F303824

General Info

Members Datasets Scaffolds Average Seq Length
198 155 170 403

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10052817|rootH2_100528172
Length 430
Sequence MEYHFHFPQFKPAISPDVQKNLRRVVVTGLGIVSCIGVGQAAVLDSLINGTSGITFAPEYAEMNFRSQIHGKPNIDLDAAVDRRVRRFMGDGSAYNYVAMQEAIADAGLEKIQVSNERTGIIMGTGGASTSNMVAASDAMRTSGSPKKIGPFMVPRTMASSNSATLATPFEIKGVNYTISSACATSAHCVGNAAELIQMGKQDIVFAGGGEEVHWSMSMLFDAMGALSSKYNETPMTASRPYDETRDGFVIAGGAGVLVLEELEHAKARGAKIYGELTGYGATSDGYDMVAPSGEGAARCMKMAMATVPSAISYINTHGTSTPVGDTAELGAMKGVFESINQPVPNYSSTKSLTGHSLGATGVQEAIYSLLMMKHNFIAASANVTELDPAAEGTAIVRQRMDNVNHTTILSNSFGFGGTNSTLAFTKYEG

Samples

Sample ID Description Type Environment
1 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
2 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
3 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
4 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
5 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
6 2643221629 Devosia sp. Root105 Isolate Unclassified
7 2643221662 Devosia sp. Root413D1 Isolate Unclassified
8 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
9 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
10 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
11 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
12 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
13 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
14 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
15 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
16 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
17 2842694124 Methylopila sp. R-72369 Isolate Unclassified
18 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
19 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
20 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
21 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
22 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
23 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
24 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
95 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
107 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
108 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
146 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
153 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
154 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
155 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.32
Metatranscriptomes 3.54
Isolates 14.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 2.02
Rhizoplane 4.04
Rhizosphere 82.83
Stem 0
Stem Tuber 0
Unclassified 8.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10052817 3300003320 Bacteria 9722
2 Ga0065704_10124812 3300005289 Bacteria 1712
3 Ga0070658_10177560 3300005327 Bacteria 1791
4 Ga0070680_100005087 3300005336 Bacteria 9922
5 Ga0070682_100005140 3300005337 Bacteria 7279
6 Ga0070660_100013047 3300005339 Bacteria 5948
7 Ga0070691_10006515 3300005341 Bacteria 5339
8 Ga0070691_10007081 3300005341 Bacteria 5142
