F303506

General Info

Members Datasets Scaffolds Average Seq Length
197 144 197 131

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0088914|Ga0495686_0088914_202_684
Length 160
Sequence MLLLIDRFVIVRGFIVLLSLVHLKTFKKLFMKSLTKLPFVLIAVMLFAGITATAQNATTNNNSKTTKAPEMKTYVIEREIPGAGKLTAEQLKGISQTSCGVLKEMGPKIQWVHSYVTGNKIYCIYKAENEELVREHAKKGGFPANSVSEVSAVISPATAN

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
123 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
124 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
125 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
126 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
127 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
131 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
132 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
139 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
140 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
141 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
142 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
143 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
144 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 0
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9221356 2162886012 Bacteria 1746
2 JGI25406J46586_10087558 3300003203 Bacteria 944
3 rootH1_10000182 3300003323 Bacteria 80743
4 rootH1_10133550 3300003323 Bacteria 3781
5 Ga0065704_10188009 3300005289 Bacteria 1203
6 Ga0065712_10002810 3300005290 Bacteria 7913
7 Ga0065715_10150132 3300005293 Bacteria 1739
8 Ga0065707_10285407 3300005295 Bacteria 1037
9 Ga0070676_10103618 3300005328 Bacteria 1762
10 Ga0070690_100316768 3300005330 Bacteria 1123
11 Ga0070670_100409535 3300005331 Bacteria 1198
12 Ga0070677_10035925 3300005333 Bacteria 1924
13 Ga0068869_100375982 3300005334 Bacteria 1163
14 Ga0070680_101106925 3300005336 Bacteria 685
15 Ga0068868_100718273 3300005338 Bacteria 895
16 Ga0068868_100977024 3300005338 Unclassified 773
17 Ga0068868_101893261 3300005338 Bacteria 565
18 Ga0070687_100525795 3300005343 Bacteria 801
19 Ga0070668_100928206 3300005347 Bacteria 779
20 Ga0070668_101475139 3300005347 Unclassified 621
21 Ga0070669_100285393 3300005353 Bacteria 1324
22 Ga0070675_100071836 3300005354 Bacteria 2872
23 Ga0070674_101933053 3300005356 Unclassified 536
24 Ga0070673_100503622 3300005364 Bacteria 1095
25 Ga0070673_101444284 3300005364 Unclassified 648
26 Ga0070688_100004030 3300005365 Bacteria 7620
27 Ga0070667_100635474 3300005367 Unclassified 985
28 Ga0070667_100764339 3300005367 Unclassified 896
29 Ga0070700_100020673 3300005441 Unclassified 3818
30 Ga0070694_100358738 3300005444 Bacteria 1131
31 Ga0070663_100392218 3300005455 Unclassified 1133
32 Ga0070678_100066250 3300005456 Bacteria 2685
33 Ga0070678_101891405 3300005456 Bacteria 563
34 Ga0070662_100167008 3300005457 Bacteria 1725
35 Ga0070662_101038206 3300005457 Bacteria 702
36 Ga0068867_100024077 3300005459 Bacteria 4363
37 Ga0070685_10548548 3300005466 Unclassified 825
