F303629
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 197 | 149 | 197 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_362651_c1|nmdc:mga0qj67_362651_c1_175_954 |
| Length | 259 |
| Sequence | MPCVPRPAIVLSSGGLDSTTCIAIARHQRFAPLYSLSFDYGQRHRHELDAAKRIAQEFRVAQHRVVTIDLRQFGKSALTDDAVAVPKDRDESAMSSDIPVTYVPARNTIFLSYALAWAEVLDVRDVFIGVNAVDYSGYPDCRPQFIAAFEAMANLATKMTVEAKDEGGRMKDEGKAAGSTSSFIPHPSSPPFKIHTPLMHMTKAQIIRRGAELGVDYSLTHSCYDPDPAGRACGRCDSCVLRRKGFAEAGVTDPTRYVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 91 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 92 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 93 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 94 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 95 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 96 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 97 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 102 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 103 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 104 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 106 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 107 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 109 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 115 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 116 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.06 |
| Rhizosphere | 93.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10017911 | 3300001990 | Bacteria | 2278 |
| 2 | JGI24735J21928_10009420 | 3300002067 | Bacteria | 3136 |
| 3 | Ga0065704_10001772 | 3300005289 | Bacteria | 10728 |
| 4 | Ga0070658_10012545 | 3300005327 | Bacteria | 6798 |
| 5 | Ga0070670_100072215 | 3300005331 | Bacteria | 2963 |
| 6 | Ga0070666_10017869 | 3300005335 | Bacteria | 4549 |
| 7 | Ga0070666_10047238 | 3300005335 | Bacteria | 2890 |
| 8 | Ga0070680_100115849 | 3300005336 | Bacteria | 2233 |
| 9 | Ga0068868_100076743 | 3300005338 | Bacteria | 2672 |
| 10 | Ga0068868_100140207 | 3300005338 | Bacteria | 1984 |
| 11 | Ga0070660_100024872 | 3300005339 | Bacteria | 4447 |
| 12 | Ga0070660_100042670 | 3300005339 | Bacteria | 3463 |
| 13 | Ga0070660_100050276 | 3300005339 | Bacteria | 3207 |
| 14 | Ga0070661_100035759 | 3300005344 | Bacteria | 3609 |
| 15 | Ga0070661_100059404 | 3300005344 | Bacteria | 2804 |
| 16 | Ga0070661_100212756 | 3300005344 | Bacteria | 1480 |
| 17 | Ga0070668_100027965 | 3300005347 | Bacteria | 4279 |
| 18 | Ga0070669_100032320 | 3300005353 | Bacteria | 3779 |
| 19 | Ga0070669_100386087 | 3300005353 | Bacteria | 1143 |
| 20 | Ga0070675_100484435 | 3300005354 | Bacteria | 1113 |
| 21 | Ga0070671_100326168 | 3300005355 | Bacteria | 1308 |
| 22 | Ga0070673_100015941 | 3300005364 | Bacteria | 5295 |
| 23 | Ga0070667_100105816 | 3300005367 | Bacteria | 2435 |
| 24 | Ga0070714_100284662 | 3300005435 | Bacteria | 1537 |
| 25 | Ga0070663_100012118 | 3300005455 | Bacteria | 5442 |
| 26 | Ga0070678_100058320 | 3300005456 | Bacteria | 2833 |
| 27 | Ga0070662_100001725 | 3300005457 | Bacteria | 13451 |
| 28 | Ga0070662_100172712 | 3300005457 | Bacteria | 1698 |
| 29 | Ga0070681_10234369 | 3300005458 | Bacteria | 1750 |
| 30 | Ga0070681_10508519 | 3300005458 | Bacteria | 1118 |
| 31 | Ga0070685_10019371 | 3300005466 | Bacteria | 3670 |
| 32 | Ga0070706_100159596 | 3300005467 | Bacteria | 2105 |
| 33 | Ga0070698_100004460 | 3300005471 | Bacteria | 15386 |
| 34 | Ga0068853_100232592 | 3300005539 | Bacteria | 1686 |
| 35 | Ga0068853_100267985 | 3300005539 | Bacteria | 1572 |
| 36 | Ga0070665_100034313 | 3300005548 | Bacteria | 5103 |
| 37 | Ga0070665_101034998 | 3300005548 | Bacteria | 833 |
