F303629

General Info

Members Datasets Scaffolds Average Seq Length
197 149 197 225

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_362651_c1|nmdc:mga0qj67_362651_c1_175_954
Length 259
Sequence MPCVPRPAIVLSSGGLDSTTCIAIARHQRFAPLYSLSFDYGQRHRHELDAAKRIAQEFRVAQHRVVTIDLRQFGKSALTDDAVAVPKDRDESAMSSDIPVTYVPARNTIFLSYALAWAEVLDVRDVFIGVNAVDYSGYPDCRPQFIAAFEAMANLATKMTVEAKDEGGRMKDEGKAAGSTSSFIPHPSSPPFKIHTPLMHMTKAQIIRRGAELGVDYSLTHSCYDPDPAGRACGRCDSCVLRRKGFAEAGVTDPTRYVG

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
104 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.06
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10017911 3300001990 Bacteria 2278
2 JGI24735J21928_10009420 3300002067 Bacteria 3136
3 Ga0065704_10001772 3300005289 Bacteria 10728
4 Ga0070658_10012545 3300005327 Bacteria 6798
5 Ga0070670_100072215 3300005331 Bacteria 2963
6 Ga0070666_10017869 3300005335 Bacteria 4549
7 Ga0070666_10047238 3300005335 Bacteria 2890
8 Ga0070680_100115849 3300005336 Bacteria 2233
9 Ga0068868_100076743 3300005338 Bacteria 2672
10 Ga0068868_100140207 3300005338 Bacteria 1984
11 Ga0070660_100024872 3300005339 Bacteria 4447
12 Ga0070660_100042670 3300005339 Bacteria 3463
13 Ga0070660_100050276 3300005339 Bacteria 3207
14 Ga0070661_100035759 3300005344 Bacteria 3609
15 Ga0070661_100059404 3300005344 Bacteria 2804
16 Ga0070661_100212756 3300005344 Bacteria 1480
17 Ga0070668_100027965 3300005347 Bacteria 4279
18 Ga0070669_100032320 3300005353 Bacteria 3779
19 Ga0070669_100386087 3300005353 Bacteria 1143
20 Ga0070675_100484435 3300005354 Bacteria 1113
21 Ga0070671_100326168 3300005355 Bacteria 1308
22 Ga0070673_100015941 3300005364 Bacteria 5295
23 Ga0070667_100105816 3300005367 Bacteria 2435
24 Ga0070714_100284662 3300005435 Bacteria 1537
25 Ga0070663_100012118 3300005455 Bacteria 5442
26 Ga0070678_100058320 3300005456 Bacteria 2833
27 Ga0070662_100001725 3300005457 Bacteria 13451
28 Ga0070662_100172712 3300005457 Bacteria 1698
29 Ga0070681_10234369 3300005458 Bacteria 1750
30 Ga0070681_10508519 3300005458 Bacteria 1118
31 Ga0070685_10019371 3300005466 Bacteria 3670
32 Ga0070706_100159596 3300005467 Bacteria 2105
33 Ga0070698_100004460 3300005471 Bacteria 15386
34 Ga0068853_100232592 3300005539 Bacteria 1686
35 Ga0068853_100267985 3300005539 Bacteria 1572
36 Ga0070665_100034313 3300005548 Bacteria 5103
37 Ga0070665_101034998 3300005548 Bacteria 833
38 Ga0070664_100066634 3300005564 Bacteria 3075
39 Ga0070664_100126740 3300005564 Bacteria 2240