9 Ga0070659_100033717 3300005366 Bacteria 3979
10 Ga0070663_100001178 3300005455 Bacteria 14395
11 Ga0070678_100045573 3300005456 Bacteria 3138
12 Ga0070681_10007601 3300005458 Bacteria 10594
13 Ga0070681_10072889 3300005458 Bacteria 3396
14 Ga0070679_100041204 3300005530 Bacteria 4596
15 Ga0070679_100203649 3300005530 Bacteria 1944
16 Ga0068853_100010092 3300005539 Bacteria 7631
17 Ga0068853_100036211 3300005539 Bacteria 4195
18 Ga0070695_100003009 3300005545 Bacteria 9821
19 Ga0070696_100004629 3300005546 Bacteria 9187
20 Ga0070693_100003615 3300005547 Bacteria 7221
21 Ga0070665_100291628 3300005548 Bacteria 1634
22 Ga0068855_100022893 3300005563 Bacteria 7487
23 Ga0068855_100048648 3300005563 Bacteria 5004
24 Ga0070664_100021796 3300005564 Bacteria 5283
25 Ga0068857_100039917 3300005577 Bacteria 4160
26 Ga0070702_100002725 3300005615 Bacteria 7718
27 Ga0068859_100296468 3300005617 Bacteria 1710
28 Ga0068858_100012529 3300005842 Bacteria 7998
29 Ga0068860_100169867 3300005843 Bacteria 2106
30 Ga0075363_100008442 3300006048 Bacteria 4795
31 Ga0075367_10112659 3300006178 Bacteria 1671
32 Ga0075370_10033107 3300006353 Bacteria 2892
33 Ga0068865_100032664 3300006881 Bacteria 3479
34 Ga0097620_100296484 3300006931 Bacteria 1710
35 Ga0105240_10537795 3300009093 Bacteria 1294
36 Ga0111539_10091103 3300009094 Bacteria 3583
37 Ga0105241_10016713 3300009174 Bacteria 5384
38 Ga0105237_10000569 3300009545 Bacteria 51575
39 Ga0105237_10055864 3300009545 Bacteria 3954
40 Ga0105238_10035715 3300009551 Bacteria 5052
41 Ga0105246_10013763 3300011119 Bacteria 5076
42 Ga0157370_10015573 3300013104 Bacteria 7730
43 Ga0157369_10118330 3300013105 Bacteria 2812
44 Ga0157372_10006382 3300013307 Bacteria 12546
45 Ga0157372_10060167 3300013307 Bacteria 4250
46 Ga0157372_10303597 3300013307 Bacteria 1857
47 Ga0157379_10039015 3300014968 Bacteria 4237
48 Ga0157376_10155508 3300014969 Bacteria 2067
49 Ga0207647_10027604 3300025904 Bacteria 3699
50 Ga0207705_10000039 3300025909 Bacteria 193592
51 Ga0207707_10001894 3300025912 Bacteria 19063
52 Ga0207707_10078383 3300025912 Bacteria 2885
53 Ga0207695_10175480 3300025913 Bacteria 2066
54 Ga0207671_10000437 3300025914 Bacteria 57390
55 Ga0207671_10020009 3300025914 Bacteria 5105
56 Ga0207660_10003148 3300025917 Bacteria 10803
57 Ga0207660_10040403 3300025917 Bacteria 3266
58 Ga0207657_10000182 3300025919 Bacteria 65095
59 Ga0207652_10009127 3300025921 Bacteria 7987
60 Ga0207652_10044275 3300025921 Bacteria 3791
61 Ga0207652_10190323 3300025921 Bacteria 1845
62 Ga0207694_10128775 3300025924 Bacteria 2027
63 Ga0207679_10045794 3300025945 Bacteria 3166
64 Ga0207667_10087066 3300025949 Bacteria 3231
65 Ga0207639_10016727 3300026041 Bacteria 5195
66 Ga0207678_10001867 3300026067 Bacteria 19220
67 Ga0207674_10010629 3300026116 Bacteria 10408
68 Ga0207683_10055370 3300026121 Bacteria 3478
69 Ga0207428_10103546 3300027907 Bacteria 2197
70 Ga0268266_10000280 3300028379 Bacteria 84153
71 Ga0265337_1007906 3300028556 Bacteria 3931
72 Ga0265338_10006872 3300028800 Bacteria 14326