| 38 | Ga0070664_100066634 | 3300005564 | Bacteria | 3075 |
| 39 | Ga0070664_100126740 | 3300005564 | Bacteria | 2240 |
| 40 | Ga0070664_100405898 | 3300005564 | Bacteria | 1246 |
| 41 | Ga0068857_100193988 | 3300005577 | Bacteria | 1850 |
| 42 | Ga0068857_100305886 | 3300005577 | Bacteria | 1466 |
| 43 | Ga0068854_100006464 | 3300005578 | Bacteria | 7456 |
| 44 | Ga0068854_100270391 | 3300005578 | Bacteria | 1364 |
| 45 | Ga0068859_100201683 | 3300005617 | Bacteria | 2074 |
| 46 | Ga0068864_100239766 | 3300005618 | Bacteria | 1680 |
| 47 | Ga0068851_10067262 | 3300005834 | Bacteria | 1848 |
| 48 | Ga0068870_10220713 | 3300005840 | Bacteria | 1160 |
| 49 | Ga0068858_100001888 | 3300005842 | Bacteria | 21404 |
| 50 | Ga0068858_100382807 | 3300005842 | Bacteria | 1350 |
| 51 | Ga0068858_100770826 | 3300005842 | Bacteria | 938 |
| 52 | Ga0068860_100066357 | 3300005843 | Bacteria | 3428 |
| 53 | Ga0070717_10153722 | 3300006028 | Bacteria | 1992 |
| 54 | Ga0097621_100907066 | 3300006237 | Bacteria | 821 |
| 55 | Ga0075428_100554268 | 3300006844 | Bacteria | 1229 |
| 56 | Ga0075434_100551597 | 3300006871 | Bacteria | 1172 |
| 57 | Ga0097620_100201682 | 3300006931 | Bacteria | 2074 |
| 58 | Ga0075435_100559202 | 3300007076 | Bacteria | 991 |
| 59 | Ga0105240_10036108 | 3300009093 | Bacteria | 6362 |
| 60 | Ga0105245_11236623 | 3300009098 | Bacteria | 795 |
| 61 | Ga0105247_10010076 | 3300009101 | Bacteria | 5726 |
| 62 | Ga0114129_10004551 | 3300009147 | Bacteria | 19567 |
| 63 | Ga0114129_10222104 | 3300009147 | Bacteria | 2548 |
| 64 | Ga0105242_10224132 | 3300009176 | Unclassified | 1682 |
| 65 | Ga0105248_10032233 | 3300009177 | Bacteria | 5858 |
| 66 | Ga0105248_10962807 | 3300009177 | Bacteria | 964 |
| 67 | Ga0105238_10120580 | 3300009551 | Bacteria | 2602 |
| 68 | Ga0105249_10428194 | 3300009553 | Bacteria | 1358 |
| 69 | Ga0105246_10217158 | 3300011119 | Bacteria | 1496 |
| 70 | Ga0157369_10021841 | 3300013105 | Bacteria | 7155 |
| 71 | Ga0157374_10031577 | 3300013296 | Bacteria | 4815 |
| 72 | Ga0157374_10552134 | 3300013296 | Bacteria | 1160 |
| 73 | Ga0163162_10147748 | 3300013306 | Bacteria | 2467 |
| 74 | Ga0157375_10607653 | 3300013308 | Bacteria | 1252 |
| 75 | Ga0163163_10351390 | 3300014325 | Bacteria | 1530 |
| 76 | Ga0163163_10578660 | 3300014325 | Bacteria | 1186 |
| 77 | Ga0157379_10067559 | 3300014968 | Bacteria | 3195 |
| 78 | Ga0157376_10166542 | 3300014969 | Bacteria | 2003 |
| 79 | Ga0163161_10097921 | 3300017792 | Bacteria | 2179 |
| 80 | Ga0213876_10191432 | 3300021384 | Bacteria | 1088 |
| 81 | Ga0207656_10089734 | 3300025321 | Bacteria | 1394 |
| 82 | Ga0207680_10028084 | 3300025903 | Bacteria | 3143 |
| 83 | Ga0207680_10036145 | 3300025903 | Bacteria | 2843 |
| 84 | Ga0207705_10017971 | 3300025909 | Bacteria | 5057 |
| 85 | Ga0207684_10154942 | 3300025910 | Bacteria | 1972 |
| 86 | Ga0207707_10303004 | 3300025912 | Bacteria | 1382 |
| 87 | Ga0207695_10061927 | 3300025913 | Bacteria | 3865 |
| 88 | Ga0207660_10504893 | 3300025917 | Bacteria | 981 |
| 89 | Ga0207657_10004967 | 3300025919 | Bacteria | 13997 |
| 90 | Ga0207657_10021283 | 3300025919 | Bacteria | 6108 |
| 91 | Ga0207657_10029643 | 3300025919 | Bacteria | 4978 |
| 92 | Ga0207649_10104101 | 3300025920 | Bacteria | 1884 |
| 93 | Ga0207694_10058505 | 3300025924 | Bacteria | 2998 |
| 94 | Ga0207650_10102855 | 3300025925 | Bacteria | 2202 |
| 95 | Ga0207659_10053912 | 3300025926 | Bacteria | 2870 |
| 96 | Ga0207659_10702952 | 3300025926 | Bacteria | 866 |
| 97 | Ga0207690_10359820 | 3300025932 | Bacteria | 1152 |
| 98 | Ga0207706_10007601 | 3300025933 | Bacteria | 10028 |
| 99 | Ga0207670_10018572 | 3300025936 | Bacteria | 4231 |