38 Ga0070698_100566783 3300005471 Bacteria 1075
39 Ga0070684_100653813 3300005535 Bacteria 979
40 Ga0068853_100525489 3300005539 Bacteria 1119
41 Ga0070672_100026390 3300005543 Bacteria 4322
42 Ga0070686_100196086 3300005544 Bacteria 1444
43 Ga0070695_101270727 3300005545 Bacteria 607
44 Ga0070696_100661172 3300005546 Bacteria 848
45 Ga0070665_101014697 3300005548 Unclassified 842
46 Ga0070665_101473623 3300005548 Bacteria 689
47 Ga0070704_100845600 3300005549 Unclassified 820
48 Ga0068857_100162810 3300005577 Bacteria 2025
49 Ga0070702_100799386 3300005615 Bacteria 729
50 Ga0068852_100240632 3300005616 Bacteria 1729
51 Ga0068852_100820444 3300005616 Bacteria 945
52 Ga0068859_100165203 3300005617 Bacteria 2293
53 Ga0068859_102107814 3300005617 Bacteria 622
54 Ga0068864_100910828 3300005618 Bacteria 869
55 Ga0068864_101567452 3300005618 Bacteria 662
56 Ga0068864_101788517 3300005618 Bacteria 620
57 Ga0068866_10330330 3300005718 Bacteria 962
58 Ga0068866_10484705 3300005718 Bacteria 815
59 Ga0068861_100483943 3300005719 Bacteria 1115
60 Ga0068861_100549645 3300005719 Bacteria 1052
61 Ga0068861_100739490 3300005719 Bacteria 918
62 Ga0068870_10045901 3300005840 Bacteria 2289
63 Ga0068870_10126635 3300005840 Bacteria 1478
64 Ga0068863_101779391 3300005841 Unclassified 626
65 Ga0068860_100109659 3300005843 Unclassified 2638
66 Ga0068860_100116861 3300005843 Unclassified 2552
67 Ga0068862_100072724 3300005844 Unclassified 2971
68 Ga0081539_10008031 3300005985 Bacteria 9351
69 Ga0075366_10070445 3300006195 Bacteria 2082
70 Ga0097621_100200856 3300006237 Bacteria 1731
71 Ga0097621_100287806 3300006237 Bacteria 1448
72 Ga0068871_100153233 3300006358 Bacteria 1967
73 Ga0068871_100617311 3300006358 Bacteria 987
74 Ga0075428_100630061 3300006844 Bacteria 1144
75 Ga0075428_101176485 3300006844 Bacteria 809
76 Ga0075430_100333803 3300006846 Unclassified 1252
77 Ga0075434_100017334 3300006871 Bacteria 6936
78 Ga0068865_100335839 3300006881 Unclassified 1220
79 Ga0068865_100744582 3300006881 Bacteria 841
80 Ga0097620_100165184 3300006931 Bacteria 2293
81 Ga0097620_102108786 3300006931 Bacteria 622
82 Ga0111539_10013676 3300009094 Bacteria 10139
83 Ga0111539_10022942 3300009094 Bacteria 7662
84 Ga0111539_10601010 3300009094 Bacteria 1281
85 Ga0105243_10297389 3300009148 Bacteria 1461
86 Ga0105243_11282753 3300009148 Unclassified 749
87 Ga0105242_10698270 3300009176 Bacteria 992
88 Ga0105242_12446274 3300009176 Bacteria 570
89 Ga0105237_11116823 3300009545 Bacteria 795
90 Ga0105238_10523676 3300009551 Bacteria 1188
91 Ga0105249_10161113 3300009553 Bacteria 2168
92 Ga0105246_11502541 3300011119 Bacteria 633
93 Ga0157374_10819326 3300013296 Bacteria 947
94 Ga0157378_11236710 3300013297 Bacteria 787
95 Ga0163162_10318682 3300013306 Bacteria 1687
96 Ga0163162_11703895 3300013306 Bacteria 720
97 Ga0163162_12591062 3300013306 Bacteria 583
98 Ga0157372_10452437 3300013307 Bacteria 1496
99 Ga0157375_10031820 3300013308 Bacteria 4996