73 Ga0265328_10003603 3300031239 Bacteria 6831
74 Ga0265328_10004314 3300031239 Bacteria 6181
75 Ga0265340_10000606 3300031247 Bacteria 20012
76 Ga0265331_10000237 3300031250 Bacteria 66600
77 Ga0265327_10000517 3300031251 Bacteria 66613
78 Ga0265313_10048336 3300031595 Bacteria 2053
79 Ga0316575_10013053 3300031665 Bacteria 3099
80 Ga0316579_10015726 3300031691 Bacteria 3291
81 Ga0316579_10023795 3300031691 Bacteria 2753
82 Ga0265314_10028178 3300031711 Bacteria 4192
83 Ga0316578_10013807 3300031728 Bacteria 4294
84 Ga0316578_10053380 3300031728 Bacteria 2368
85 Ga0316577_10017237 3300031733 Bacteria 3986
86 Ga0316577_10061425 3300031733 Bacteria 2097
87 Ga0316583_10002226 3300032133 Bacteria 6692
88 Ga0316593_10003907 3300032168 Bacteria 3757
89 Ga0316593_10022247 3300032168 Bacteria 1990
90 Ga0316593_10050550 3300032168 Bacteria 1403
91 Ga0316592_1000596 3300033524 Bacteria 5205
92 Ga0316596_1028666 3300033541 Bacteria 1440
93 Ga0373931_0008983 3300035691 Bacteria 4765
94 Ga0373933_0158211 3300035724 Bacteria 1438
95 Ga0373937_0108289 3300036401 Bacteria 2584
96 Ga0316582_0018675 3300036647 Bacteria 4041
97 Ga0316582_0042059 3300036647 Bacteria 2860
98 Ga0316582_0071387 3300036647 Bacteria 2249
99 Ga0316584_0045339 3300036712 Bacteria 3282
100 Ga0316584_0046691 3300036712 Bacteria 3235
101 Ga0395900_0198504 3300037418 Bacteria 2031
102 Ga0316581_0004809 3300037588 Bacteria 3475
103 Ga0436363_1636656 3300039450 Bacteria 6632
104 Ga0439437_000459 3300042000 Bacteria 4004
105 Ga0450911_000013 3300042115 Bacteria 129019
106 Ga0450904_000018 3300042139 Bacteria 40183
107 Ga0439459_0000847 3300042438 Bacteria 4273
108 Ga0450916_000014 3300042530 Bacteria 8751
109 Ga0451577_0159542 3300042876 Bacteria 2031
110 Ga0451576_0051231 3300045051 Bacteria 4328
111 Ga0495580_0087583 3300046472 Bacteria 2169
112 Ga0495582_0015363 3300046473 Bacteria 4206
113 Ga0495606_0000027 3300046507 Bacteria 253573
114 Ga0495643_0000271 3300046522 Bacteria 75201
115 Ga0495640_0107708 3300046533 Bacteria 1824
116 Ga0495586_0018051 3300046535 Bacteria 3752
117 Ga0495671_0001686 3300046692 Bacteria 14441
118 Ga0495649_0003541 3300046694 Bacteria 10493
119 Ga0496100_0022319 3300048903 Bacteria 3830
120 Ga0496101_0020818 3300048904 Bacteria 4499
121 Ga0496104_0034082 3300048907 Bacteria 4745
122 Ga0496106_0007060 3300048909 Bacteria 8296
123 Ga0496110_0130216 3300048913 Bacteria 2271
124 Ga0496114_0145195 3300048917 Bacteria 2056
125 Ga0496115_0014041 3300048918 Bacteria 6063
126 Ga0496121_0045795 3300048924 Bacteria 3754
127 Ga0501032_0000341 3300049569 Bacteria 39021
128 Ga0501032_0021161 3300049569 Bacteria 4524
129 Ga0501034_0000135 3300049571 Bacteria 137151
130 Ga0501034_0048765 3300049571 Bacteria 4274
131 Ga0501034_0216624 3300049571 Bacteria 1868
132 Ga0501034_0275329 3300049571 Bacteria 1623
133 Ga0501036_0027140 3300049572 Bacteria 4838
134 Ga0501037_0001178 3300049573 Bacteria 19304
135 Ga0501038_0009982 3300049574 Bacteria 8694
136 Ga0501038_0016935 3300049574 Bacteria 6596