| 100 | Ga0207669_10179572 | 3300025937 | Bacteria | 1516 |
| 101 | Ga0207711_10154731 | 3300025941 | Bacteria | 2071 |
| 102 | Ga0207679_10012541 | 3300025945 | Bacteria | 5529 |
| 103 | Ga0207679_10458430 | 3300025945 | Bacteria | 1132 |
| 104 | Ga0207679_10881751 | 3300025945 | Bacteria | 818 |
| 105 | Ga0207667_10736243 | 3300025949 | Bacteria | 986 |
| 106 | Ga0207651_10009634 | 3300025960 | Bacteria | 5304 |
| 107 | Ga0207651_10035998 | 3300025960 | Bacteria | 3226 |
| 108 | Ga0207651_10362456 | 3300025960 | Bacteria | 1224 |
| 109 | Ga0207640_10176992 | 3300025981 | Bacteria | 1596 |
| 110 | Ga0207677_10163830 | 3300026023 | Bacteria | 1731 |
| 111 | Ga0207703_10010388 | 3300026035 | Bacteria | 7283 |
| 112 | Ga0207639_10089361 | 3300026041 | Bacteria | 2461 |
| 113 | Ga0207639_10304358 | 3300026041 | Bacteria | 1410 |
| 114 | Ga0207702_10361108 | 3300026078 | Bacteria | 1392 |
| 115 | Ga0207674_10017946 | 3300026116 | Bacteria | 7712 |
| 116 | Ga0207674_10032542 | 3300026116 | Bacteria | 5469 |
| 117 | Ga0207674_10363696 | 3300026116 | Bacteria | 1398 |
| 118 | Ga0207683_10012270 | 3300026121 | Bacteria | 7313 |
| 119 | Ga0268266_10029186 | 3300028379 | Bacteria | 4689 |
| 120 | Ga0268266_10091491 | 3300028379 | Bacteria | 2667 |
| 121 | Ga0268266_10784894 | 3300028379 | Bacteria | 920 |
| 122 | Ga0268265_10102917 | 3300028380 | Bacteria | 2311 |
| 123 | Ga0268265_10206928 | 3300028380 | Bacteria | 1707 |
| 124 | Ga0268264_10042594 | 3300028381 | Bacteria | 3759 |
| 125 | Ga0265313_10060938 | 3300031595 | Bacteria | 1768 |
| 126 | Ga0307508_10009824 | 3300031616 | Bacteria | 8769 |
| 127 | Ga0316579_10014557 | 3300031691 | Bacteria | 3404 |
| 128 | Ga0316576_10200692 | 3300031727 | Bacteria | 1502 |
| 129 | Ga0316578_10061735 | 3300031728 | Bacteria | 2208 |
| 130 | Ga0316577_10132515 | 3300031733 | Bacteria | 1402 |
| 131 | Ga0307413_10189267 | 3300031824 | Bacteria | 1476 |
| 132 | Ga0307406_10275124 | 3300031901 | Bacteria | 1281 |
| 133 | Ga0307406_10326677 | 3300031901 | Bacteria | 1189 |
| 134 | Ga0307406_10619667 | 3300031901 | Bacteria | 894 |
| 135 | Ga0307409_100200638 | 3300031995 | Bacteria | 1784 |
| 136 | Ga0307409_100214984 | 3300031995 | Bacteria | 1731 |
| 137 | Ga0307416_100504083 | 3300032002 | Bacteria | 1275 |
| 138 | Ga0307411_10021709 | 3300032005 | Bacteria | 3763 |
| 139 | Ga0307415_100042581 | 3300032126 | Bacteria | 3023 |
| 140 | Ga0316583_10011540 | 3300032133 | Bacteria | 3183 |
| 141 | Ga0316585_10054209 | 3300032137 | Bacteria | 1289 |
| 142 | Ga0316593_10001888 | 3300032168 | Bacteria | 4797 |
| 143 | Ga0373957_0082078 | 3300035120 | Bacteria | 1274 |
| 144 | Ga0316574_0011259 | 3300035398 | Bacteria | 5079 |
| 145 | Ga0316574_0031093 | 3300035398 | Bacteria | 3237 |
| 146 | Ga0316574_0041752 | 3300035398 | Bacteria | 2829 |
| 147 | Ga0373937_0266936 | 3300036401 | Bacteria | 1615 |
| 148 | Ga0316582_0121251 | 3300036647 | Bacteria | 1749 |
| 149 | Ga0316582_0243251 | 3300036647 | Bacteria | 1233 |
| 150 | Ga0316582_0416596 | 3300036647 | Bacteria | 925 |
| 151 | Ga0316584_0194780 | 3300036712 | Bacteria | 1497 |
| 152 | Ga0316584_0216276 | 3300036712 | Bacteria | 1409 |
| 153 | Ga0316584_0223148 | 3300036712 | Bacteria | 1383 |
| 154 | Ga0316584_0440905 | 3300036712 | Bacteria | 922 |
| 155 | Ga0395899_0021005 | 3300037312 | Bacteria | 4951 |
| 156 | Ga0395905_0012333 | 3300037471 | Bacteria | 8227 |
| 157 | Ga0400489_15423 | 3300039093 | Bacteria | 3231 |
| 158 | Ga0436365_0308635 | 3300039437 | Unclassified | 1017 |
| 159 | Ga0436363_0625559 | 3300039450 | Unclassified | 1138 |
| 160 | Ga0439458_0027101 | 3300042157 | Bacteria | 1351 |