40 Ga0070664_100405898 3300005564 Bacteria 1246
41 Ga0068857_100193988 3300005577 Bacteria 1850
42 Ga0068857_100305886 3300005577 Bacteria 1466
43 Ga0068854_100006464 3300005578 Bacteria 7456
44 Ga0068854_100270391 3300005578 Bacteria 1364
45 Ga0068859_100201683 3300005617 Bacteria 2074
46 Ga0068864_100239766 3300005618 Bacteria 1680
47 Ga0068851_10067262 3300005834 Bacteria 1848
48 Ga0068870_10220713 3300005840 Bacteria 1160
49 Ga0068858_100001888 3300005842 Bacteria 21404
50 Ga0068858_100382807 3300005842 Bacteria 1350
51 Ga0068858_100770826 3300005842 Bacteria 938
52 Ga0068860_100066357 3300005843 Bacteria 3428
53 Ga0070717_10153722 3300006028 Bacteria 1992
54 Ga0097621_100907066 3300006237 Bacteria 821
55 Ga0075428_100554268 3300006844 Bacteria 1229
56 Ga0075434_100551597 3300006871 Bacteria 1172
57 Ga0097620_100201682 3300006931 Bacteria 2074
58 Ga0075435_100559202 3300007076 Bacteria 991
59 Ga0105240_10036108 3300009093 Bacteria 6362
60 Ga0105245_11236623 3300009098 Bacteria 795
61 Ga0105247_10010076 3300009101 Bacteria 5726
62 Ga0114129_10004551 3300009147 Bacteria 19567
63 Ga0114129_10222104 3300009147 Bacteria 2548
64 Ga0105242_10224132 3300009176 Unclassified 1682
65 Ga0105248_10032233 3300009177 Bacteria 5858
66 Ga0105248_10962807 3300009177 Bacteria 964
67 Ga0105238_10120580 3300009551 Bacteria 2602
68 Ga0105249_10428194 3300009553 Bacteria 1358
69 Ga0105246_10217158 3300011119 Bacteria 1496
70 Ga0157369_10021841 3300013105 Bacteria 7155
71 Ga0157374_10031577 3300013296 Bacteria 4815
72 Ga0157374_10552134 3300013296 Bacteria 1160
73 Ga0163162_10147748 3300013306 Bacteria 2467
74 Ga0157375_10607653 3300013308 Bacteria 1252
75 Ga0163163_10351390 3300014325 Bacteria 1530
76 Ga0163163_10578660 3300014325 Bacteria 1186
77 Ga0157379_10067559 3300014968 Bacteria 3195
78 Ga0157376_10166542 3300014969 Bacteria 2003
79 Ga0163161_10097921 3300017792 Bacteria 2179
80 Ga0213876_10191432 3300021384 Bacteria 1088
81 Ga0207656_10089734 3300025321 Bacteria 1394
82 Ga0207680_10028084 3300025903 Bacteria 3143
83 Ga0207680_10036145 3300025903 Bacteria 2843
84 Ga0207705_10017971 3300025909 Bacteria 5057
85 Ga0207684_10154942 3300025910 Bacteria 1972
86 Ga0207707_10303004 3300025912 Bacteria 1382
87 Ga0207695_10061927 3300025913 Bacteria 3865
88 Ga0207660_10504893 3300025917 Bacteria 981
89 Ga0207657_10004967 3300025919 Bacteria 13997
90 Ga0207657_10021283 3300025919 Bacteria 6108
91 Ga0207657_10029643 3300025919 Bacteria 4978
92 Ga0207649_10104101 3300025920 Bacteria 1884