100 Ga0157375_10200108 3300013308 Bacteria 2153
101 Ga0157375_12503113 3300013308 Bacteria 616
102 Ga0157380_10029515 3300014326 Bacteria 4191
103 Ga0157380_10161688 3300014326 Bacteria 1947
104 Ga0157380_10562020 3300014326 Bacteria 1121
105 Ga0157377_10199451 3300014745 Bacteria 1269
106 Ga0157376_10732095 3300014969 Bacteria 997
107 Ga0207697_10021197 3300025315 Bacteria 2662
108 Ga0207656_10313783 3300025321 Bacteria 778
109 Ga0207682_10123753 3300025893 Bacteria 1149
110 Ga0207682_10405003 3300025893 Bacteria 645
111 Ga0207645_10116140 3300025907 Bacteria 1735
112 Ga0207643_10055267 3300025908 Bacteria 2258
113 Ga0207671_10716593 3300025914 Bacteria 795
114 Ga0207681_10317022 3300025923 Bacteria 1238
115 Ga0207694_10420348 3300025924 Bacteria 1113
116 Ga0207650_10064657 3300025925 Bacteria 2739
117 Ga0207650_10393957 3300025925 Bacteria 1145
118 Ga0207659_10931136 3300025926 Bacteria 747
119 Ga0207644_10939385 3300025931 Bacteria 725
120 Ga0207706_10202219 3300025933 Bacteria 1742
121 Ga0207691_10075625 3300025940 Bacteria 3036
122 Ga0207691_10397662 3300025940 Bacteria 1175
123 Ga0207689_10382373 3300025942 Bacteria 1172
124 Ga0207689_10963258 3300025942 Bacteria 720
125 Ga0207679_10810345 3300025945 Unclassified 854
126 Ga0207679_11247772 3300025945 Unclassified 682
127 Ga0207667_10176765 3300025949 Bacteria 2193
128 Ga0207712_10830516 3300025961 Unclassified 814
129 Ga0207677_10503055 3300026023 Unclassified 1048
130 Ga0207639_11037569 3300026041 Unclassified 768
131 Ga0207708_10592552 3300026075 Bacteria 938
132 Ga0207641_10467747 3300026088 Bacteria 1221
133 Ga0207648_10063388 3300026089 Unclassified 3222
134 Ga0207648_10942612 3300026089 Unclassified 807
135 Ga0207676_10370691 3300026095 Bacteria 1330
136 Ga0207676_10961011 3300026095 Unclassified 840
137 Ga0207676_11243327 3300026095 Bacteria 739
138 Ga0207674_10111370 3300026116 Unclassified 2711
139 Ga0207674_11698641 3300026116 Bacteria 599
140 Ga0207675_100003498 3300026118 Bacteria 15327
141 Ga0207675_100165573 3300026118 Bacteria 2111
142 Ga0207675_100749715 3300026118 Bacteria 988
143 Ga0207683_10015879 3300026121 Bacteria 6412
144 Ga0209999_1109137 3300027543 Bacteria 541
145 Ga0207428_10187983 3300027907 Bacteria 1558
146 Ga0268266_11252546 3300028379 Unclassified 717
147 Ga0268265_10007100 3300028380 Bacteria 7564
148 Ga0268265_10163884 3300028380 Bacteria 1892
149 Ga0268264_10175661 3300028381 Bacteria 1941
150 Ga0268264_11544613 3300028381 Unclassified 674
151 Ga0307513_10054381 3300031456 Bacteria 4293
152 Ga0307509_10145517 3300031507 Bacteria 2297
153 Ga0307408_101458259 3300031548 Bacteria 646
154 Ga0307407_10495054 3300031903 Bacteria 895
155 Ga0307416_100971820 3300032002 Bacteria 952
156 Ga0307411_11717465 3300032005 Bacteria 581
157 Ga0395900_0042853 3300037418 Bacteria 4663
158 Ga0395905_0022343 3300037471 Bacteria 5984
159 Ga0436365_1519288 3300039437 Bacteria 1220
160 Ga0466972_0066617 3300044658 Bacteria 1721