| 161 | Ga0451577_0394670 | 3300042876 | Bacteria | 1256 |
| 162 | Ga0495629_0216216 | 3300046459 | Bacteria | 1323 |
| 163 | Ga0495651_0030636 | 3300046462 | Bacteria | 4195 |
| 164 | Ga0495653_0024785 | 3300046463 | Bacteria | 4829 |
| 165 | Ga0495664_0010915 | 3300046477 | Bacteria | 5109 |
| 166 | Ga0495594_0076966 | 3300046499 | Bacteria | 1861 |
| 167 | Ga0495628_0143383 | 3300046516 | Bacteria | 1822 |
| 168 | Ga0495630_0162751 | 3300046517 | Bacteria | 1699 |
| 169 | Ga0495630_0216867 | 3300046517 | Bacteria | 1461 |
| 170 | Ga0495663_0031852 | 3300046525 | Bacteria | 1568 |
| 171 | Ga0495652_0011217 | 3300046529 | Bacteria | 8113 |
| 172 | Ga0495665_0008286 | 3300046531 | Bacteria | 5635 |
| 173 | Ga0495586_0054012 | 3300046535 | Unclassified | 2177 |
| 174 | Ga0495587_0001370 | 3300046536 | Bacteria | 16176 |
| 175 | Ga0495645_0006739 | 3300046543 | Bacteria | 7981 |
| 176 | Ga0495634_0055450 | 3300046642 | Bacteria | 2650 |
| 177 | Ga0495599_0006290 | 3300046678 | Bacteria | 7155 |
| 178 | Ga0495623_0008171 | 3300046679 | Bacteria | 6804 |
| 179 | Ga0495675_0241769 | 3300047444 | Bacteria | 1086 |
| 180 | Ga0495684_0008456 | 3300047471 | Bacteria | 7967 |
| 181 | Ga0496101_0085324 | 3300048904 | Bacteria | 2340 |
| 182 | Ga0496102_0184315 | 3300048905 | Bacteria | 1967 |
| 183 | Ga0496107_0031481 | 3300048910 | Bacteria | 3786 |
| 184 | Ga0496108_0284916 | 3300048911 | Bacteria | 1438 |
| 185 | Ga0496108_0362247 | 3300048911 | Bacteria | 1266 |
| 186 | Ga0496108_0739484 | 3300048911 | Bacteria | 851 |
| 187 | Ga0496112_0589404 | 3300048915 | Bacteria | 1044 |
| 188 | Ga0496114_0396743 | 3300048917 | Bacteria | 1222 |
| 189 | Ga0501047_0447665 | 3300049581 | Bacteria | 1121 |
| 190 | Ga0501067_0105775 | 3300049583 | Bacteria | 1564 |
| 191 | nmdc:mga05p37_74645_c1 | 3300050507 | Bacteria | 4174 |
| 192 | nmdc:mga09592_452642_c1 | 3300050508 | Bacteria | 1107 |
| 193 | nmdc:mga0qj67_362651_c1 | 3300050509 | Bacteria | 1171 |
| 194 | nmdc:mga06r32_679946_c1 | 3300050510 | Bacteria | 996 |
| 195 | Ga0495601_0137353 | 3300053077 | Bacteria | 1594 |
| 196 | Ga0495595_0048336 | 3300053084 | Bacteria | 1964 |
| 197 | Ga0501082_0804596 | 3300060353 | Unclassified | 822 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036647 | Ga0316582_0243251 | Ga0316582_0243251_414_1040 | 187 |
| 2 | 3300005338 | Ga0068868_100076743 | Ga0068868_1000767432 | 193 |
| 3 | 3300009098 | Ga0105245_11236623 | Ga0105245_112366231 | 193 |
| 4 | 3300013296 | Ga0157374_10552134 | Ga0157374_105521342 | 193 |
| 5 | 3300014325 | Ga0163163_10351390 | Ga0163163_103513902 | 193 |
| 6 | 3300048915 | Ga0496112_0589404 | Ga0496112_0589404_289_960 | 193 |
| 7 | 3300049581 | Ga0501047_0447665 | Ga0501047_0447665_307_975 | 193 |
| 8 | 3300053077 | Ga0495601_0137353 | Ga0495601_0137353_572_1291 | 195 |
| 9 | 3300050507 | nmdc:mga05p37_74645_c1 | nmdc:mga05p37_74645_c1_1351_1968 | 200 |
| 10 | 3300050508 | nmdc:mga09592_452642_c1 | nmdc:mga09592_452642_c1_144_761 | 200 |
| 11 | 3300039437 | Ga0436365_0308635 | Ga0436365_0308635_252_881 | 202 |
| 12 | 3300039450 | Ga0436363_0625559 | Ga0436363_0625559_349_978 | 202 |
| 13 | 3300048905 | Ga0496102_0184315 | Ga0496102_0184315_1272_1898 | 202 |
| 14 | 3300005331 | Ga0070670_100072215 | Ga0070670_1000722152 | 203 |
| 15 | 3300007076 | Ga0075435_100559202 | Ga0075435_1005592022 | 203 |
| 16 | 3300035398 | Ga0316574_0031093 | Ga0316574_0031093_2141_2845 | 203 |
| 17 | 3300035398 | Ga0316574_0041752 | Ga0316574_0041752_755_1414 | 203 |
| 18 | 3300060353 | Ga0501082_0804596 | Ga0501082_0804596_37_717 | 203 |
| 19 | 3300014325 | Ga0163163_10578660 | Ga0163163_105786602 | 204 |