137 Ga0501039_0000180 3300049575 Bacteria 45008
138 Ga0501039_0047597 3300049575 Bacteria 3315
139 Ga0501039_0255774 3300049575 Bacteria 1377
140 Ga0501039_0348276 3300049575 Bacteria 1164
141 Ga0501046_0000567 3300049580 Bacteria 36589
142 Ga0501046_0019028 3300049580 Bacteria 5700
143 Ga0501047_0000435 3300049581 Bacteria 46511
144 Ga0501047_0005507 3300049581 Bacteria 11914
145 Ga0501047_0083323 3300049581 Bacteria 3073
146 Ga0501048_0000636 3300049582 Bacteria 25113
147 Ga0501067_0000586 3300049583 Bacteria 19606
148 Ga0501069_0030658 3300049585 Bacteria 2954
149 Ga0501070_0000017 3300049586 Bacteria 173127
150 Ga0501070_0007834 3300049586 Bacteria 9054
151 Ga0501073_0043898 3300049589 Bacteria 3152
152 Ga0501080_0000014 3300049742 Bacteria 99739
153 Ga0501080_0006334 3300049742 Bacteria 10621
154 Ga0501080_0108817 3300049742 Bacteria 2569
155 Ga0501080_0344205 3300049742 Bacteria 1347
156 Ga0501035_0000056 3300049822 Bacteria 137385
157 Ga0501035_0001049 3300049822 Bacteria 28932
158 Ga0501044_0000536 3300049823 Bacteria 46054
159 Ga0501044_0001245 3300049823 Bacteria 30224
160 Ga0501044_0036855 3300049823 Bacteria 5115
161 Ga0501044_0055029 3300049823 Bacteria 4087
162 Ga0501044_0065417 3300049823 Bacteria 3708
163 Ga0501226_000015 3300049853 Bacteria 164151
164 Ga0500618_009806 3300053125 Bacteria 2600
165 Ga0500616_0003749 3300053153 Bacteria 11329
166 Ga0500636_0000359 3300053177 Bacteria 24993
167 Ga0587082_002149 3300059504 Bacteria 2178
168 Ga0587075_001827 3300059644 Bacteria 2151
169 Ga0501082_0007923 3300060353 Bacteria 9176
170 Ga0501082_0173445 3300060353 Bacteria 1875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0130216 Ga0496110_0130216_10_1005 327
2 3300060353 Ga0501082_0173445 Ga0501082_0173445_16_1014 328
3 3300049575 Ga0501039_0348276 Ga0501039_0348276_11_1069 348
4 3300031691 Ga0316579_10015726 Ga0316579_100157263 387
5 3300049571 Ga0501034_0216624 Ga0501034_0216624_399_1598 387
6 3300049581 Ga0501047_0005507 Ga0501047_0005507_4128_5327 387
7 3300049575 Ga0501039_0047597 Ga0501039_0047597_1048_2271 393
8 3300036712 Ga0316584_0046691 Ga0316584_0046691_1811_3028 395
9 3300042000 Ga0439437_000459 Ga0439437_000459_1312_2526 395
10 3300042115 Ga0450911_000013 Ga0450911_000013_58351_59565 395
11 3300042438 Ga0439459_0000847 Ga0439459_0000847_94_1308 395
12 3300042530 Ga0450916_000014 Ga0450916_000014_1645_2859 395
13 3300049853 Ga0501226_000015 Ga0501226_000015_117389_118603 395
14 3300046507 Ga0495606_0000027 Ga0495606_0000027_241269_242489 396
15 3300046522 Ga0495643_0000271 Ga0495643_0000271_43212_44432 396
16 3300046692 Ga0495671_0001686 Ga0495671_0001686_8293_9513 396
17 3300046694 Ga0495649_0003541 Ga0495649_0003541_9107_10327 396
18 3300049571 Ga0501034_0275329 Ga0501034_0275329_25_1242 396
19 3300049823 Ga0501044_0065417 Ga0501044_0065417_1219_2424 396
20 3300031691 Ga0316579_10023795 Ga0316579_100237951 397
21 3300031733 Ga0316577_10017237 Ga0316577_100172373 397
22 3300032133 Ga0316583_10002226 Ga0316583_100022261 397
23 3300036647 Ga0316582_0018675 Ga0316582_0018675_669_1886 397