93 Ga0207694_10058505 3300025924 Bacteria 2998
94 Ga0207650_10102855 3300025925 Bacteria 2202
95 Ga0207659_10053912 3300025926 Bacteria 2870
96 Ga0207659_10702952 3300025926 Bacteria 866
97 Ga0207690_10359820 3300025932 Bacteria 1152
98 Ga0207706_10007601 3300025933 Bacteria 10028
99 Ga0207670_10018572 3300025936 Bacteria 4231
100 Ga0207669_10179572 3300025937 Bacteria 1516
101 Ga0207711_10154731 3300025941 Bacteria 2071
102 Ga0207679_10012541 3300025945 Bacteria 5529
103 Ga0207679_10458430 3300025945 Bacteria 1132
104 Ga0207679_10881751 3300025945 Bacteria 818
105 Ga0207667_10736243 3300025949 Bacteria 986
106 Ga0207651_10009634 3300025960 Bacteria 5304
107 Ga0207651_10035998 3300025960 Bacteria 3226
108 Ga0207651_10362456 3300025960 Bacteria 1224
109 Ga0207640_10176992 3300025981 Bacteria 1596
110 Ga0207677_10163830 3300026023 Bacteria 1731
111 Ga0207703_10010388 3300026035 Bacteria 7283
112 Ga0207639_10089361 3300026041 Bacteria 2461
113 Ga0207639_10304358 3300026041 Bacteria 1410
114 Ga0207702_10361108 3300026078 Bacteria 1392
115 Ga0207674_10017946 3300026116 Bacteria 7712
116 Ga0207674_10032542 3300026116 Bacteria 5469
117 Ga0207674_10363696 3300026116 Bacteria 1398
118 Ga0207683_10012270 3300026121 Bacteria 7313
119 Ga0268266_10029186 3300028379 Bacteria 4689
120 Ga0268266_10091491 3300028379 Bacteria 2667
121 Ga0268266_10784894 3300028379 Bacteria 920
122 Ga0268265_10102917 3300028380 Bacteria 2311
123 Ga0268265_10206928 3300028380 Bacteria 1707
124 Ga0268264_10042594 3300028381 Bacteria 3759
125 Ga0265313_10060938 3300031595 Bacteria 1768
126 Ga0307508_10009824 3300031616 Bacteria 8769
127 Ga0316579_10014557 3300031691 Bacteria 3404
128 Ga0316576_10200692 3300031727 Bacteria 1502
129 Ga0316578_10061735 3300031728 Bacteria 2208
130 Ga0316577_10132515 3300031733 Bacteria 1402
131 Ga0307413_10189267 3300031824 Bacteria 1476
132 Ga0307406_10275124 3300031901 Bacteria 1281
133 Ga0307406_10326677 3300031901 Bacteria 1189
134 Ga0307406_10619667 3300031901 Bacteria 894
135 Ga0307409_100200638 3300031995 Bacteria 1784
136 Ga0307409_100214984 3300031995 Bacteria 1731
137 Ga0307416_100504083 3300032002 Bacteria 1275
138 Ga0307411_10021709 3300032005 Bacteria 3763
139 Ga0307415_100042581 3300032126 Bacteria 3023
140 Ga0316583_10011540 3300032133 Bacteria 3183
141 Ga0316585_10054209 3300032137 Bacteria 1289
142 Ga0316593_10001888 3300032168 Bacteria 4797
143 Ga0373957_0082078 3300035120 Bacteria 1274
144 Ga0316574_0011259 3300035398 Bacteria 5079
145 Ga0316574_0031093 3300035398 Bacteria 3237