| 20 | 3300025960 | Ga0207651_10362456 | Ga0207651_103624561 | 204 |
| 21 | 3300031691 | Ga0316579_10014557 | Ga0316579_100145572 | 204 |
| 22 | 3300031727 | Ga0316576_10200692 | Ga0316576_102006921 | 204 |
| 23 | 3300031728 | Ga0316578_10061735 | Ga0316578_100617352 | 204 |
| 24 | 3300031733 | Ga0316577_10132515 | Ga0316577_101325152 | 204 |
| 25 | 3300032133 | Ga0316583_10011540 | Ga0316583_100115402 | 204 |
| 26 | 3300032137 | Ga0316585_10054209 | Ga0316585_100542092 | 204 |
| 27 | 3300035398 | Ga0316574_0011259 | Ga0316574_0011259_2101_2784 | 204 |
| 28 | 3300036647 | Ga0316582_0121251 | Ga0316582_0121251_242_925 | 204 |
| 29 | 3300036647 | Ga0316582_0416596 | Ga0316582_0416596_23_706 | 204 |
| 30 | 3300036712 | Ga0316584_0194780 | Ga0316584_0194780_743_1426 | 204 |
| 31 | 3300036712 | Ga0316584_0216276 | Ga0316584_0216276_560_1243 | 204 |
| 32 | 3300036712 | Ga0316584_0223148 | Ga0316584_0223148_465_1148 | 204 |
| 33 | 3300036712 | Ga0316584_0440905 | Ga0316584_0440905_130_813 | 204 |
| 34 | 3300005289 | Ga0065704_10001772 | Ga0065704_100017725 | 205 |
| 35 | 3300005338 | Ga0068868_100140207 | Ga0068868_1001402072 | 205 |
| 36 | 3300005466 | Ga0070685_10019371 | Ga0070685_100193714 | 205 |
| 37 | 3300005548 | Ga0070665_101034998 | Ga0070665_1010349981 | 205 |
| 38 | 3300005617 | Ga0068859_100201683 | Ga0068859_1002016832 | 205 |
| 39 | 3300005842 | Ga0068858_100001888 | Ga0068858_1000018886 | 205 |
| 40 | 3300005842 | Ga0068858_100770826 | Ga0068858_1007708262 | 205 |
| 41 | 3300005843 | Ga0068860_100066357 | Ga0068860_1000663571 | 205 |
| 42 | 3300006871 | Ga0075434_100551597 | Ga0075434_1005515972 | 205 |
| 43 | 3300006931 | Ga0097620_100201682 | Ga0097620_1002016822 | 205 |
| 44 | 3300009101 | Ga0105247_10010076 | Ga0105247_100100767 | 205 |
| 45 | 3300009147 | Ga0114129_10004551 | Ga0114129_100045516 | 205 |
| 46 | 3300009176 | Ga0105242_10224132 | Ga0105242_102241322 | 205 |
| 47 | 3300009177 | Ga0105248_10032233 | Ga0105248_100322333 | 205 |
| 48 | 3300009177 | Ga0105248_10962807 | Ga0105248_109628071 | 205 |
| 49 | 3300013308 | Ga0157375_10607653 | Ga0157375_106076532 | 205 |
| 50 | 3300014968 | Ga0157379_10067559 | Ga0157379_100675593 | 205 |
| 51 | 3300014969 | Ga0157376_10166542 | Ga0157376_101665422 | 205 |
| 52 | 3300025926 | Ga0207659_10702952 | Ga0207659_107029521 | 205 |
| 53 | 3300025936 | Ga0207670_10018572 | Ga0207670_100185722 | 205 |
| 54 | 3300025941 | Ga0207711_10154731 | Ga0207711_101547312 | 205 |
| 55 | 3300026035 | Ga0207703_10010388 | Ga0207703_100103884 | 205 |
| 56 | 3300028379 | Ga0268266_10784894 | Ga0268266_107848942 | 205 |
| 57 | 3300028381 | Ga0268264_10042594 | Ga0268264_100425942 | 205 |
| 58 | 3300035120 | Ga0373957_0082078 | Ga0373957_0082078_226_906 | 205 |
| 59 | 3300036401 | Ga0373937_0266936 | Ga0373937_0266936_484_1170 | 205 |
| 60 | 3300046459 | Ga0495629_0216216 | Ga0495629_0216216_544_1224 | 205 |
| 61 | 3300046462 | Ga0495651_0030636 | Ga0495651_0030636_1216_1896 | 205 |
| 62 | 3300046463 | Ga0495653_0024785 | Ga0495653_0024785_274_954 | 205 |
| 63 | 3300046477 | Ga0495664_0010915 | Ga0495664_0010915_2273_2953 | 205 |
| 64 | 3300046499 | Ga0495594_0076966 | Ga0495594_0076966_886_1566 | 205 |
| 65 | 3300046516 | Ga0495628_0143383 | Ga0495628_0143383_176_856 | 205 |
| 66 | 3300046517 | Ga0495630_0216867 | Ga0495630_0216867_587_1267 | 205 |
| 67 | 3300046529 | Ga0495652_0011217 | Ga0495652_0011217_151_831 | 205 |
| 68 | 3300046531 | Ga0495665_0008286 | Ga0495665_0008286_4926_5606 | 205 |
| 69 | 3300046535 | Ga0495586_0054012 | Ga0495586_0054012_1263_1952 | 205 |
| 70 | 3300046536 | Ga0495587_0001370 | Ga0495587_0001370_13109_13789 | 205 |
