F303201

General Info

Members Datasets Scaffolds Average Seq Length
197 113 394 347

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10040443|Ga0265324_100404432
Length 398
Sequence MEGQISGYRQYGHNQDNKNFFAHKSIIIFLSLDSQRCLEVQYIYMIVAVIILGVLCLALVGFVFWTLAKPKKTDSDATMLLKTDMGELTKAMGQLQQGLQKQLTDQLGTSNKQMTAQFQASAKIIRDVTEKLTELDRTNKSVGDVAAELKTLQNVLQNPKQRGVLGEYYLEQILKNTLPPGSFELQYKLAEGMVVDAVVKLDERLLPIDSKFSLENYNRLLEAKTEDKPALERAFKEDLKRRIDETSKYIKTNKGTLDQALMFIPSEAIYYDLLANKVGLAGVSGRNLMQYAAVDKKVTIVGPSTLSAMLQIIVQGLRSIEIQKDTDKIRKNIEQLSKHLLAHNGYMQKLGNSLGTTVGHFNVTYKELGKIDKDVVKIADTSVVVEPMVLDKPSLDED

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
54 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
55 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
58 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
59 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
63 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
64 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
65 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
66 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
67 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
80 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
81 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
82 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
83 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
84 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
85 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
86 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
104 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
105 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
106 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
107 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
108 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
109 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
110 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
111 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
113 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.74
Nodule 0
Rhizoplane 0
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10040443 3300029957 Bacteria 1614
2 JGI24737J22298_10000038 3300001990 Bacteria 37913
3 JGI24742J22300_10000006 3300002244 Bacteria 41202
4 rootH2_10006847 3300003320 Bacteria 155484
5 rootH1_10202562 3300003323 Bacteria 3603
6 Ga0070658_10000015 3300005327 Bacteria 230579
7 Ga0070658_10001477 3300005327 Bacteria 19990
8 Ga0070658_10006133 3300005327 Bacteria 9748
9 Ga0070658_10203966 3300005327 Bacteria 1669
10 Ga0070680_100001168 3300005336 Bacteria 18869
11 Ga0070680_100011478 3300005336 Bacteria 6855
12 Ga0070660_100000078 3300005339 Bacteria 58990
13 Ga0070660_100000224 3300005339 Bacteria 37460
14 Ga0070660_100005047 3300005339 Bacteria 9118
15 Ga0070708_100158654 3300005445 Unclassified 2107
16 Ga0070681_10111949 3300005458 Bacteria 2669
17 Ga0070681_10226686 3300005458 Bacteria 1783
18 Ga0070679_100000876 3300005530 Bacteria 26140
19 Ga0070679_100014762 3300005530 Bacteria 7506
20 Ga0070679_100027157 3300005530 Bacteria 5630
21 Ga0068853_100084959 3300005539 Bacteria 2774
22 Ga0068855_100000002 3300005563 Bacteria 616881
23 Ga0068855_100001288 3300005563 Bacteria 31095
24 Ga0068855_100054770 3300005563 Bacteria 4687
25 Ga0068856_100000001 3300005614 Bacteria 565602
26 Ga0068852_100000001 3300005616 Bacteria 716526
27 Ga0068860_100064909 3300005843 Bacteria 3467
28 Ga0068862_100189416 3300005844 Bacteria 1850
29 Ga0075365_10022229 3300006038 Unclassified 3971
30 Ga0075365_10054023 3300006038 Bacteria 2662
31 Ga0075368_10000003 3300006042 Bacteria 56143
32 Ga0075368_10000235 3300006042 Bacteria 15544
33 Ga0075363_100013728 3300006048 Bacteria 3938
34 Ga0075364_10001012 3300006051 Bacteria 14896
35 Ga0075364_10003417 3300006051 Bacteria 9026
36 Ga0075364_10086039 3300006051 Bacteria 2082
37 Ga0075367_10004670 3300006178 Bacteria 6721
38 Ga0075366_10008375 3300006195 Bacteria 5745
39 Ga0075370_10006549 3300006353 Bacteria 5865
40 Ga0105240_10012742 3300009093 Bacteria 11588
41 Ga0105240_10449100 3300009093 Unclassified 1443
42 Ga0105245_10000001 3300009098 Bacteria 939270
43 Ga0105245_10035983 3300009098 Unclassified 4396
44 Ga0105241_10011744 3300009174 Bacteria 6431
45 Ga0105241_10089578 3300009174 Bacteria 2424
46 Ga0105241_10334072 3300009174 Bacteria 1311
47 Ga0105242_10288006 3300009176 Bacteria 1494
48 Ga0105237_10000002 3300009545 Bacteria 702357
49 Ga0105032_100001 3300009979 Bacteria 472394
50 Ga0105032_100018 3300009979 Bacteria 47684
51 Ga0105239_10068714 3300010375 Bacteria 3893
52 Ga0105239_10081328 3300010375 Unclassified 3565
53 Ga0105239_10147408 3300010375 Bacteria 2626
54 Ga0105239_10713067 3300010375 Unclassified 1147
55 Ga0157371_10026825 3300013102 Bacteria 4184
56 Ga0157370_10210744 3300013104 Unclassified 1801
57 Ga0157369_10000063 3300013105 Bacteria 147327
58 Ga0157369_10000413 3300013105 Bacteria 56589
59 Ga0157369_10001676 3300013105 Bacteria 27019
60 Ga0157369_10034395 3300013105 Bacteria 5562
61 Ga0157369_10059964 3300013105 Bacteria 4103
62 Ga0157372_10000086 3300013307 Bacteria 96247
63 Ga0207705_10000011 3300025909 Bacteria 517768
64 Ga0207705_10000327 3300025909 Bacteria 43259
65 Ga0207705_10169560 3300025909 Bacteria 1643
66 Ga0207654_10210557 3300025911 Bacteria 1284
67 Ga0207707_10054049 3300025912 Bacteria 3496
68 Ga0207695_10010095 3300025913 Bacteria 11595
69 Ga0207671_10000008 3300025914 Bacteria 798229
70 Ga0207660_10003394 3300025917 Bacteria 10381
71 Ga0207660_10007290 3300025917 Bacteria 7156
72 Ga0207660_10009609 3300025917 Bacteria 6262
73 Ga0207657_10000741 3300025919 Bacteria 34635
74 Ga0207652_10000906 3300025921 Bacteria 28011
75 Ga0207652_10026458 3300025921 Bacteria 4833
76 Ga0207652_10124950 3300025921 Bacteria 2291
77 Ga0207687_10000030 3300025927 Bacteria 155548
78 Ga0207687_10108178 3300025927 Bacteria 2058
79 Ga0207644_10397699 3300025931 Bacteria 1126
80 Ga0207667_10000005 3300025949 Bacteria 715503
81 Ga0207667_10002118 3300025949 Bacteria 24862
82 Ga0207667_10017182 3300025949 Bacteria 8155
83 Ga0207667_10051256 3300025949 Bacteria 4352
84 Ga0207668_10121438 3300025972 Bacteria 1979
85 Ga0207640_10020015 3300025981 Unclassified 3966
86 Ga0207639_10002495 3300026041 Bacteria 12331
87 Ga0207702_10000001 3300026078 Bacteria 895738
88 Ga0207698_10000001 3300026142 Bacteria 625389
89 Ga0209813_10000376 3300027866 Bacteria 11191
90 Ga0265337_1000201 3300028556 Bacteria 31796
91 Ga0265337_1000384 3300028556 Bacteria 23747
92 Ga0265337_1000836 3300028556 Bacteria 16153
93 Ga0265337_1001196 3300028556 Bacteria 13197
94 Ga0265337_1011821 3300028556 Archaea 2994
95 Ga0265326_10003852 3300028558 Bacteria 4881
96 Ga0265326_10004494 3300028558 Bacteria 4464
97 Ga0265326_10006543 3300028558 Unclassified 3611
98 Ga0265326_10017683 3300028558 Bacteria 2055
99 Ga0265319_1061087 3300028563 Unclassified 1222
100 Ga0265334_10000049 3300028573 Bacteria 89091
101 Ga0265334_10010504 3300028573 Archaea 3909
102 Ga0265334_10033563 3300028573 Unclassified 2041
103 Ga0265334_10040610 3300028573 Bacteria 1821
104 Ga0265318_10041127 3300028577 Unclassified 1758
105 Ga0265323_10012352 3300028653 Bacteria 3425
106 Ga0265322_10000664 3300028654 Bacteria 12851
107 Ga0265336_10000047 3300028666 Bacteria 123576
108 Ga0265336_10004552 3300028666 Bacteria 5223
109 Ga0265336_10005232 3300028666 Bacteria 4810
110 Ga0265338_10000003 3300028800 Bacteria 733923
111 Ga0265338_10000039 3300028800 Bacteria 236135
112 Ga0265338_10000052 3300028800 Bacteria 209239
113 Ga0265338_10000178 3300028800 Bacteria 118345
114 Ga0265338_10000482 3300028800 Bacteria 71209
115 Ga0265338_10002389 3300028800 Bacteria 28280
116 Ga0265338_10007578 3300028800 Bacteria 13408
117 Ga0265338_10011019 3300028800 Bacteria 10499
118 Ga0265338_10014879 3300028800 Bacteria 8604
119 Ga0265338_10025409 3300028800 Bacteria 6009
120 Ga0265338_10043492 3300028800 Unclassified 4165
121 Ga0265338_10044563 3300028800 Bacteria 4094
122 Ga0265338_10072539 3300028800 Bacteria 2939
123 Ga0265338_10084668 3300028800 Bacteria 2646
124 Ga0265338_10114389 3300028800 Bacteria 2165
125 Ga0265338_10123826 3300028800 Unclassified 2055
126 Ga0265338_10230038 3300028800 Bacteria 1379
127 Ga0265324_10011819 3300029957 Unclassified 3315
128 Ga0314311_1133365 3300030733 Bacteria 2009
129 Ga0316179_1019830 3300030734 Bacteria 16972
130 Ga0316180_1183837 3300030736 Bacteria 7968
131 Ga0316183_1010742 3300030742 Bacteria 8052
132 Ga0316183_1073503 3300030742 Bacteria 19331
133 Ga0316181_1138937 3300030744 Bacteria 58229
134 Ga0316182_1009688 3300030745 Bacteria 39463
135 Ga0316182_1059726 3300030745 Bacteria 44312
136 Ga0316182_1328432 3300030745 Bacteria 3177
137 Ga0265330_10016161 3300031235 Archaea 3446
138 Ga0265332_10003459 3300031238 Bacteria 7605
139 Ga0265320_10085358 3300031240 Bacteria 1469
140 Ga0265325_10012748 3300031241 Bacteria 4798
141 Ga0265339_10041298 3300031249 Bacteria 2561
142 Ga0265327_10000017 3300031251 Bacteria 445264
143 Ga0265327_10008115 3300031251 Bacteria 7903
144 Ga0265327_10019292 3300031251 Unclassified 4197
145 Ga0265327_10026554 3300031251 Archaea 3350
146 Ga0265316_10017324 3300031344 Bacteria 6233
147 Ga0265316_10029504 3300031344 Unclassified 4509
148 Ga0265313_10003356 3300031595 Bacteria 13050
149 Ga0265313_10063118 3300031595 Unclassified 1728
150 Ga0265314_10144382 3300031711 Bacteria 1467
151 Ga0395900_0000232 3300037418 Bacteria 87268
152 Ga0395900_0014764 3300037418 Bacteria 7961
153 Ga0395898_0002945 3300037466 Bacteria 19369
154 Ga0439438_005305 3300041405 Bacteria 4768
155 Ga0439461_0001504 3300041410 Bacteria 3613
156 Ga0439442_007179 3300042002 Bacteria 2240
157 Ga0439445_0000935 3300042004 Bacteria 6203
158 Ga0439432_000814 3300042006 Bacteria 11629
159 Ga0450906_000842 3300042145 Bacteria 6761
160 Ga0439446_0000001 3300042156 Bacteria 275840
161 Ga0439446_0001960 3300042156 Bacteria 4857
162 Ga0450909_011705 3300042185 Bacteria 1285
163 Ga0439434_0002436 3300042435 Bacteria 5408
164 Ga0450918_000221 3300042531 Bacteria 13041
165 Ga0450918_009403 3300042531 Bacteria 1714
166 Ga0466965_0002955 3300044683 Bacteria 7359
167 Ga0451576_0074588 3300045051 Bacteria 3531
168 Ga0451576_0310400 3300045051 Bacteria 1650
169 Ga0495649_0000843 3300046694 Bacteria 24617
170 Ga0501034_0000241 3300049571 Bacteria 101160
171 Ga0501034_0015595 3300049571 Bacteria 7804
172 Ga0501037_0000001 3300049573 Bacteria 753276
173 Ga0501080_0411744 3300049742 Bacteria 1215
174 Ga0501083_0007879 3300049744 Bacteria 7547
175 Ga0501083_0019917 3300049744 Unclassified 4669
176 Ga0501035_0000033 3300049822 Bacteria 175087
177 Ga0501035_0018541 3300049822 Bacteria 6411
178 Ga0501044_0073471 3300049823 Unclassified 3476
179 nmdc:mga03n38_9701_c1 3300050490 Bacteria 3125
180 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
181 nmdc:mga0yw44_18704_c1 3300050492 Bacteria 3802
182 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
183 nmdc:mga04h51_302_c1 3300050495 Bacteria 12593
184 nmdc:mga07m45_86579_c1 3300050496 Bacteria 1793
185 nmdc:mga0sz30_6018_c1 3300050516 Unclassified 4482
186 Ga0500643_003724 3300053087 Bacteria 7169
187 Ga0500644_0041363 3300053088 Bacteria 1530
188 Ga0500583_0013010 3300053092 Unclassified 3201
189 Ga0500651_0000001 3300053093 Bacteria 529808
190 Ga0500651_0000045 3300053093 Bacteria 85481
191 Ga0500651_0000441 3300053093 Bacteria 22180
192 Ga0500556_0000272 3300053104 Bacteria 40585
193 Ga0500593_031683 3300053117 Bacteria 2365
194 Ga0500594_0000208 3300053118 Bacteria 14511
195 Ga0500614_003167 3300053123 Bacteria 3571
196 Ga0500616_0019655 3300053153 Bacteria 3804
197 Ga0500611_006672 3300053727 Bacteria 1694
198 Ga0265324_10040443
199 JGI24737J22298_10000038
200 JGI24742J22300_10000006
201 rootH2_10006847
202 rootH1_10202562
203 Ga0070658_10000015
204 Ga0070658_10001477
205 Ga0070658_10006133
206 Ga0070658_10203966
207 Ga0070680_100001168
208 Ga0070680_100011478
209 Ga0070660_100000078
210 Ga0070660_100000224
211 Ga0070660_100005047
212 Ga0070708_100158654
213 Ga0070681_10111949
214 Ga0070681_10226686
215 Ga0070679_100000876
216 Ga0070679_100014762
217 Ga0070679_100027157
218 Ga0068853_100084959
219 Ga0068855_100000002
220 Ga0068855_100001288
221 Ga0068855_100054770
222 Ga0068856_100000001
223 Ga0068852_100000001
224 Ga0068860_100064909
225 Ga0068862_100189416
226 Ga0075365_10022229
227 Ga0075365_10054023
228 Ga0075368_10000003
229 Ga0075368_10000235
230 Ga0075363_100013728
231 Ga0075364_10001012
232 Ga0075364_10003417
233 Ga0075364_10086039
234 Ga0075367_10004670
235 Ga0075366_10008375
236 Ga0075370_10006549
237 Ga0105240_10012742
238 Ga0105240_10449100
239 Ga0105245_10000001
240 Ga0105245_10035983
241 Ga0105241_10011744
242 Ga0105241_10089578
243 Ga0105241_10334072
244 Ga0105242_10288006
245 Ga0105237_10000002
246 Ga0105032_100001
247 Ga0105032_100018
248 Ga0105239_10068714
249 Ga0105239_10081328
250 Ga0105239_10147408
251 Ga0105239_10713067
252 Ga0157371_10026825
253 Ga0157370_10210744
254 Ga0157369_10000063
255 Ga0157369_10000413
256 Ga0157369_10001676
257 Ga0157369_10034395
258 Ga0157369_10059964
259 Ga0157372_10000086
260 Ga0207705_10000011
261 Ga0207705_10000327
262 Ga0207705_10169560
263 Ga0207654_10210557
264 Ga0207707_10054049
265 Ga0207695_10010095
266 Ga0207671_10000008
267 Ga0207660_10003394
268 Ga0207660_10007290
269 Ga0207660_10009609
270 Ga0207657_10000741
271 Ga0207652_10000906
272 Ga0207652_10026458
273 Ga0207652_10124950
274 Ga0207687_10000030
275 Ga0207687_10108178
276 Ga0207644_10397699
277 Ga0207667_10000005
278 Ga0207667_10002118
279 Ga0207667_10017182
280 Ga0207667_10051256
281 Ga0207668_10121438
282 Ga0207640_10020015
283 Ga0207639_10002495
284 Ga0207702_10000001
285 Ga0207698_10000001
286 Ga0209813_10000376
287 Ga0265337_1000201
288 Ga0265337_1000384
289 Ga0265337_1000836
290 Ga0265337_1001196
291 Ga0265337_1011821
292 Ga0265326_10003852
293 Ga0265326_10004494
294 Ga0265326_10006543
295 Ga0265326_10017683
296 Ga0265319_1061087
297 Ga0265334_10000049
298 Ga0265334_10010504
299 Ga0265334_10033563
300 Ga0265334_10040610
301 Ga0265318_10041127
302 Ga0265323_10012352
303 Ga0265322_10000664
304 Ga0265336_10000047
305 Ga0265336_10004552
306 Ga0265336_10005232
307 Ga0265338_10000003
308 Ga0265338_10000039
309 Ga0265338_10000052
310 Ga0265338_10000178
311 Ga0265338_10000482
312 Ga0265338_10002389
313 Ga0265338_10007578
314 Ga0265338_10011019
315 Ga0265338_10014879
316 Ga0265338_10025409
317 Ga0265338_10043492
318 Ga0265338_10044563
319 Ga0265338_10072539
320 Ga0265338_10084668
321 Ga0265338_10114389
322 Ga0265338_10123826
323 Ga0265338_10230038
324 Ga0265324_10011819
325 Ga0314311_1133365
326 Ga0316179_1019830
327 Ga0316180_1183837
328 Ga0316183_1010742
329 Ga0316183_1073503
330 Ga0316181_1138937
331 Ga0316182_1009688
332 Ga0316182_1059726
333 Ga0316182_1328432
334 Ga0265330_10016161
335 Ga0265332_10003459
336 Ga0265320_10085358
337 Ga0265325_10012748
338 Ga0265339_10041298
339 Ga0265327_10000017
340 Ga0265327_10008115
341 Ga0265327_10019292
342 Ga0265327_10026554
343 Ga0265316_10017324
344 Ga0265316_10029504
345 Ga0265313_10003356
346 Ga0265313_10063118
347 Ga0265314_10144382
348 Ga0395900_0000232
349 Ga0395900_0014764
350 Ga0395898_0002945
351 Ga0439438_005305
352 Ga0439461_0001504
353 Ga0439442_007179
354 Ga0439445_0000935
355 Ga0439432_000814
356 Ga0450906_000842
357 Ga0439446_0000001
358 Ga0439446_0001960
359 Ga0450909_011705
360 Ga0439434_0002436
361 Ga0450918_000221
362 Ga0450918_009403
363 Ga0466965_0002955
364 Ga0451576_0074588
365 Ga0451576_0310400
366 Ga0495649_0000843
367 Ga0501034_0000241
368 Ga0501034_0015595
369 Ga0501037_0000001
370 Ga0501080_0411744
371 Ga0501083_0007879
372 Ga0501083_0019917
373 Ga0501035_0000033
374 Ga0501035_0018541
375 Ga0501044_0073471
376 nmdc:mga03n38_9701_c1
377 nmdc:mga00v17_120_c1
378 nmdc:mga0yw44_18704_c1
379 nmdc:mga0yw44_4_c1
380 nmdc:mga04h51_302_c1
381 nmdc:mga07m45_86579_c1
382 nmdc:mga0sz30_6018_c1
383 Ga0500643_003724
384 Ga0500644_0041363
385 Ga0500583_0013010
386 Ga0500651_0000001
387 Ga0500651_0000045
388 Ga0500651_0000441
389 Ga0500556_0000272
390 Ga0500593_031683
391 Ga0500594_0000208
392 Ga0500614_003167
393 Ga0500616_0019655
394 Ga0500611_006672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02646

RmuC

RmuC family

93

386

0.88

Map