146 Ga0316574_0041752 3300035398 Bacteria 2829
147 Ga0373937_0266936 3300036401 Bacteria 1615
148 Ga0316582_0121251 3300036647 Bacteria 1749
149 Ga0316582_0243251 3300036647 Bacteria 1233
150 Ga0316582_0416596 3300036647 Bacteria 925
151 Ga0316584_0194780 3300036712 Bacteria 1497
152 Ga0316584_0216276 3300036712 Bacteria 1409
153 Ga0316584_0223148 3300036712 Bacteria 1383
154 Ga0316584_0440905 3300036712 Bacteria 922
155 Ga0395899_0021005 3300037312 Bacteria 4951
156 Ga0395905_0012333 3300037471 Bacteria 8227
157 Ga0400489_15423 3300039093 Bacteria 3231
158 Ga0436365_0308635 3300039437 Unclassified 1017
159 Ga0436363_0625559 3300039450 Unclassified 1138
160 Ga0439458_0027101 3300042157 Bacteria 1351
161 Ga0451577_0394670 3300042876 Bacteria 1256
162 Ga0495629_0216216 3300046459 Bacteria 1323
163 Ga0495651_0030636 3300046462 Bacteria 4195
164 Ga0495653_0024785 3300046463 Bacteria 4829
165 Ga0495664_0010915 3300046477 Bacteria 5109
166 Ga0495594_0076966 3300046499 Bacteria 1861
167 Ga0495628_0143383 3300046516 Bacteria 1822
168 Ga0495630_0162751 3300046517 Bacteria 1699
169 Ga0495630_0216867 3300046517 Bacteria 1461
170 Ga0495663_0031852 3300046525 Bacteria 1568
171 Ga0495652_0011217 3300046529 Bacteria 8113
172 Ga0495665_0008286 3300046531 Bacteria 5635
173 Ga0495586_0054012 3300046535 Unclassified 2177
174 Ga0495587_0001370 3300046536 Bacteria 16176
175 Ga0495645_0006739 3300046543 Bacteria 7981
176 Ga0495634_0055450 3300046642 Bacteria 2650
177 Ga0495599_0006290 3300046678 Bacteria 7155
178 Ga0495623_0008171 3300046679 Bacteria 6804
179 Ga0495675_0241769 3300047444 Bacteria 1086
180 Ga0495684_0008456 3300047471 Bacteria 7967
181 Ga0496101_0085324 3300048904 Bacteria 2340
182 Ga0496102_0184315 3300048905 Bacteria 1967
183 Ga0496107_0031481 3300048910 Bacteria 3786
184 Ga0496108_0284916 3300048911 Bacteria 1438
185 Ga0496108_0362247 3300048911 Bacteria 1266
186 Ga0496108_0739484 3300048911 Bacteria 851
187 Ga0496112_0589404 3300048915 Bacteria 1044
188 Ga0496114_0396743 3300048917 Bacteria 1222
189 Ga0501047_0447665 3300049581 Bacteria 1121
190 Ga0501067_0105775 3300049583 Bacteria 1564
191 nmdc:mga05p37_74645_c1 3300050507 Bacteria 4174
192 nmdc:mga09592_452642_c1 3300050508 Bacteria 1107
193 nmdc:mga0qj67_362651_c1 3300050509 Bacteria 1171
194 nmdc:mga06r32_679946_c1 3300050510 Bacteria 996
195 Ga0495601_0137353 3300053077 Bacteria 1594
196 Ga0495595_0048336 3300053084 Bacteria 1964
197 Ga0501082_0804596 3300060353 Unclassified 822