| 71 | 3300046543 | Ga0495645_0006739 | Ga0495645_0006739_4493_5173 | 205 |
| 72 | 3300046642 | Ga0495634_0055450 | Ga0495634_0055450_1187_1873 | 205 |
| 73 | 3300046678 | Ga0495599_0006290 | Ga0495599_0006290_391_1071 | 205 |
| 74 | 3300046679 | Ga0495623_0008171 | Ga0495623_0008171_1964_2644 | 205 |
| 75 | 3300047444 | Ga0495675_0241769 | Ga0495675_0241769_158_838 | 205 |
| 76 | 3300047471 | Ga0495684_0008456 | Ga0495684_0008456_2518_3198 | 205 |
| 77 | 3300048917 | Ga0496114_0396743 | Ga0496114_0396743_20_706 | 205 |
| 78 | 3300053084 | Ga0495595_0048336 | Ga0495595_0048336_96_776 | 205 |
| 79 | 3300005354 | Ga0070675_100484435 | Ga0070675_1004844352 | 206 |
| 80 | 3300025945 | Ga0207679_10881751 | Ga0207679_108817511 | 206 |
| 81 | 3300001990 | JGI24737J22298_10017911 | JGI24737J22298_100179111 | 207 |
| 82 | 3300002067 | JGI24735J21928_10009420 | JGI24735J21928_100094203 | 207 |
| 83 | 3300005327 | Ga0070658_10012545 | Ga0070658_100125458 | 207 |
| 84 | 3300005335 | Ga0070666_10017869 | Ga0070666_100178696 | 207 |
| 85 | 3300005335 | Ga0070666_10047238 | Ga0070666_100472383 | 207 |
| 86 | 3300005336 | Ga0070680_100115849 | Ga0070680_1001158493 | 207 |
| 87 | 3300005339 | Ga0070660_100024872 | Ga0070660_1000248726 | 207 |
| 88 | 3300005339 | Ga0070660_100042670 | Ga0070660_1000426704 | 207 |
| 89 | 3300005339 | Ga0070660_100050276 | Ga0070660_1000502764 | 207 |
| 90 | 3300005344 | Ga0070661_100035759 | Ga0070661_1000357594 | 207 |
| 91 | 3300005344 | Ga0070661_100059404 | Ga0070661_1000594044 | 207 |
| 92 | 3300005344 | Ga0070661_100212756 | Ga0070661_1002127562 | 207 |
| 93 | 3300005347 | Ga0070668_100027965 | Ga0070668_1000279655 | 207 |
| 94 | 3300005353 | Ga0070669_100032320 | Ga0070669_1000323204 | 207 |
| 95 | 3300005353 | Ga0070669_100386087 | Ga0070669_1003860872 | 207 |
| 96 | 3300005355 | Ga0070671_100326168 | Ga0070671_1003261681 | 207 |
| 97 | 3300005364 | Ga0070673_100015941 | Ga0070673_1000159414 | 207 |
| 98 | 3300005367 | Ga0070667_100105816 | Ga0070667_1001058163 | 207 |
| 99 | 3300005435 | Ga0070714_100284662 | Ga0070714_1002846622 | 207 |
| 100 | 3300005455 | Ga0070663_100012118 | Ga0070663_1000121186 | 207 |
| 101 | 3300005456 | Ga0070678_100058320 | Ga0070678_1000583202 | 207 |
| 102 | 3300005457 | Ga0070662_100001725 | Ga0070662_10000172510 | 207 |
| 103 | 3300005457 | Ga0070662_100172712 | Ga0070662_1001727123 | 207 |
| 104 | 3300005458 | Ga0070681_10234369 | Ga0070681_102343692 | 207 |
| 105 | 3300005458 | Ga0070681_10508519 | Ga0070681_105085191 | 207 |
| 106 | 3300005467 | Ga0070706_100159596 | Ga0070706_1001595962 | 207 |
| 107 | 3300005471 | Ga0070698_100004460 | Ga0070698_1000044604 | 207 |
| 108 | 3300005539 | Ga0068853_100232592 | Ga0068853_1002325922 | 207 |
| 109 | 3300005539 | Ga0068853_100267985 | Ga0068853_1002679851 | 207 |
| 110 | 3300005548 | Ga0070665_100034313 | Ga0070665_1000343137 | 207 |
| 111 | 3300005564 | Ga0070664_100066634 | Ga0070664_1000666344 | 207 |
| 112 | 3300005564 | Ga0070664_100126740 | Ga0070664_1001267402 | 207 |
| 113 | 3300005564 | Ga0070664_100405898 | Ga0070664_1004058982 | 207 |
| 114 | 3300005577 | Ga0068857_100193988 | Ga0068857_1001939882 | 207 |
| 115 | 3300005577 | Ga0068857_100305886 | Ga0068857_1003058862 | 207 |
| 116 | 3300005578 | Ga0068854_100006464 | Ga0068854_1000064648 | 207 |
| 117 | 3300005578 | Ga0068854_100270391 | Ga0068854_1002703912 | 207 |
| 118 | 3300005618 | Ga0068864_100239766 | Ga0068864_1002397663 | 207 |
| 119 | 3300005834 | Ga0068851_10067262 | Ga0068851_100672623 | 207 |
| 120 | 3300005840 | Ga0068870_10220713 | Ga0068870_102207131 | 207 |
| 121 | 3300005842 | Ga0068858_100382807 | Ga0068858_1003828072 | 207 |