161 Ga0466967_1597559 3300045976 Bacteria 649
162 Ga0495638_0285124 3300046460 Bacteria 896
163 Ga0495672_0012623 3300047320 Bacteria 5880
164 Ga0495686_0088914 3300047472 Bacteria 1877
165 Ga0495686_0090185 3300047472 Bacteria 1862
166 Ga0501296_004700 3300049519 Bacteria 1499
167 Ga0501047_0030842 3300049581 Bacteria 5168
168 Ga0501047_0135007 3300049581 Bacteria 2348
169 Ga0501073_0392327 3300049589 Unclassified 959
170 Ga0501198_011826 3300049649 Bacteria 1306
171 Ga0501199_058004 3300049650 Unclassified 535
172 Ga0501202_050140 3300049652 Bacteria 923
173 Ga0501240_004480 3300049673 Bacteria 1623
174 Ga0501250_000290 3300049680 Bacteria 3143
175 Ga0501252_000667 3300049682 Bacteria 2772
176 Ga0501257_002662 3300049686 Bacteria 3771
177 Ga0501257_005876 3300049686 Bacteria 2715
178 Ga0501225_0229675 3300049705 Bacteria 601
179 Ga0501245_002785 3300049708 Bacteria 2348
180 Ga0501268_001682 3300049765 Bacteria 2803
181 Ga0501280_039397 3300049776 Bacteria 762
182 Ga0501044_0147347 3300049823 Bacteria 2338
183 Ga0501212_042317 3300049851 Bacteria 756
184 nmdc:mga0k408_197557_c1 3300050493 Bacteria 1200
185 nmdc:mga0k408_271418_c1 3300050493 Bacteria 1013
186 nmdc:mga08y16_102406_c1 3300050511 Bacteria 2981
187 nmdc:mga08y16_1123704_c1 3300050511 Bacteria 760
188 nmdc:mga08y16_35060_c1 3300050511 Bacteria 5271
189 nmdc:mga0n895_167941_c1 3300050512 Unclassified 2226
190 Ga0500566_0454014 3300053094 Bacteria 561
191 Ga0500554_190698 3300053102 Bacteria 687
192 Ga0500658_0180471 3300053134 Unclassified 961
193 Ga0500622_0103094 3300053156 Unclassified 1402
194 Ga0500570_166665 3300053724 Unclassified 745
195 Ga0500611_000037 3300053727 Bacteria 72513
196 Ga0500611_029286 3300053727 Bacteria 1126
197 Ga0500587_017733 3300053739 Bacteria 914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_12591062 Ga0163162_125910621 111
2 3300026118 Ga0207675_100165573 Ga0207675_1001655732 121
3 3300005841 Ga0068863_101779391 Ga0068863_1017793911 123
4 3300005535 Ga0070684_100653813 Ga0070684_1006538132 127
5 3300005616 Ga0068852_100240632 Ga0068852_1002406322 127
6 3300006844 Ga0075428_100630061 Ga0075428_1006300612 127
7 3300005456 Ga0070678_101891405 Ga0070678_1018914052 128
8 3300005548 Ga0070665_101473623 Ga0070665_1014736232 128
9 3300005615 Ga0070702_100799386 Ga0070702_1007993861 128
10 3300005616 Ga0068852_100820444 Ga0068852_1008204443 128
11 3300005718 Ga0068866_10330330 Ga0068866_103303301 128
12 3300005719 Ga0068861_100739490 Ga0068861_1007394903 128
13 3300006237 Ga0097621_100200856 Ga0097621_1002008562 128
14 3300006358 Ga0068871_100153233 Ga0068871_1001532333 128
15 3300006846 Ga0075430_100333803 Ga0075430_1003338032 128
16 3300009094 Ga0111539_10013676 Ga0111539_100136767 128
17 3300009176 Ga0105242_12446274 Ga0105242_124462742 128
18 3300009545 Ga0105237_11116823 Ga0105237_111168232 128
19 3300011119 Ga0105246_11502541 Ga0105246_115025411 128
20 3300013296 Ga0157374_10819326 Ga0157374_108193262 128
21 3300013306 Ga0163162_10318682 Ga0163162_103186822 128