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0243251 Ga0316582_0243251_414_1040 187
2 3300005338 Ga0068868_100076743 Ga0068868_1000767432 193
3 3300009098 Ga0105245_11236623 Ga0105245_112366231 193
4 3300013296 Ga0157374_10552134 Ga0157374_105521342 193
5 3300014325 Ga0163163_10351390 Ga0163163_103513902 193
6 3300048915 Ga0496112_0589404 Ga0496112_0589404_289_960 193
7 3300049581 Ga0501047_0447665 Ga0501047_0447665_307_975 193
8 3300053077 Ga0495601_0137353 Ga0495601_0137353_572_1291 195
9 3300050507 nmdc:mga05p37_74645_c1 nmdc:mga05p37_74645_c1_1351_1968 200
10 3300050508 nmdc:mga09592_452642_c1 nmdc:mga09592_452642_c1_144_761 200
11 3300039437 Ga0436365_0308635 Ga0436365_0308635_252_881 202
12 3300039450 Ga0436363_0625559 Ga0436363_0625559_349_978 202
13 3300048905 Ga0496102_0184315 Ga0496102_0184315_1272_1898 202
14 3300005331 Ga0070670_100072215 Ga0070670_1000722152 203
15 3300007076 Ga0075435_100559202 Ga0075435_1005592022 203
16 3300035398 Ga0316574_0031093 Ga0316574_0031093_2141_2845 203
17 3300035398 Ga0316574_0041752 Ga0316574_0041752_755_1414 203
18 3300060353 Ga0501082_0804596 Ga0501082_0804596_37_717 203
19 3300014325 Ga0163163_10578660 Ga0163163_105786602 204
20 3300025960 Ga0207651_10362456 Ga0207651_103624561 204
21 3300031691 Ga0316579_10014557 Ga0316579_100145572 204
22 3300031727 Ga0316576_10200692 Ga0316576_102006921 204
23 3300031728 Ga0316578_10061735 Ga0316578_100617352 204
24 3300031733 Ga0316577_10132515 Ga0316577_101325152 204
25 3300032133 Ga0316583_10011540 Ga0316583_100115402 204
26 3300032137 Ga0316585_10054209 Ga0316585_100542092 204
27 3300035398 Ga0316574_0011259 Ga0316574_0011259_2101_2784 204
28 3300036647 Ga0316582_0121251 Ga0316582_0121251_242_925 204
29 3300036647 Ga0316582_0416596 Ga0316582_0416596_23_706 204
30 3300036712 Ga0316584_0194780 Ga0316584_0194780_743_1426 204
31 3300036712 Ga0316584_0216276 Ga0316584_0216276_560_1243 204
32 3300036712 Ga0316584_0223148 Ga0316584_0223148_465_1148 204
33 3300036712 Ga0316584_0440905 Ga0316584_0440905_130_813 204
34 3300005289 Ga0065704_10001772 Ga0065704_100017725 205
35 3300005338 Ga0068868_100140207 Ga0068868_1001402072 205
36 3300005466 Ga0070685_10019371 Ga0070685_100193714 205
37 3300005548 Ga0070665_101034998 Ga0070665_1010349981 205
38 3300005617 Ga0068859_100201683 Ga0068859_1002016832 205
39 3300005842 Ga0068858_100001888 Ga0068858_1000018886 205
40 3300005842 Ga0068858_100770826 Ga0068858_1007708262 205
41 3300005843 Ga0068860_100066357 Ga0068860_1000663571 205
42 3300006871 Ga0075434_100551597 Ga0075434_1005515972 205
43 3300006931 Ga0097620_100201682 Ga0097620_1002016822 205
44 3300009101 Ga0105247_10010076 Ga0105247_100100767 205
45 3300009147 Ga0114129_10004551 Ga0114129_100045516 205
46 3300009176 Ga0105242_10224132 Ga0105242_102241322 205
47 3300009177 Ga0105248_10032233 Ga0105248_100322333 205
48 3300009177 Ga0105248_10962807 Ga0105248_109628071 205
49 3300013308 Ga0157375_10607653 Ga0157375_106076532 205
50 3300014968 Ga0157379_10067559 Ga0157379_100675593 205
51 3300014969 Ga0157376_10166542 Ga0157376_101665422 205
52 3300025926 Ga0207659_10702952 Ga0207659_107029521 205
53 3300025936 Ga0207670_10018572 Ga0207670_100185722 205
54 3300025941 Ga0207711_10154731 Ga0207711_101547312 205
55 3300026035 Ga0207703_10010388 Ga0207703_100103884 205
56 3300028379 Ga0268266_10784894 Ga0268266_107848942 205