24 3300005530 Ga0070679_100203649 Ga0070679_1002036492 398
25 3300009174 Ga0105241_10016713 Ga0105241_100167133 398
26 3300009545 Ga0105237_10055864 Ga0105237_100558644 398
27 3300009551 Ga0105238_10035715 Ga0105238_100357152 398
28 3300011119 Ga0105246_10013763 Ga0105246_100137634 398
29 3300013105 Ga0157369_10118330 Ga0157369_101183303 398
30 3300013307 Ga0157372_10303597 Ga0157372_103035971 398
31 3300014968 Ga0157379_10039015 Ga0157379_100390153 398
32 3300014969 Ga0157376_10155508 Ga0157376_101555081 398
33 3300025921 Ga0207652_10190323 Ga0207652_101903232 398
34 3300028556 Ga0265337_1007906 Ga0265337_10079062 398
35 3300028800 Ga0265338_10006872 Ga0265338_100068722 398
36 3300031247 Ga0265340_10000606 Ga0265340_100006065 398
37 3300031595 Ga0265313_10048336 Ga0265313_100483362 398
38 3300035691 Ga0373931_0008983 Ga0373931_0008983_2349_3575 398
39 3300037418 Ga0395900_0198504 Ga0395900_0198504_81_1289 398
40 3300046473 Ga0495582_0015363 Ga0495582_0015363_914_2140 398
41 3300046533 Ga0495640_0107708 Ga0495640_0107708_522_1748 398
42 3300046535 Ga0495586_0018051 Ga0495586_0018051_923_2149 398
43 3300048903 Ga0496100_0022319 Ga0496100_0022319_1060_2268 398
44 3300048904 Ga0496101_0020818 Ga0496101_0020818_1095_2303 398
45 3300048907 Ga0496104_0034082 Ga0496104_0034082_816_2024 398
46 3300048909 Ga0496106_0007060 Ga0496106_0007060_3787_4995 398
47 3300048917 Ga0496114_0145195 Ga0496114_0145195_360_1568 398
48 3300048918 Ga0496115_0014041 Ga0496115_0014041_1223_2431 398
49 3300049569 Ga0501032_0000341 Ga0501032_0000341_1760_2968 398
50 3300049569 Ga0501032_0021161 Ga0501032_0021161_2826_4046 398
51 3300049571 Ga0501034_0000135 Ga0501034_0000135_39423_40631 398
52 3300049572 Ga0501036_0027140 Ga0501036_0027140_1851_3059 398
53 3300049573 Ga0501037_0001178 Ga0501037_0001178_3922_5130 398
54 3300049574 Ga0501038_0009982 Ga0501038_0009982_2362_3570 398
55 3300049574 Ga0501038_0016935 Ga0501038_0016935_943_2163 398
56 3300049575 Ga0501039_0000180 Ga0501039_0000180_15861_17069 398
57 3300049580 Ga0501046_0000567 Ga0501046_0000567_29165_30373 398
58 3300049580 Ga0501046_0019028 Ga0501046_0019028_1442_2650 398
59 3300049581 Ga0501047_0000435 Ga0501047_0000435_36830_38038 398
60 3300049581 Ga0501047_0083323 Ga0501047_0083323_68_1276 398
61 3300049582 Ga0501048_0000636 Ga0501048_0000636_20213_21421 398
62 3300049583 Ga0501067_0000586 Ga0501067_0000586_3773_4981 398
63 3300049585 Ga0501069_0030658 Ga0501069_0030658_152_1372 398
64 3300049586 Ga0501070_0000017 Ga0501070_0000017_97320_98540 398
65 3300049586 Ga0501070_0007834 Ga0501070_0007834_5409_6617 398
66 3300049742 Ga0501080_0000014 Ga0501080_0000014_96670_97878 398
67 3300049742 Ga0501080_0006334 Ga0501080_0006334_2982_4202 398
68 3300049822 Ga0501035_0000056 Ga0501035_0000056_39260_40468 398
69 3300049822 Ga0501035_0001049 Ga0501035_0001049_24858_26078 398
70 3300049823 Ga0501044_0000536 Ga0501044_0000536_5873_7081 398
71 3300049823 Ga0501044_0001245 Ga0501044_0001245_3317_4537 398
