010375 Ga0105239_10243473 Ga0105239_102434732 266
110 3300013102 Ga0157371_10109099 Ga0157371_101090992 266
111 3300013104 Ga0157370_10073286 Ga0157370_100732863 266
112 3300013105 Ga0157369_10022874 Ga0157369_100228741 266
113 3300013307 Ga0157372_10103713 Ga0157372_101037133 266
114 3300025909 Ga0207705_10023636 Ga0207705_100236361 266
115 3300025913 Ga0207695_10024716 Ga0207695_100247164 266
116 3300025919 Ga0207657_10185814 Ga0207657_101858142 266
117 3300025924 Ga0207694_10108226 Ga0207694_101082262 266
118 3300025932 Ga0207690_10240088 Ga0207690_102400882 266
119 3300025949 Ga0207667_10012235 Ga0207667_100122356 266
120 3300025949 Ga0207667_10228323 Ga0207667_102283232 266
121 3300026041 Ga0207639_10517434 Ga0207639_105174342 266
122 3300026067 Ga0207678_10136927 Ga0207678_101369272 266
123 3300026116 Ga0207674_10588416 Ga0207674_105884162 266
124 3300026142 Ga0207698_10036859 Ga0207698_100368592 266
125 3300026142 Ga0207698_10193253 Ga0207698_101932532 266
126 3300037312 Ga0395899_0273444 Ga0395899_0273444_65_886 266
127 3300053139 Ga0500568_0006183 Ga0500568_0006183_2966_3787 266
128 3300003320 rootH2_10078551 rootH2_100785512 267
129 3300005344 Ga0070661_100015009 Ga0070661_1000150094 267
130 3300005366 Ga0070659_100670465 Ga0070659_1006704651 267
131 3300005577 Ga0068857_100357634 Ga0068857_1003576342 267
132 3300005614 Ga0068856_100392393 Ga0068856_1003923932 267
133 3300025920 Ga0207649_10064374 Ga0207649_100643742 267
134 3300026078 Ga0207702_10525240 Ga0207702_105252402 267
135 3300026116 Ga0207674_10163716 Ga0207674_101637162 267
136 3300028379 Ga0268266_10230725 Ga0268266_102307252 267
137 3300028573 Ga0265334_10101135 Ga0265334_101011351 267
138 3300028800 Ga0265338_10017836 Ga0265338_100178362 267
139 3300029957 Ga0265324_10027764 Ga0265324_100277642 267
140 3300031241 Ga0265325_10009678 Ga0265325_100096783 267
141 3300031249 Ga0265339_10001947 Ga0265339_1000194713 267
142 3300031250 Ga0265331_10027749 Ga0265331_100277493 267
143 3300031595 Ga0265313_10000032 Ga0265313_10000032124 267
144 3300031711 Ga0265314_10090789 Ga0265314_100907892 267
145 3300031911 Ga0307412_10182556 Ga0307412_101825562 267
146 3300032004 Ga0307414_10171586 Ga0307414_101715862 267
147 3300041413 Ga0439465_0032050 Ga0439465_0032050_644_1471 267
148 3300044683 Ga0466965_0121026 Ga0466965_0121026_439_1263 267
149 3300049571 Ga0501034_0016680 Ga0501034_0016680_2218_3042 267
150 3300049571 Ga0501034_0076968 Ga0501034_0076968_1140_1967 267
151 3300049581 Ga0501047_0192705 Ga0501047_0192705_862_1689 267
152 iso_pu_bacteria 2939669807 2939670403 267
153 3300003320 rootH2_10001938 rootH2_100019381 268
154 3300005347 Ga0070668_100034948 Ga0070668_1000349483 268
155 3300025972 Ga0207668_10007054 Ga0207668_100070546 268
156 3300048909 Ga0496106_0153068 Ga0496106_0153068_320_1147 268
157 3300049570 Ga0501033_0168299 Ga0501033_0168299_703_1533 268
158 3300053153 Ga0500616_0004932 Ga0500616_0004932_3236_4063 268
159 3300031824 Ga0307413_10048573 Ga0307413_100485731 269
160 3300031911 Ga0307412_10238068 Ga0307412_102380682 269
161 3300032004 Ga0307414_10003935 Ga0307414_100039355 269
162 3300032004 Ga0307414_10010499 Ga0307414_100104992 269
163 3300048928 Ga0496125_0003219 Ga0496125_0003219_3256_4086 269
164 3300005327 Ga0070658_10034452 Ga0070658_100344524 270
165 3300005339 Ga0070660_100006687 Ga0070660_1000066873 270
166 3300005530 Ga0070679_100306243 Ga0070679_1003062432 270
167 3300005563 Ga0068855_100181201 Ga0068855_1001812012 270
168 3300015265 Ga0182005_1006771 Ga0182005_10067712 270
169 3300025919 Ga0207657_10013829 Ga0207657_100138295 270
170 3300026067 Ga0207678_10168940 Ga0207678_101689402 270
171 3300049571 Ga0501034_0071611 Ga0501034_0071611_827_1663 270
172 3300049586 Ga0501070_0291643 Ga0501070_0291643_463_1299 270
173 3300049742 Ga0501080_0089786 Ga0501080_0089786_1852_2688 270
174 3300003214 JGI25165J46597_1001577 JGI25165J46597_10015779 271
175 3300005539 Ga0068853_100022674 Ga0068853_1000226742 271
176 3300009098 Ga0105245_10394960 Ga0105245_103949602 271
177 3300009545 Ga0105237_10361316 Ga0105237_103613162 271
178 3300013105 Ga0157369_10145901 Ga0157369_101459012 271
179 3300025261 Ga0209233_1000408 Ga0209233_100040831 271
180 3300025261 Ga0209233_1039697 Ga0209233_10396971 271
181 3300026041 Ga0207639_10002259 Ga0207639_1000225912 271
182 3300031730 Ga0307516_10101814 Ga0307516_101018142 271
183 3300037312 Ga0395899_0017812 Ga0395899_0017812_2281_3117 271
184 3300037418 Ga0395900_0115812 Ga0395900_0115812_1601_2437 271
185 3300038443 Ga0395901_0072930 Ga0395901_0072930_131_967 271
186 3300038443 Ga0395901_0401130 Ga0395901_0401130_505_1341 271
187 3300049570 Ga0501033_0043623 Ga0501033_0043623_590_1426 271
188 3300049571 Ga0501034_0086424 Ga0501034_0086424_2267_3103 271
189 3300049571 Ga0501034_0134867 Ga0501034_0134867_1583_2422 271
190 3300049580 Ga0501046_0054017 Ga0501046_0054017_718_1554 271
191 3300049581 Ga0501047_0142635 Ga0501047_0142635_802_1638 271
192 3300049586 Ga0501070_0009673 Ga0501070_0009673_1721_2557 271
193 3300049586 Ga0501070_0015398 Ga0501070_0015398_5279_6115 271
194 3300049742 Ga0501080_0238226 Ga0501080_0238226_639_1475 271
195 3300049822 Ga0501035_0029639 Ga0501035_0029639_1712_2548 271
196 3300049822 Ga0501035_0050469 Ga0501035_0050469_2534_3370 271
197 3300049823 Ga0501044_0023213 Ga0501044_0023213_5580_6416 271
198 3300049823 Ga0501044_0484754 Ga0501044_0484754_284_1120 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02237