57 3300028381 Ga0268264_10042594 Ga0268264_100425942 205
58 3300035120 Ga0373957_0082078 Ga0373957_0082078_226_906 205
59 3300036401 Ga0373937_0266936 Ga0373937_0266936_484_1170 205
60 3300046459 Ga0495629_0216216 Ga0495629_0216216_544_1224 205
61 3300046462 Ga0495651_0030636 Ga0495651_0030636_1216_1896 205
62 3300046463 Ga0495653_0024785 Ga0495653_0024785_274_954 205
63 3300046477 Ga0495664_0010915 Ga0495664_0010915_2273_2953 205
64 3300046499 Ga0495594_0076966 Ga0495594_0076966_886_1566 205
65 3300046516 Ga0495628_0143383 Ga0495628_0143383_176_856 205
66 3300046517 Ga0495630_0216867 Ga0495630_0216867_587_1267 205
67 3300046529 Ga0495652_0011217 Ga0495652_0011217_151_831 205
68 3300046531 Ga0495665_0008286 Ga0495665_0008286_4926_5606 205
69 3300046535 Ga0495586_0054012 Ga0495586_0054012_1263_1952 205
70 3300046536 Ga0495587_0001370 Ga0495587_0001370_13109_13789 205
71 3300046543 Ga0495645_0006739 Ga0495645_0006739_4493_5173 205
72 3300046642 Ga0495634_0055450 Ga0495634_0055450_1187_1873 205
73 3300046678 Ga0495599_0006290 Ga0495599_0006290_391_1071 205
74 3300046679 Ga0495623_0008171 Ga0495623_0008171_1964_2644 205
75 3300047444 Ga0495675_0241769 Ga0495675_0241769_158_838 205
76 3300047471 Ga0495684_0008456 Ga0495684_0008456_2518_3198 205
77 3300048917 Ga0496114_0396743 Ga0496114_0396743_20_706 205
78 3300053084 Ga0495595_0048336 Ga0495595_0048336_96_776 205
79 3300005354 Ga0070675_100484435 Ga0070675_1004844352 206
80 3300025945 Ga0207679_10881751 Ga0207679_108817511 206
81 3300001990 JGI24737J22298_10017911 JGI24737J22298_100179111 207
82 3300002067 JGI24735J21928_10009420 JGI24735J21928_100094203 207
83 3300005327 Ga0070658_10012545 Ga0070658_100125458 207
84 3300005335 Ga0070666_10017869 Ga0070666_100178696 207
85 3300005335 Ga0070666_10047238 Ga0070666_100472383 207
86 3300005336 Ga0070680_100115849 Ga0070680_1001158493 207
87 3300005339 Ga0070660_100024872 Ga0070660_1000248726 207
88 3300005339 Ga0070660_100042670 Ga0070660_1000426704 207
89 3300005339 Ga0070660_100050276 Ga0070660_1000502764 207
90 3300005344 Ga0070661_100035759 Ga0070661_1000357594 207
91 3300005344 Ga0070661_100059404 Ga0070661_1000594044 207
92 3300005344 Ga0070661_100212756 Ga0070661_1002127562 207
93 3300005347 Ga0070668_100027965 Ga0070668_1000279655 207
94 3300005353 Ga0070669_100032320 Ga0070669_1000323204 207
95 3300005353 Ga0070669_100386087 Ga0070669_1003860872 207
96 3300005355 Ga0070671_100326168 Ga0070671_1003261681 207
97 3300005364 Ga0070673_100015941 Ga0070673_1000159414 207
98 3300005367 Ga0070667_100105816 Ga0070667_1001058163 207
99 3300005435 Ga0070714_100284662 Ga0070714_1002846622 207
100 3300005455 Ga0070663_100012118 Ga0070663_1000121186 207
101 3300005456 Ga0070678_100058320 Ga0070678_1000583202 207
102 3300005457 Ga0070662_100001725 Ga0070662_10000172510 207
103 3300005457 Ga0070662_100172712 Ga0070662_1001727123 207
104 3300005458 Ga0070681_10234369 Ga0070681_102343692 207
105 3300005458 Ga0070681_10508519 Ga0070681_105085191 207
106 3300005467 Ga0070706_100159596 Ga0070706_1001595962 207
107 3300005471 Ga0070698_100004460 Ga0070698_1000044604 207
108 3300005539 Ga0068853_100232592 Ga0068853_1002325922 207
109 3300005539 Ga0068853_100267985 Ga0068853_1002679851 207
110 3300005548 Ga0070665_100034313 Ga0070665_1000343137 207
111 3300005564 Ga0070664_100066634 Ga0070664_1000666344 207