72 3300049823 Ga0501044_0036855 Ga0501044_0036855_3112_4317 398
73 3300049823 Ga0501044_0055029 Ga0501044_0055029_1369_2589 398
74 3300053153 Ga0500616_0003749 Ga0500616_0003749_3861_5069 398
75 3300060353 Ga0501082_0007923 Ga0501082_0007923_3147_4355 398
76 iso_pu_bacteria 2887630918 2887632276 398
77 3300032168 Ga0316593_10022247 Ga0316593_100222472 399
78 3300032168 Ga0316593_10050550 Ga0316593_100505501 399
79 3300046472 Ga0495580_0087583 Ga0495580_0087583_643_1869 399
80 iso_pu_bacteria 2648501241 2649120870 399
81 iso_pu_bacteria 2651869818 2652975393 399
82 iso_pu_bacteria 2842694124 2842694860 399
83 iso_pu_bacteria 2919493220 2919494575 399
84 iso_pu_bacteria 2919543075 2919543576 399
85 iso_pu_bacteria 2923525760 2923528201 399
86 3300031728 Ga0316578_10053380 Ga0316578_100533802 400
87 3300031733 Ga0316577_10061425 Ga0316577_100614253 400
88 3300033541 Ga0316596_1028666 Ga0316596_10286661 400
89 iso_pu_bacteria 2606217733 2608382473 401
90 iso_pu_bacteria 2738543020 2739288922 401
91 iso_pu_bacteria 2738543021 2739294234 401
92 iso_pu_bacteria 2811994881 2812366166 401
93 iso_pu_bacteria 2826581358 2826583035 401
94 iso_pu_bacteria 2842805378 2842806332 401
95 iso_pu_bacteria 2923519811 2923520189 401
96 iso_pu_bacteria 8011350971 8011354622 401
97 3300033524 Ga0316592_1000596 Ga0316592_10005962 402
98 3300042139 Ga0450904_000018 Ga0450904_000018_13672_14880 402
99 iso_pu_bacteria 2524023209 2524462161 402
100 iso_pu_bacteria 2585427531 2585564154 402
101 iso_pu_bacteria 2585427608 2585897287 402
102 iso_pu_bacteria 2643221547 2643758142 402
103 iso_pu_bacteria 2643221629 2644164689 402
104 iso_pu_bacteria 2643221662 2644346039 402
105 iso_pu_bacteria 2818991448 2819613234 402
106 iso_pu_bacteria 2842298080 2842303519 402
107 iso_pu_bacteria 2842357229 2842362790 402
108 iso_pu_bacteria 3005416602 3005419288 402
109 iso_pu_bacteria 8005314921 8005317556 402
110 iso_pu_bacteria 8005484373 8005489275 402
111 iso_pu_bacteria 8005645114 8005645407 402
112 3300005289 Ga0065704_10124812 Ga0065704_101248121 403
113 3300031239 Ga0265328_10003603 Ga0265328_100036038 403
114 3300031239 Ga0265328_10004314 Ga0265328_100043141 403
115 3300031250 Ga0265331_10000237 Ga0265331_1000023730 403
116 3300031251 Ga0265327_10000517 Ga0265327_1000051742 403
117 3300042876 Ga0451577_0159542 Ga0451577_0159542_330_1571 403
118 3300025913 Ga0207695_10175480 Ga0207695_101754801 404
119 3300031711 Ga0265314_10028178 Ga0265314_100281782 405
120 3300032168 Ga0316593_10003907 Ga0316593_100039074 405
121 3300036647 Ga0316582_0042059 Ga0316582_0042059_287_1504 405
122 3300037588 Ga0316581_0004809 Ga0316581_0004809_2205_3422 405
123 3300048924 Ga0496121_0045795 Ga0496121_0045795_135_1352 405
124 3300049575 Ga0501039_0255774 Ga0501039_0255774_91_1323 405
125 3300049742 Ga0501080_0108817 Ga0501080_0108817_762_1994 405
126 3300005327 Ga0070658_10177560 Ga0070658_101775601 406
127 3300005336 Ga0070680_100005087 Ga0070680_1000050873 406
128 3300005337 Ga0070682_100005140 Ga0070682_1000051402 406