22 3300013308 Ga0157375_10200108 Ga0157375_102001082 128
23 3300014326 Ga0157380_10161688 Ga0157380_101616882 128
24 3300014969 Ga0157376_10732095 Ga0157376_107320951 128
25 3300025321 Ga0207656_10313783 Ga0207656_103137832 128
26 3300025914 Ga0207671_10716593 Ga0207671_107165932 128
27 3300025926 Ga0207659_10931136 Ga0207659_109311361 128
28 3300025940 Ga0207691_10397662 Ga0207691_103976622 128
29 3300025942 Ga0207689_10963258 Ga0207689_109632581 128
30 3300026041 Ga0207639_11037569 Ga0207639_110375691 128
31 3300026116 Ga0207674_11698641 Ga0207674_116986411 128
32 3300026118 Ga0207675_100749715 Ga0207675_1007497151 128
33 3300027907 Ga0207428_10187983 Ga0207428_101879832 128
34 3300031507 Ga0307509_10145517 Ga0307509_101455171 128
35 3300032005 Ga0307411_11717465 Ga0307411_117174652 128
36 3300037418 Ga0395900_0042853 Ga0395900_0042853_3216_3602 128
37 3300037471 Ga0395905_0022343 Ga0395905_0022343_2888_3274 128
38 3300045976 Ga0466967_1597559 Ga0466967_1597559_162_551 128
39 3300049519 Ga0501296_004700 Ga0501296_004700_348_734 128
40 3300049581 Ga0501047_0135007 Ga0501047_0135007_322_711 128
41 3300049589 Ga0501073_0392327 Ga0501073_0392327_56_517 128
42 3300049649 Ga0501198_011826 Ga0501198_011826_826_1212 128
43 3300049652 Ga0501202_050140 Ga0501202_050140_213_599 128
44 3300049673 Ga0501240_004480 Ga0501240_004480_19_405 128
45 3300049680 Ga0501250_000290 Ga0501250_000290_1231_1617 128
46 3300049682 Ga0501252_000667 Ga0501252_000667_1932_2318 128
47 3300049686 Ga0501257_002662 Ga0501257_002662_121_507 128
48 3300049705 Ga0501225_0229675 Ga0501225_0229675_181_567 128
49 3300049708 Ga0501245_002785 Ga0501245_002785_694_1080 128
50 3300049765 Ga0501268_001682 Ga0501268_001682_563_949 128
51 3300049776 Ga0501280_039397 Ga0501280_039397_366_752 128
52 3300049823 Ga0501044_0147347 Ga0501044_0147347_1159_1548 128
53 3300049851 Ga0501212_042317 Ga0501212_042317_191_577 128
54 3300053739 Ga0500587_017733 Ga0500587_017733_339_734 128
55 3300003203 JGI25406J46586_10087558 JGI25406J46586_100875581 129
56 3300005338 Ga0068868_100718273 Ga0068868_1007182732 129
57 3300005338 Ga0068868_101893261 Ga0068868_1018932611 129
58 3300005347 Ga0070668_100928206 Ga0070668_1009282061 129
59 3300005356 Ga0070674_101933053 Ga0070674_1019330531 129
60 3300005367 Ga0070667_100635474 Ga0070667_1006354741 129
61 3300005367 Ga0070667_100764339 Ga0070667_1007643391 129
62 3300005455 Ga0070663_100392218 Ga0070663_1003922182 129
63 3300005456 Ga0070678_100066250 Ga0070678_1000662503 129
64 3300005471 Ga0070698_100566783 Ga0070698_1005667832 129
65 3300005546 Ga0070696_100661172 Ga0070696_1006611722 129
66 3300005548 Ga0070665_101014697 Ga0070665_1010146972 129
67 3300005617 Ga0068859_102107814 Ga0068859_1021078141 129
68 3300005618 Ga0068864_101567452 Ga0068864_1015674521 129
69 3300005719 Ga0068861_100549645 Ga0068861_1005496452 129
70 3300005985 Ga0081539_10008031 Ga0081539_100080312 129
71 3300006195 Ga0075366_10070445 Ga0075366_100704453 129