112 3300005564 Ga0070664_100126740 Ga0070664_1001267402 207
113 3300005564 Ga0070664_100405898 Ga0070664_1004058982 207
114 3300005577 Ga0068857_100193988 Ga0068857_1001939882 207
115 3300005577 Ga0068857_100305886 Ga0068857_1003058862 207
116 3300005578 Ga0068854_100006464 Ga0068854_1000064648 207
117 3300005578 Ga0068854_100270391 Ga0068854_1002703912 207
118 3300005618 Ga0068864_100239766 Ga0068864_1002397663 207
119 3300005834 Ga0068851_10067262 Ga0068851_100672623 207
120 3300005840 Ga0068870_10220713 Ga0068870_102207131 207
121 3300005842 Ga0068858_100382807 Ga0068858_1003828072 207
122 3300006028 Ga0070717_10153722 Ga0070717_101537223 207
123 3300006237 Ga0097621_100907066 Ga0097621_1009070661 207
124 3300006844 Ga0075428_100554268 Ga0075428_1005542683 207
125 3300009093 Ga0105240_10036108 Ga0105240_100361082 207
126 3300009147 Ga0114129_10222104 Ga0114129_102221045 207
127 3300009551 Ga0105238_10120580 Ga0105238_101205803 207
128 3300009553 Ga0105249_10428194 Ga0105249_104281941 207
129 3300011119 Ga0105246_10217158 Ga0105246_102171581 207
130 3300013105 Ga0157369_10021841 Ga0157369_100218414 207
131 3300013296 Ga0157374_10031577 Ga0157374_100315777 207
132 3300013306 Ga0163162_10147748 Ga0163162_101477482 207
133 3300017792 Ga0163161_10097921 Ga0163161_100979212 207
134 3300021384 Ga0213876_10191432 Ga0213876_101914322 207
135 3300025321 Ga0207656_10089734 Ga0207656_100897342 207
136 3300025903 Ga0207680_10028084 Ga0207680_100280844 207
137 3300025903 Ga0207680_10036145 Ga0207680_100361454 207
138 3300025909 Ga0207705_10017971 Ga0207705_100179713 207
139 3300025910 Ga0207684_10154942 Ga0207684_101549422 207
140 3300025912 Ga0207707_10303004 Ga0207707_103030042 207
141 3300025913 Ga0207695_10061927 Ga0207695_100619273 207
142 3300025917 Ga0207660_10504893 Ga0207660_105048931 207
143 3300025919 Ga0207657_10004967 Ga0207657_1000496716 207
144 3300025919 Ga0207657_10021283 Ga0207657_100212836 207
145 3300025919 Ga0207657_10029643 Ga0207657_100296437 207
146 3300025920 Ga0207649_10104101 Ga0207649_101041013 207
147 3300025924 Ga0207694_10058505 Ga0207694_100585053 207
148 3300025925 Ga0207650_10102855 Ga0207650_101028552 207
149 3300025926 Ga0207659_10053912 Ga0207659_100539122 207
150 3300025932 Ga0207690_10359820 Ga0207690_103598202 207
151 3300025933 Ga0207706_10007601 Ga0207706_1000760112 207
152 3300025937 Ga0207669_10179572 Ga0207669_101795722 207
153 3300025945 Ga0207679_10012541 Ga0207679_100125412 207
154 3300025945 Ga0207679_10458430 Ga0207679_104584302 207
155 3300025949 Ga0207667_10736243 Ga0207667_107362432 207
156 3300025960 Ga0207651_10009634 Ga0207651_100096347 207
157 3300025960 Ga0207651_10035998 Ga0207651_100359985 207
158 3300025981 Ga0207640_10176992 Ga0207640_101769922 207
159 3300026023 Ga0207677_10163830 Ga0207677_101638302 207
160 3300026041 Ga0207639_10089361 Ga0207639_100893614 207
161 3300026041 Ga0207639_10304358 Ga0207639_103043582 207
162 3300026078 Ga0207702_10361108 Ga0207702_103611082 207
163 3300026116 Ga0207674_10017946 Ga0207674_100179468 207
164 3300026116 Ga0207674_10032542 Ga0207674_100325422 207
165 3300026116 Ga0207674_10363696 Ga0207674_103636962 207
166 3300026121 Ga0207683_10012270 Ga0207683_100122704 207
167 3300028379 Ga0268266_10029186 Ga0268266_100291864 207
168 3300028379 Ga0268266_10091491 Ga0268266_100914914 207
169 3300028380 Ga0268265_10102917 Ga0268265_101029172 207
170 3300028380 Ga0268265_10206928 Ga0268265_102069282 207
171 3300031595 Ga0265313_10060938 Ga0265313_100609382 207
172 3300031616 Ga0307508_10009824 Ga0307508_100098248 207
173 3300031824 Ga0307413_10189267 Ga0307413_101892672 207
174 3300031901 Ga0307406_10275124 Ga0307406_102751242 207
175 3300031901 Ga0307406_10326677 Ga0307406_103266772 207
176 3300031901 Ga0307406_10619667 Ga0307406_106196671 207
177 3300031995 Ga0307409_100200638 Ga0307409_1002006381 207
178 3300031995 Ga0307409_100214984 Ga0307409_1002149843 207
179 3300032002 Ga0307416_100504083 Ga0307416_1005040831 207
180 3300032005 Ga0307411_10021709 Ga0307411_100217094 207
181 3300032126 Ga0307415_100042581 Ga0307415_1000425813 207
182 3300032168 Ga0316593_10001888 Ga0316593_100018886 207
183 3300037312 Ga0395899_0021005 Ga0395899_0021005_1826_2518 207
184 3300037471 Ga0395905_0012333 Ga0395905_0012333_5159_5902 207
185 3300039093 Ga0400489_15423 Ga0400489_15423_1313_2008 207
186 3300042157 Ga0439458_0027101 Ga0439458_0027101_520_1242 207
187 3300042876 Ga0451577_0394670 Ga0451577_0394670_336_1043 207
188 3300046517 Ga0495630_0162751 Ga0495630_0162751_897_1661 207
189 3300046525 Ga0495663_0031852 Ga0495663_0031852_858_1535 207
190 3300048904 Ga0496101_0085324 Ga0496101_0085324_1017_1682 207
191 3300048910 Ga0496107_0031481 Ga0496107_0031481_2135_2836 207
192 3300048911 Ga0496108_0284916 Ga0496108_0284916_726_1391 207
193 3300048911 Ga0496108_0362247 Ga0496108_0362247_287_994 207
194 3300048911 Ga0496108_0739484 Ga0496108_0739484_103_795 207
195 3300049583 Ga0501067_0105775 Ga0501067_0105775_98_763 207
196 3300050509 nmdc:mga0qj67_362651_c1 nmdc:mga0qj67_362651_c1_175_954 207
197 3300050510 nmdc:mga06r32_679946_c1 nmdc:mga06r32_679946_c1_11_790 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06508

QueC

Queuosine biosynthesis protein QueC

7

250

0.96

PF00733

Asn_synthase

Asparagine synthase

6

108

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8228 2 197
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8085 2 197
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.7763 2 197
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.748 2 197
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.737 2 197
ID Description Score Start End Superfamily
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8647 2 196 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8444 2 205 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8366 2 205 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.817 2 196 3.40.50.620
af_P0ADW6_41_234_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.6919 4 48 3.80.30.20
ID Description Score Start End GO Terms
AF-A0A2U1G3G2-F1-model_v4 deleted 0.9878 2 205
AF-A0A1B3N740-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) 0.985 1 205 GO:0005524
GO:0008270
GO:0008616
GO:0016879
AF-A0A5E7ZD32-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) 0.9832 1 205 GO:0005524
GO:0008270
GO:0008616
GO:0016879
AF-N9VYL0-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) 0.9831 2 205 GO:0005524
GO:0008270
GO:0008616
GO:0016879
AF-A0A1D7NHA1-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) 0.9826 1 205 GO:0005524
GO:0008270
GO:0008616
GO:0016879

Feature Viewer

pLDDT pTM Quality
92.27 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map