129 3300005339 Ga0070660_100013047 Ga0070660_1000130475 406
130 3300005341 Ga0070691_10006515 Ga0070691_100065153 406
131 3300005341 Ga0070691_10007081 Ga0070691_100070815 406
132 3300005366 Ga0070659_100033717 Ga0070659_1000337172 406
133 3300005455 Ga0070663_100001178 Ga0070663_10000117810 406
134 3300005456 Ga0070678_100045573 Ga0070678_1000455733 406
135 3300005458 Ga0070681_10007601 Ga0070681_100076015 406
136 3300005458 Ga0070681_10072889 Ga0070681_100728892 406
137 3300005530 Ga0070679_100041204 Ga0070679_1000412045 406
138 3300005539 Ga0068853_100010092 Ga0068853_1000100926 406
139 3300005539 Ga0068853_100036211 Ga0068853_1000362114 406
140 3300005546 Ga0070696_100004629 Ga0070696_1000046299 406
141 3300005547 Ga0070693_100003615 Ga0070693_1000036155 406
142 3300005548 Ga0070665_100291628 Ga0070665_1002916281 406
143 3300005563 Ga0068855_100022893 Ga0068855_1000228937 406
144 3300005563 Ga0068855_100048648 Ga0068855_1000486486 406
145 3300005564 Ga0070664_100021796 Ga0070664_1000217962 406
146 3300005577 Ga0068857_100039917 Ga0068857_1000399172 406
147 3300005615 Ga0070702_100002725 Ga0070702_1000027254 406
148 3300005617 Ga0068859_100296468 Ga0068859_1002964681 406
149 3300005842 Ga0068858_100012529 Ga0068858_1000125297 406
150 3300005843 Ga0068860_100169867 Ga0068860_1001698672 406
151 3300006048 Ga0075363_100008442 Ga0075363_1000084422 406
152 3300006178 Ga0075367_10112659 Ga0075367_101126592 406
153 3300006353 Ga0075370_10033107 Ga0075370_100331074 406
154 3300006881 Ga0068865_100032664 Ga0068865_1000326642 406
155 3300006931 Ga0097620_100296484 Ga0097620_1002964841 406
156 3300009094 Ga0111539_10091103 Ga0111539_100911032 406
157 3300013104 Ga0157370_10015573 Ga0157370_100155735 406
158 3300013307 Ga0157372_10006382 Ga0157372_1000638211 406
159 3300013307 Ga0157372_10060167 Ga0157372_100601675 406
160 3300025904 Ga0207647_10027604 Ga0207647_100276043 406
161 3300025909 Ga0207705_10000039 Ga0207705_10000039176 406
162 3300025912 Ga0207707_10001894 Ga0207707_1000189418 406
163 3300025912 Ga0207707_10078383 Ga0207707_100783832 406
164 3300025914 Ga0207671_10020009 Ga0207671_100200092 406
165 3300025917 Ga0207660_10003148 Ga0207660_1000314811 406
166 3300025917 Ga0207660_10040403 Ga0207660_100404034 406
167 3300025919 Ga0207657_10000182 Ga0207657_1000018240 406
168 3300025921 Ga0207652_10009127 Ga0207652_100091277 406
169 3300025921 Ga0207652_10044275 Ga0207652_100442753 406
170 3300025924 Ga0207694_10128775 Ga0207694_101287752 406
171 3300025945 Ga0207679_10045794 Ga0207679_100457942 406
172 3300025949 Ga0207667_10087066 Ga0207667_100870662 406
173 3300026041 Ga0207639_10016727 Ga0207639_100167272 406
174 3300026067 Ga0207678_10001867 Ga0207678_100018677 406
175 3300026116 Ga0207674_10010629 Ga0207674_100106294 406
176 3300026121 Ga0207683_10055370 Ga0207683_100553703 406
177 3300027907 Ga0207428_10103546 Ga0207428_101035462 406
178 3300035724 Ga0373933_0158211 Ga0373933_0158211_157_1383 406
179 3300036401 Ga0373937_0108289 Ga0373937_0108289_568_1794 406