72 3300006237 Ga0097621_100287806 Ga0097621_1002878062 129
73 3300006358 Ga0068871_100617311 Ga0068871_1006173112 129
74 3300006871 Ga0075434_100017334 Ga0075434_1000173348 129
75 3300006931 Ga0097620_102108786 Ga0097620_1021087861 129
76 3300009094 Ga0111539_10601010 Ga0111539_106010101 129
77 3300009148 Ga0105243_10297389 Ga0105243_102973892 129
78 3300009176 Ga0105242_10698270 Ga0105242_106982701 129
79 3300009551 Ga0105238_10523676 Ga0105238_105236762 129
80 3300013307 Ga0157372_10452437 Ga0157372_104524372 129
81 3300013308 Ga0157375_12503113 Ga0157375_125031131 129
82 3300014326 Ga0157380_10562020 Ga0157380_105620201 129
83 3300025893 Ga0207682_10405003 Ga0207682_104050032 129
84 3300025924 Ga0207694_10420348 Ga0207694_104203482 129
85 3300025925 Ga0207650_10064657 Ga0207650_100646573 129
86 3300025931 Ga0207644_10939385 Ga0207644_109393852 129
87 3300025945 Ga0207679_10810345 Ga0207679_108103452 129
88 3300025949 Ga0207667_10176765 Ga0207667_101767653 129
89 3300026095 Ga0207676_10370691 Ga0207676_103706911 129
90 3300026121 Ga0207683_10015879 Ga0207683_100158797 129
91 3300027543 Ga0209999_1109137 Ga0209999_11091371 129
92 3300028379 Ga0268266_11252546 Ga0268266_112525461 129
93 3300028380 Ga0268265_10163884 Ga0268265_101638841 129
94 3300039437 Ga0436365_1519288 Ga0436365_1519288_103_495 129
95 3300044658 Ga0466972_0066617 Ga0466972_0066617_261_692 129
96 3300046460 Ga0495638_0285124 Ga0495638_0285124_55_444 129
97 3300047320 Ga0495672_0012623 Ga0495672_0012623_4864_5256 129
98 3300047472 Ga0495686_0088914 Ga0495686_0088914_202_684 129
99 3300047472 Ga0495686_0090185 Ga0495686_0090185_1352_1825 129
100 3300049581 Ga0501047_0030842 Ga0501047_0030842_163_576 129
101 3300049650 Ga0501199_058004 Ga0501199_058004_128_523 129
102 3300049686 Ga0501257_005876 Ga0501257_005876_1948_2343 129
103 3300050493 nmdc:mga0k408_197557_c1 nmdc:mga0k408_197557_c1_118_513 129
104 3300050493 nmdc:mga0k408_271418_c1 nmdc:mga0k408_271418_c1_233_625 129
105 3300050511 nmdc:mga08y16_1123704_c1 nmdc:mga08y16_1123704_c1_46_462 129
106 3300050511 nmdc:mga08y16_35060_c1 nmdc:mga08y16_35060_c1_4500_4910 129
107 3300050512 nmdc:mga0n895_167941_c1 nmdc:mga0n895_167941_c1_1026_1418 129
108 3300053094 Ga0500566_0454014 Ga0500566_0454014_11_442 129
109 3300053102 Ga0500554_190698 Ga0500554_190698_17_448 129
110 3300053727 Ga0500611_000037 Ga0500611_000037_31996_32385 129
111 2162886012 MBSR1b_contig_9221356 MBSR1b_0053.00000970 130
112 3300003323 rootH1_10000182 rootH1_1000018237 130
113 3300003323 rootH1_10133550 rootH1_101335505 130
114 3300005289 Ga0065704_10188009 Ga0065704_101880092 130
115 3300005290 Ga0065712_10002810 Ga0065712_100028101 130
116 3300005293 Ga0065715_10150132 Ga0065715_101501321 130
117 3300005295 Ga0065707_10285407 Ga0065707_102854073 130
118 3300005328 Ga0070676_10103618 Ga0070676_101036181 130
119 3300005330 Ga0070690_100316768 Ga0070690_1003167683 130
120 3300005331 Ga0070670_100409535 Ga0070670_1004095351 130