BPL_C

Biotin protein ligase C terminal domain

230

277

0.94

PF16917

BPL_LplA_LipB_2

Biotin/lipoate A/B protein ligase family

66

226

0.85

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

30

168

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hj4-assembly1.cif.gz_A cryoem structure of an anti-crispr protein acriic5 bound to nme1cas9-sgrna complex 0.8482 218 248
6kc8-assembly1.cif.gz_A crystal structure of wt nme1cas9 in complex with sgrna and target dna (atatgatt pam) in post-cleavage state 0.827 218 248
6je9-assembly1.cif.gz_C crystal structure of nme1cas9-sgrna dimer mediated by double protein inhibitor acriic3 monomers 0.8072 218 263
8hnw-assembly1.cif.gz_A crystal structure of hpacas9-sgrna surveillance complex bound to double-stranded dna 0.7861 218 250
4r6u-assembly1.cif.gz_C il-18 receptor complex 0.7779 139 162
ID Description Score Start End Superfamily
2ejfB02 Mainly Beta;Roll;SH3 type barrels.; 0.9629 218 261 2.30.30.100
2ejfB02 Mainly Beta;Roll;SH3 type barrels.; 0.9187 218 261 2.30.30.100
4xu1B02 Mainly Beta;Roll;SH3 type barrels.; 0.8879 218 261 2.30.30.100
2e65B02 Mainly Beta;Roll;SH3 type barrels.; 0.8839 218 263 2.30.30.100
4op0A02 Mainly Beta;Roll;SH3 type barrels.; 0.8809 218 263 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A530B162-F1-model_v4 deleted 0.9747 2 98
AF-A0A530B162-F1-model_v4 deleted 0.9554 2 98
AF-A0A2W5FHU7-F1-model_v4 Biotin--[acetyl-CoA-carboxylase] ligase 0.9406 15 157 GO:0004077
GO:0005737
GO:0036211
AF-A0A833G3P2-F1-model_v4 Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15) 0.9285 2 182 GO:0004077
GO:0005737
GO:0036211
AF-A0A519JUY6-F1-model_v4 Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15) 0.9265 16 147 GO:0004077
GO:0005737
GO:0036211

Feature Viewer

pLDDT pTM Quality
81.05 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map