180 3300039450 Ga0436363_1636656 Ga0436363_1636656_5207_6427 406
181 3300045051 Ga0451576_0051231 Ga0451576_0051231_560_1780 406
182 3300049589 Ga0501073_0043898 Ga0501073_0043898_562_1785 406
183 3300049742 Ga0501080_0344205 Ga0501080_0344205_16_1242 406
184 3300059504 Ga0587082_002149 Ga0587082_002149_61_1296 406
185 3300059644 Ga0587075_001827 Ga0587075_001827_301_1524 406
186 3300009545 Ga0105237_10000569 Ga0105237_1000056935 407
187 3300025914 Ga0207671_10000437 Ga0207671_1000043717 407
188 3300028379 Ga0268266_10000280 Ga0268266_1000028064 407
189 3300031665 Ga0316575_10013053 Ga0316575_100130533 407
190 3300031728 Ga0316578_10013807 Ga0316578_100138072 407
191 3300036712 Ga0316584_0045339 Ga0316584_0045339_1072_2301 407
192 3300005545 Ga0070695_100003009 Ga0070695_1000030097 409
193 3300009093 Ga0105240_10537795 Ga0105240_105377951 410
194 3300053125 Ga0500618_009806 Ga0500618_009806_1127_2365 411
195 3300053177 Ga0500636_0000359 Ga0500636_0000359_169_1407 411
196 3300049571 Ga0501034_0048765 Ga0501034_0048765_2500_3741 413
197 3300036647 Ga0316582_0071387 Ga0316582_0071387_644_1921 415
198 3300003320 rootH2_10052817 rootH2_100528172 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

274

385

0.92

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

22

266

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pps-assembly1.cif.gz_B apo fabb from pseudomonas aeruginosa with single point mutation c161a 0.9907 22 429
4xox-assembly1.cif.gz_B structure of beta-ketoacyl-acp synthase i (fabb) from vibrio cholerae 0.9885 22 430
7pps-assembly1.cif.gz_B apo fabb from pseudomonas aeruginosa with single point mutation c161a 0.9883 22 429
2byy-assembly1.cif.gz_A e.coli kas i h298e mutation 0.9858 22 429
2bz4-assembly2.cif.gz_C structure of e.coli kas i h298q mutant 0.9855 22 429
ID Description Score Start End Superfamily
1dd8A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9872 27 279 3.40.47.10
1dd8A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9795 27 279 3.40.47.10
4xoxB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9607 281 428 3.40.47.10
4xoxB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9478 281 428 3.40.47.10
2rjtA01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9448 26 273 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A436QLL0-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9972 94 228 GO:0004315
GO:0005829
GO:0006633
AF-A0A530Y959-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9969 32 258 GO:0004315
GO:0005829
GO:0006633
AF-A0A529JT77-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9967 129 263 GO:0004315
GO:0005829
GO:0006633
AF-A0A401TV85-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.9965 87 257 GO:0004315
GO:0005829
GO:0006633
AF-A0A6L8G3B9-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 1 (EC 2.3.1.41) (3-oxoacyl-[acyl-carrier-protein] synthase I) (Beta-ketoacyl-ACP synthase I) 0.994 22 302 GO:0004315
GO:0005829
GO:0006633

Feature Viewer

pLDDT pTM Quality
93.13 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map