| 122 | 3300006028 | Ga0070717_10153722 | Ga0070717_101537223 | 207 |
| 123 | 3300006237 | Ga0097621_100907066 | Ga0097621_1009070661 | 207 |
| 124 | 3300006844 | Ga0075428_100554268 | Ga0075428_1005542683 | 207 |
| 125 | 3300009093 | Ga0105240_10036108 | Ga0105240_100361082 | 207 |
| 126 | 3300009147 | Ga0114129_10222104 | Ga0114129_102221045 | 207 |
| 127 | 3300009551 | Ga0105238_10120580 | Ga0105238_101205803 | 207 |
| 128 | 3300009553 | Ga0105249_10428194 | Ga0105249_104281941 | 207 |
| 129 | 3300011119 | Ga0105246_10217158 | Ga0105246_102171581 | 207 |
| 130 | 3300013105 | Ga0157369_10021841 | Ga0157369_100218414 | 207 |
| 131 | 3300013296 | Ga0157374_10031577 | Ga0157374_100315777 | 207 |
| 132 | 3300013306 | Ga0163162_10147748 | Ga0163162_101477482 | 207 |
| 133 | 3300017792 | Ga0163161_10097921 | Ga0163161_100979212 | 207 |
| 134 | 3300021384 | Ga0213876_10191432 | Ga0213876_101914322 | 207 |
| 135 | 3300025321 | Ga0207656_10089734 | Ga0207656_100897342 | 207 |
| 136 | 3300025903 | Ga0207680_10028084 | Ga0207680_100280844 | 207 |
| 137 | 3300025903 | Ga0207680_10036145 | Ga0207680_100361454 | 207 |
| 138 | 3300025909 | Ga0207705_10017971 | Ga0207705_100179713 | 207 |
| 139 | 3300025910 | Ga0207684_10154942 | Ga0207684_101549422 | 207 |
| 140 | 3300025912 | Ga0207707_10303004 | Ga0207707_103030042 | 207 |
| 141 | 3300025913 | Ga0207695_10061927 | Ga0207695_100619273 | 207 |
| 142 | 3300025917 | Ga0207660_10504893 | Ga0207660_105048931 | 207 |
| 143 | 3300025919 | Ga0207657_10004967 | Ga0207657_1000496716 | 207 |
| 144 | 3300025919 | Ga0207657_10021283 | Ga0207657_100212836 | 207 |
| 145 | 3300025919 | Ga0207657_10029643 | Ga0207657_100296437 | 207 |
| 146 | 3300025920 | Ga0207649_10104101 | Ga0207649_101041013 | 207 |
| 147 | 3300025924 | Ga0207694_10058505 | Ga0207694_100585053 | 207 |
| 148 | 3300025925 | Ga0207650_10102855 | Ga0207650_101028552 | 207 |
| 149 | 3300025926 | Ga0207659_10053912 | Ga0207659_100539122 | 207 |
| 150 | 3300025932 | Ga0207690_10359820 | Ga0207690_103598202 | 207 |
| 151 | 3300025933 | Ga0207706_10007601 | Ga0207706_1000760112 | 207 |
| 152 | 3300025937 | Ga0207669_10179572 | Ga0207669_101795722 | 207 |
| 153 | 3300025945 | Ga0207679_10012541 | Ga0207679_100125412 | 207 |
| 154 | 3300025945 | Ga0207679_10458430 | Ga0207679_104584302 | 207 |
| 155 | 3300025949 | Ga0207667_10736243 | Ga0207667_107362432 | 207 |
| 156 | 3300025960 | Ga0207651_10009634 | Ga0207651_100096347 | 207 |
| 157 | 3300025960 | Ga0207651_10035998 | Ga0207651_100359985 | 207 |
| 158 | 3300025981 | Ga0207640_10176992 | Ga0207640_101769922 | 207 |
| 159 | 3300026023 | Ga0207677_10163830 | Ga0207677_101638302 | 207 |
| 160 | 3300026041 | Ga0207639_10089361 | Ga0207639_100893614 | 207 |
| 161 | 3300026041 | Ga0207639_10304358 | Ga0207639_103043582 | 207 |
| 162 | 3300026078 | Ga0207702_10361108 | Ga0207702_103611082 | 207 |
| 163 | 3300026116 | Ga0207674_10017946 | Ga0207674_100179468 | 207 |
| 164 | 3300026116 | Ga0207674_10032542 | Ga0207674_100325422 | 207 |
| 165 | 3300026116 | Ga0207674_10363696 | Ga0207674_103636962 | 207 |
| 166 | 3300026121 | Ga0207683_10012270 | Ga0207683_100122704 | 207 |
| 167 | 3300028379 | Ga0268266_10029186 | Ga0268266_100291864 | 207 |
| 168 | 3300028379 | Ga0268266_10091491 | Ga0268266_100914914 | 207 |
| 169 | 3300028380 | Ga0268265_10102917 | Ga0268265_101029172 | 207 |
| 170 | 3300028380 | Ga0268265_10206928 | Ga0268265_102069282 | 207 |
| 171 | 3300031595 | Ga0265313_10060938 | Ga0265313_100609382 | 207 |
| 172 | 3300031616 | Ga0307508_10009824 | Ga0307508_100098248 | 207 |
| 173 | 3300031824 | Ga0307413_10189267 | Ga0307413_101892672 | 207 |