121 3300005333 Ga0070677_10035925 Ga0070677_100359251 130
122 3300005334 Ga0068869_100375982 Ga0068869_1003759821 130
123 3300005336 Ga0070680_101106925 Ga0070680_1011069251 130
124 3300005338 Ga0068868_100977024 Ga0068868_1009770241 130
125 3300005343 Ga0070687_100525795 Ga0070687_1005257951 130
126 3300005347 Ga0070668_101475139 Ga0070668_1014751391 130
127 3300005353 Ga0070669_100285393 Ga0070669_1002853931 130
128 3300005354 Ga0070675_100071836 Ga0070675_1000718362 130
129 3300005364 Ga0070673_100503622 Ga0070673_1005036222 130
130 3300005364 Ga0070673_101444284 Ga0070673_1014442841 130
131 3300005365 Ga0070688_100004030 Ga0070688_1000040306 130
132 3300005441 Ga0070700_100020673 Ga0070700_1000206734 130
133 3300005444 Ga0070694_100358738 Ga0070694_1003587383 130
134 3300005457 Ga0070662_100167008 Ga0070662_1001670081 130
135 3300005457 Ga0070662_101038206 Ga0070662_1010382061 130
136 3300005459 Ga0068867_100024077 Ga0068867_1000240774 130
137 3300005466 Ga0070685_10548548 Ga0070685_105485481 130
138 3300005539 Ga0068853_100525489 Ga0068853_1005254892 130
139 3300005543 Ga0070672_100026390 Ga0070672_1000263901 130
140 3300005544 Ga0070686_100196086 Ga0070686_1001960862 130
141 3300005545 Ga0070695_101270727 Ga0070695_1012707272 130
142 3300005549 Ga0070704_100845600 Ga0070704_1008456002 130
143 3300005577 Ga0068857_100162810 Ga0068857_1001628104 130
144 3300005617 Ga0068859_100165203 Ga0068859_1001652034 130
145 3300005618 Ga0068864_100910828 Ga0068864_1009108283 130
146 3300005618 Ga0068864_101788517 Ga0068864_1017885171 130
147 3300005718 Ga0068866_10484705 Ga0068866_104847051 130
148 3300005719 Ga0068861_100483943 Ga0068861_1004839433 130
149 3300005840 Ga0068870_10045901 Ga0068870_100459014 130
150 3300005840 Ga0068870_10126635 Ga0068870_101266352 130
151 3300005843 Ga0068860_100109659 Ga0068860_1001096592 130
152 3300005843 Ga0068860_100116861 Ga0068860_1001168612 130
153 3300005844 Ga0068862_100072724 Ga0068862_1000727244 130
154 3300006844 Ga0075428_101176485 Ga0075428_1011764852 130
155 3300006881 Ga0068865_100335839 Ga0068865_1003358392 130
156 3300006881 Ga0068865_100744582 Ga0068865_1007445821 130
157 3300006931 Ga0097620_100165184 Ga0097620_1001651844 130
158 3300009094 Ga0111539_10022942 Ga0111539_100229426 130
159 3300009148 Ga0105243_11282753 Ga0105243_112827532 130
160 3300009553 Ga0105249_10161113 Ga0105249_101611131 130
161 3300013297 Ga0157378_11236710 Ga0157378_112367102 130
162 3300013306 Ga0163162_11703895 Ga0163162_117038951 130
163 3300013308 Ga0157375_10031820 Ga0157375_100318205 130
164 3300014326 Ga0157380_10029515 Ga0157380_100295152 130
165 3300014745 Ga0157377_10199451 Ga0157377_101994513 130
166 3300025315 Ga0207697_10021197 Ga0207697_100211971 130
167 3300025893 Ga0207682_10123753 Ga0207682_101237531 130
168 3300025907 Ga0207645_10116140 Ga0207645_101161403 130
169 3300025908 Ga0207643_10055267 Ga0207643_100552671 130
170 3300025923 Ga0207681_10317022 Ga0207681_103170223 130
171 3300025925 Ga0207650_10393957 Ga0207650_103939573 130
172 3300025933 Ga0207706_10202219 Ga0207706_102022192 130
173 3300025940 Ga0207691_10075625 Ga0207691_100756254 130
174 3300025942 Ga0207689_10382373 Ga0207689_103823731 130
175 3300025945 Ga0207679_11247772 Ga0207679_112477721 130
176 3300025961 Ga0207712_10830516 Ga0207712_108305162 130
177 3300026023 Ga0207677_10503055 Ga0207677_105030552 130
178 3300026075 Ga0207708_10592552 Ga0207708_105925522 130
179 3300026088 Ga0207641_10467747 Ga0207641_104677472 130
180 3300026089 Ga0207648_10063388 Ga0207648_100633881 130
181 3300026089 Ga0207648_10942612 Ga0207648_109426122 130
182 3300026095 Ga0207676_10961011 Ga0207676_109610112 130
183 3300026095 Ga0207676_11243327 Ga0207676_112433271 130
184 3300026116 Ga0207674_10111370 Ga0207674_101113701 130
185 3300026118 Ga0207675_100003498 Ga0207675_1000034981 130
186 3300028380 Ga0268265_10007100 Ga0268265_100071001 130
187 3300028381 Ga0268264_10175661 Ga0268264_101756612 130
188 3300028381 Ga0268264_11544613 Ga0268264_115446131 130
189 3300031456 Ga0307513_10054381 Ga0307513_100543814 130
190 3300031548 Ga0307408_101458259 Ga0307408_1014582591 130
191 3300031903 Ga0307407_10495054 Ga0307407_104950541 130
192 3300032002 Ga0307416_100971820 Ga0307416_1009718202 130
193 3300050511 nmdc:mga08y16_102406_c1 nmdc:mga08y16_102406_c1_253_645 130
194 3300053134 Ga0500658_0180471 Ga0500658_0180471_38_436 130
195 3300053156 Ga0500622_0103094 Ga0500622_0103094_813_1211 130
196 3300053724 Ga0500570_166665 Ga0500570_166665_251_649 130
197 3300053727 Ga0500611_029286 Ga0500611_029286_138_536 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

74

150

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8538 42 123
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8348 42 123
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.6845 76 96
3k7r-assembly2.cif.gz_D crystal structure of [tm][cuatx1]3 0.6655 40 119
3t2g-assembly1.cif.gz_A fructose-1,6-bisphosphate aldolase/phosphatase from thermoproteus neutrophilus, y229f variant with dhap 0.6604 40 109
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8438 43 123 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8249 43 123 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8125 39 119 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7779 39 119 3.30.70.3090
af_P36646_1_51_3.10.20.10 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.7577 39 122 3.10.20.10
ID Description Score Start End GO Terms
AF-A0A530QG42-F1-model_v4 DUF4242 domain-containing protein 0.9647 40 121
AF-A0A4V3UYL4-F1-model_v4 DUF4242 domain-containing protein 0.9635 40 124
AF-A0A286C6H2-F1-model_v4 DUF4242 domain-containing protein 0.9606 40 119
AF-A0A530QG42-F1-model_v4 DUF4242 domain-containing protein 0.9535 40 121
AF-A0A424PBW3-F1-model_v4 DUF4242 domain-containing protein 0.9494 40 124

Feature Viewer

pLDDT pTM Quality
79.31 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map