| 174 | 3300031901 | Ga0307406_10275124 | Ga0307406_102751242 | 207 |
| 175 | 3300031901 | Ga0307406_10326677 | Ga0307406_103266772 | 207 |
| 176 | 3300031901 | Ga0307406_10619667 | Ga0307406_106196671 | 207 |
| 177 | 3300031995 | Ga0307409_100200638 | Ga0307409_1002006381 | 207 |
| 178 | 3300031995 | Ga0307409_100214984 | Ga0307409_1002149843 | 207 |
| 179 | 3300032002 | Ga0307416_100504083 | Ga0307416_1005040831 | 207 |
| 180 | 3300032005 | Ga0307411_10021709 | Ga0307411_100217094 | 207 |
| 181 | 3300032126 | Ga0307415_100042581 | Ga0307415_1000425813 | 207 |
| 182 | 3300032168 | Ga0316593_10001888 | Ga0316593_100018886 | 207 |
| 183 | 3300037312 | Ga0395899_0021005 | Ga0395899_0021005_1826_2518 | 207 |
| 184 | 3300037471 | Ga0395905_0012333 | Ga0395905_0012333_5159_5902 | 207 |
| 185 | 3300039093 | Ga0400489_15423 | Ga0400489_15423_1313_2008 | 207 |
| 186 | 3300042157 | Ga0439458_0027101 | Ga0439458_0027101_520_1242 | 207 |
| 187 | 3300042876 | Ga0451577_0394670 | Ga0451577_0394670_336_1043 | 207 |
| 188 | 3300046517 | Ga0495630_0162751 | Ga0495630_0162751_897_1661 | 207 |
| 189 | 3300046525 | Ga0495663_0031852 | Ga0495663_0031852_858_1535 | 207 |
| 190 | 3300048904 | Ga0496101_0085324 | Ga0496101_0085324_1017_1682 | 207 |
| 191 | 3300048910 | Ga0496107_0031481 | Ga0496107_0031481_2135_2836 | 207 |
| 192 | 3300048911 | Ga0496108_0284916 | Ga0496108_0284916_726_1391 | 207 |
| 193 | 3300048911 | Ga0496108_0362247 | Ga0496108_0362247_287_994 | 207 |
| 194 | 3300048911 | Ga0496108_0739484 | Ga0496108_0739484_103_795 | 207 |
| 195 | 3300049583 | Ga0501067_0105775 | Ga0501067_0105775_98_763 | 207 |
| 196 | 3300050509 | nmdc:mga0qj67_362651_c1 | nmdc:mga0qj67_362651_c1_175_954 | 207 |
| 197 | 3300050510 | nmdc:mga06r32_679946_c1 | nmdc:mga06r32_679946_c1_11_790 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bl5-assembly1.cif.gz_A | crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis | 0.8228 | 2 | 197 |
| 3bl5-assembly6.cif.gz_F | crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis | 0.8085 | 2 | 197 |
| 2pg3-assembly1.cif.gz_A-2 | crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution | 0.7763 | 2 | 197 |
| 3bl5-assembly1.cif.gz_A | crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis | 0.748 | 2 | 197 |
| 3bl5-assembly6.cif.gz_F | crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis | 0.737 | 2 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1X6_7_221_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8647 | 2 | 196 | 3.40.50.620 |
| af_Q58742_1_231_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8444 | 2 | 205 | 3.40.50.620 |
| af_Q58742_1_231_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8366 | 2 | 205 | 3.40.50.620 |
| af_Q2G1X6_7_221_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.817 | 2 | 196 | 3.40.50.620 |
| af_P0ADW6_41_234_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.6919 | 4 | 48 | 3.80.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U1G3G2-F1-model_v4 | deleted | 0.9878 | 2 | 205 |
|
| AF-A0A1B3N740-F1-model_v4 | 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) | 0.985 | 1 | 205 |
GO:0005524
GO:0008270 GO:0008616 GO:0016879 |
| AF-A0A5E7ZD32-F1-model_v4 | 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) | 0.9832 | 1 | 205 |
GO:0005524
GO:0008270 GO:0008616 GO:0016879 |
| AF-N9VYL0-F1-model_v4 | 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) | 0.9831 | 2 | 205 |
GO:0005524
GO:0008270 GO:0008616 GO:0016879 |
| AF-A0A1D7NHA1-F1-model_v4 | 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) | 0.9826 | 1 | 205 |
GO:0005524
GO:0008270 GO:0008616 GO:0016879 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar