F303196

General Info

Members Datasets Scaffolds Average Seq Length
197 152 394 283

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10058435|Ga0307515_100584351
Length 308
Sequence MTTYEPALDVAVQAQATLGEGPTWDAAKSRLIWIDILGSRVNTYDPSTGRRTVMATEQHVGAAKPRATGGLVLNLRDGVALYDDGEGSEVTPAPAIDAVPXXXXPPGSFRWLHHDPTPGRRANDAAVAPDGSLWAGTMRYDEAAGGGTLSRLTGDGEVTTVLDDVAVSNGTGWSPDGRLMYYIDSPTRRVDVFDVSADGQSVTNRRQLALIEEGAGWPDGLTVDADGCVWVALWDGGAVRRYTPSGTLDRTITLPTVRPTACAFGGPNLTDLYITTARVGLSAPHPLSGSLLVVPGAGKGVAQPAFAG

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
11 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
12 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
15 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
16 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
17 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
18 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
23 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
24 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
25 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
26 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
27 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
28 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
29 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
30 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
31 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
34 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
35 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
36 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
37 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
38 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
39 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
40 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
41 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
42 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
43 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
44 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
45 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
46 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
47 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
48 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
49 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
50 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
51 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
52 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
53 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
54 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
55 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
56 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
57 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
58 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
59 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
60 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
61 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
62 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
63 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
64 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
65 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
66 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
67 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
68 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
69 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
70 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
71 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
72 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
73 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
74 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
75 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
76 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
77 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
78 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
79 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
80 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
81 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
103 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
108 2582580736 Prauserella sp. Am3 Isolate Unclassified
109 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
110 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
111 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
112 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
113 2643221647 Streptomyces sp. Root369 Isolate Unclassified
114 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
115 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
116 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
117 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
118 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
119 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
120 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
121 2808606448 Streptomyces sp. 193411 Isolate Unclassified
122 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
123 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
124 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
125 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
126 2862574272 Streptomyces sp. AcE210 Isolate Nodule
127 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
128 2867369537 Streptomyces sp. Z26 Isolate Unclassified
129 2867428634 Streptomyces sp. RP5T Isolate Unclassified
130 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
131 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
132 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
133 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
134 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
135 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
136 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
137 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
138 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
139 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
140 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
141 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
142 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
143 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
144 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
145 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
146 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
147 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
148 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
149 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
150 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
151 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
152 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.13
Metatranscriptomes 1.52
Isolates 23.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 0.51
Rhizoplane 0
Rhizosphere 75.63
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10058435 3300028794 Bacteria 5554
2 rootH1_10032598 3300003316 Bacteria 4795
3 rootH2_10153980 3300003320 Bacteria 2319
4 rootL2_10011034 3300003322 Bacteria 3525
5 Ga0006562J51391_1166383 3300003578 Bacteria 2210
6 Ga0006562J51391_1166384 3300003578 Bacteria 2120
7 Ga0006562J51391_1194146 3300003578 Bacteria 1514
8 Ga0068855_100368053 3300005563 Bacteria 1580
9 Ga0075365_10040382 3300006038 Bacteria 3043
10 Ga0075368_10033814 3300006042 Bacteria 1990
11 Ga0075370_10035794 3300006353 Bacteria 2788
12 Ga0075433_10531905 3300006852 Bacteria 1034
13 Ga0105238_10138332 3300009551 Bacteria 2413
14 Ga0105239_10218441 3300010375 Bacteria 2137
15 Ga0105246_10002603 3300011119 Bacteria 10917
16 Ga0182008_10005346 3300014497 Bacteria 7332
17 Ga0183367_1009 3300015688 Bacteria 484598
18 Ga0209758_1033507 3300025297 Bacteria 2060
19 Ga0207426_1072882 3300025302 Bacteria 952
20 Ga0207647_10041644 3300025904 Bacteria 2887
21 Ga0207694_10112160 3300025924 Bacteria 2170
22 Ga0207667_10672092 3300025949 Bacteria 1040
23 Ga0207702_10021060 3300026078 Bacteria 5396
24 Ga0209813_10100592 3300027866 Bacteria 983
25 Ga0307515_10128947 3300028794 Bacteria 2801
26 Ga0307512_10002005 3300030522 Bacteria 27063
27 Ga0307512_10108728 3300030522 Bacteria 1838
28 Ga0307513_10011380 3300031456 Bacteria 11061
29 Ga0307508_10002215 3300031616 Bacteria 20728
30 Ga0307508_10003289 3300031616 Bacteria 16470
31 Ga0307514_10019012 3300031649 Bacteria 5624
32 Ga0307516_10070335 3300031730 Bacteria 3363
33 Ga0307518_10127011 3300031838 Bacteria 1797
34 Ga0307518_10198134 3300031838 Bacteria 1337
35 Ga0307510_10111960 3300033180 Bacteria 2468
36 Ga0395900_0420531 3300037418 Bacteria 1297
37 Ga0395898_0008924 3300037466 Bacteria 10559
38 Ga0395898_0092205 3300037466 Bacteria 2913
39 Ga0395898_0243302 3300037466 Bacteria 1716
40 Ga0395901_0105773 3300038443 Bacteria 2954
41 Ga0439448_0014778 3300042005 Bacteria 2357
42 Ga0439449_0007844 3300042007 Bacteria 4053
43 Ga0450903_000409 3300042138 Bacteria 9202
44 Ga0439458_0000755 3300042157 Bacteria 8284
45 Ga0439458_0009174 3300042157 Bacteria 2203
46 Ga0466972_0048081 3300044658 Bacteria 2061
47 Ga0466972_0066634 3300044658 Bacteria 1721
48 Ga0466970_0000812 3300044765 Bacteria 15029
49 Ga0466970_0046952 3300044765 Bacteria 2301
50 Ga0466960_0124126 3300044901 Bacteria 1355
51 Ga0495603_0013829 3300046455 Bacteria 4885
52 Ga0495603_0044708 3300046455 Bacteria 2642
53 Ga0495603_0065089 3300046455 Bacteria 2148
54 Ga0495629_0001162 3300046459 Bacteria 20771
55 Ga0495629_0002985 3300046459 Bacteria 12859
56 Ga0495629_0021664 3300046459 Bacteria 4586
57 Ga0495605_0003157 3300046474 Bacteria 9916
58 Ga0495605_0121799 3300046474 Bacteria 1182
59 Ga0495662_0080288 3300046476 Bacteria 1586
60 Ga0495594_0010413 3300046499 Bacteria 4822
61 Ga0495606_0032897 3300046507 Bacteria 3585
62 Ga0495608_0235246 3300046511 Bacteria 1146
63 Ga0495610_0084979 3300046512 Bacteria 1445
64 Ga0495620_0006218 3300046515 Bacteria 6575
65 Ga0495620_0010860 3300046515 Bacteria 4782
66 Ga0495643_0014717 3300046522 Bacteria 4647
67 Ga0495648_0012761 3300046524 Bacteria 6241
68 Ga0495666_0001803 3300046526 Bacteria 10583
69 Ga0495652_0156345 3300046529 Bacteria 1775
70 Ga0495640_0015961 3300046533 Bacteria 5634
71 Ga0495597_0070196 3300046542 Bacteria 1510
72 Ga0495633_0028475 3300046558 Bacteria 2722
73 Ga0495656_0132900 3300046615 Unclassified 1186
74 Ga0495668_0151397 3300046616 Bacteria 1270
75 Ga0495634_0026038 3300046642 Bacteria 4085
76 Ga0495611_0087061 3300046648 Bacteria 1441
77 Ga0495588_0009785 3300046674 Bacteria 4445
78 Ga0495657_0048105 3300046675 Bacteria 2878
79 Ga0495623_0069345 3300046679 Bacteria 2198
80 Ga0495613_0008342 3300046689 Bacteria 7693
81 Ga0495613_0039376 3300046689 Bacteria 3504
82 Ga0495613_0041838 3300046689 Bacteria 3391
83 Ga0495589_0006716 3300046794 Bacteria 6060
84 Ga0495589_0009745 3300046794 Bacteria 4989
85 Ga0495589_0034432 3300046794 Bacteria 2543
86 Ga0495589_0195193 3300046794 Bacteria 957
87 Ga0495600_0138574 3300046809 Bacteria 1579
88 Ga0495660_0073841 3300046810 Bacteria 1803
89 Ga0495604_0029444 3300047317 Bacteria 4368
90 Ga0495604_0267617 3300047317 Bacteria 1159
91 Ga0495636_0012677 3300047318 Bacteria 3338
92 Ga0495636_0024477 3300047318 Bacteria 2449
93 Ga0495636_0122999 3300047318 Bacteria 1149
94 Ga0495672_0016847 3300047320 Bacteria 4904
95 Ga0495676_0005506 3300047321 Bacteria 11613
96 Ga0495676_0005931 3300047321 Bacteria 11213
97 Ga0495676_0008001 3300047321 Bacteria 9693
98 Ga0495676_0052501 3300047321 Bacteria 3253
99 Ga0495680_0197316 3300047322 Bacteria 1445
100 Ga0495683_0036382 3300047323 Bacteria 2499
101 Ga0495687_007290 3300047443 Bacteria 6551
102 Ga0495687_085328 3300047443 Bacteria 1225
103 Ga0495685_005384 3300047447 Bacteria 4176
104 Ga0495685_006134 3300047447 Bacteria 3932
105 Ga0495685_087758 3300047447 Bacteria 1032
106 Ga0495681_0084978 3300047470 Bacteria 1406
107 Ga0495684_0134795 3300047471 Bacteria 1854
108 Ga0495593_0038401 3300047673 Bacteria 2586
109 Ga0495593_0047712 3300047673 Bacteria 2277
110 Ga0495614_0000523 3300048089 Bacteria 15819
111 Ga0495626_0038994 3300048091 Bacteria 2249
112 Ga0496125_0000429 3300048928 Bacteria 77563
113 Ga0495678_051878 3300049459 Bacteria 1582
114 Ga0501032_0005424 3300049569 Bacteria 9478
115 Ga0501032_0050123 3300049569 Bacteria 2816
116 Ga0501032_0050667 3300049569 Bacteria 2800
117 Ga0501033_0002390 3300049570 Bacteria 15983
118 Ga0501034_0007244 3300049571 Bacteria 11839
119 Ga0501034_0053183 3300049571 Bacteria 4079
120 Ga0501036_0012819 3300049572 Bacteria 6956
121 Ga0501036_0041048 3300049572 Bacteria 3916
122 Ga0501036_0069006 3300049572 Bacteria 2991
123 Ga0501037_0060586 3300049573 Bacteria 2760
124 Ga0501037_0107228 3300049573 Bacteria 2013
125 Ga0501037_0489330 3300049573 Bacteria 835
126 Ga0501038_0001168 3300049574 Bacteria 23828
127 Ga0501038_0009409 3300049574 Bacteria 8967
128 Ga0501038_0113673 3300049574 Bacteria 2240
129 Ga0501039_0029113 3300049575 Bacteria 4253
130 Ga0501039_0466055 3300049575 Bacteria 992
131 Ga0501041_0047217 3300049577 Bacteria 2621
132 Ga0501042_0159252 3300049578 Bacteria 1628
133 Ga0501043_0000737 3300049579 Bacteria 29002
134 Ga0501043_0103788 3300049579 Bacteria 2233
135 Ga0501046_0047026 3300049580 Bacteria 3423
136 Ga0501046_0062955 3300049580 Bacteria 2897
137 Ga0501048_0006891 3300049582 Bacteria 8635
138 Ga0501068_0079459 3300049584 Bacteria 2011
139 Ga0501070_0000283 3300049586 Bacteria 47512
140 Ga0501070_0054266 3300049586 Bacteria 3324
141 Ga0501080_0063082 3300049742 Bacteria 3449
142 Ga0501035_0008742 3300049822 Bacteria 9426
143 Ga0501044_0005337 3300049823 Bacteria 14287
144 Ga0501045_0010490 3300049824 Bacteria 6490
145 nmdc:mga03n38_10944_c1 3300050490 Bacteria 3362
146 nmdc:mga0yw44_105374_c1 3300050492 Bacteria 1801
147 nmdc:mga04h51_20059_c1 3300050495 Bacteria 1990
148 nmdc:mga07m45_35124_c1 3300050496 Bacteria 2788
149 nmdc:mga0a205_456456_c1 3300050515 Unclassified 1137
150 Ga0501084_0027674 3300054114 Bacteria 4737
151 Ga0501082_0045169 3300060353 Bacteria 3799
152 2547407840 2547132111 Bacteria 8013147
153 2583153244 2582580736 Bacteria 5325865
154 2585298193 2582581312 Bacteria 7308206
155 2585305079 2582581313 Bacteria 10042643
156 2616694690 2616644814 Bacteria 11555299
157 2616901450 2616644941 Bacteria 8510691
158 2644268957 2643221647 Bacteria 10741251
159 2644436155 2643221678 Bacteria 9540101
160 2753071590 2751185734 Bacteria 8863695
161 2784587710 2784132148 Bacteria 8627943
162 2785368349 2784746768 Bacteria 10036182
163 2786669337 2786546132 Bacteria 10419719
164 2808840983 2808606359 Bacteria 9866990
165 2808919562 2808606375 Bacteria 9466072
166 2809231278 2808606448 Bacteria 8656184
167 2812481379 2811994917 Bacteria 7761064
168 2862185852 2862178590 Bacteria 8583590
169 2862288339 2862281513 Bacteria 9621493
170 2862514017 2862507626 Bacteria 9425308
171 2862582570 2862574272 Bacteria 10567477
172 2867347301 2867346516 Bacteria 7608576
173 2867370898 2867369537 Bacteria 6501581
174 2867430119 2867428634 Bacteria 9590268
175 2870729448 2870721527 Bacteria 9689237
176 2873152892 2873151551 Bacteria 8625867
177 2877682241 2877676314 Bacteria 9512378
178 2912721129 2912715099 Bacteria 9460473
179 2919468465 2919468124 Bacteria 9133025
180 2954003948 2954002825 Bacteria 9173742
181 2954387356 2954380949 Bacteria 10050426
182 2954675801 2954673503 Bacteria 9685905
183 2954688463 2954682443 Bacteria 9862841
184 2954698191 2954691527 Bacteria 10720516
185 2954704036 2954701450 Bacteria 10834262
186 2954717227 2954711539 Bacteria 10867210
187 2954727195 2954721474 Bacteria 10456478
188 2954734597 2954731030 Bacteria 10243860
189 2954746101 2954740390 Bacteria 10229294
190 2954753494 2954749733 Bacteria 10366972
191 2954765068 2954759201 Bacteria 9358192
192 2990093709 2990088156 Bacteria 6657676
193 3006398427 3006393351 Bacteria 6615579
194 3006501905 3006493962 Bacteria 8825450
195 8023630885 8023623736 Bacteria 8593882
196 8048135887 8048127548 Bacteria 11053136
197 8056836759 8056829672 Bacteria 9045328
198 Ga0307515_10058435
199 rootH1_10032598
200 rootH2_10153980
201 rootL2_10011034
202 Ga0006562J51391_1166383
203 Ga0006562J51391_1166384
204 Ga0006562J51391_1194146
205 Ga0068855_100368053
206 Ga0075365_10040382
207 Ga0075368_10033814
208 Ga0075370_10035794
209 Ga0075433_10531905
210 Ga0105238_10138332
211 Ga0105239_10218441
212 Ga0105246_10002603
213 Ga0182008_10005346
214 Ga0183367_1009
215 Ga0209758_1033507
216 Ga0207426_1072882
217 Ga0207647_10041644
218 Ga0207694_10112160
219 Ga0207667_10672092
220 Ga0207702_10021060
221 Ga0209813_10100592
222 Ga0307515_10128947
223 Ga0307512_10002005
224 Ga0307512_10108728
225 Ga0307513_10011380
226 Ga0307508_10002215
227 Ga0307508_10003289
228 Ga0307514_10019012
229 Ga0307516_10070335
230 Ga0307518_10127011
231 Ga0307518_10198134
232 Ga0307510_10111960
233 Ga0395900_0420531
234 Ga0395898_0008924
235 Ga0395898_0092205
236 Ga0395898_0243302
237 Ga0395901_0105773
238 Ga0439448_0014778
239 Ga0439449_0007844
240 Ga0450903_000409
241 Ga0439458_0000755
242 Ga0439458_0009174
243 Ga0466972_0048081
244 Ga0466972_0066634
245 Ga0466970_0000812
246 Ga0466970_0046952
247 Ga0466960_0124126
248 Ga0495603_0013829
249 Ga0495603_0044708
250 Ga0495603_0065089
251 Ga0495629_0001162
252 Ga0495629_0002985
253 Ga0495629_0021664
254 Ga0495605_0003157
255 Ga0495605_0121799
256 Ga0495662_0080288
257 Ga0495594_0010413
258 Ga0495606_0032897
259 Ga0495608_0235246
260 Ga0495610_0084979
261 Ga0495620_0006218
262 Ga0495620_0010860
263 Ga0495643_0014717
264 Ga0495648_0012761
265 Ga0495666_0001803
266 Ga0495652_0156345
267 Ga0495640_0015961
268 Ga0495597_0070196
269 Ga0495633_0028475
270 Ga0495656_0132900
271 Ga0495668_0151397
272 Ga0495634_0026038
273 Ga0495611_0087061
274 Ga0495588_0009785
275 Ga0495657_0048105
276 Ga0495623_0069345
277 Ga0495613_0008342
278 Ga0495613_0039376
279 Ga0495613_0041838
280 Ga0495589_0006716
281 Ga0495589_0009745
282 Ga0495589_0034432
283 Ga0495589_0195193
284 Ga0495600_0138574
285 Ga0495660_0073841
286 Ga0495604_0029444
287 Ga0495604_0267617
288 Ga0495636_0012677
289 Ga0495636_0024477
290 Ga0495636_0122999
291 Ga0495672_0016847
292 Ga0495676_0005506
293 Ga0495676_0005931
294 Ga0495676_0008001
295 Ga0495676_0052501
296 Ga0495680_0197316
297 Ga0495683_0036382
298 Ga0495687_007290
299 Ga0495687_085328
300 Ga0495685_005384
301 Ga0495685_006134
302 Ga0495685_087758
303 Ga0495681_0084978
304 Ga0495684_0134795
305 Ga0495593_0038401
306 Ga0495593_0047712
307 Ga0495614_0000523
308 Ga0495626_0038994
309 Ga0496125_0000429
310 Ga0495678_051878
311 Ga0501032_0005424
312 Ga0501032_0050123
313 Ga0501032_0050667
314 Ga0501033_0002390
315 Ga0501034_0007244
316 Ga0501034_0053183
317 Ga0501036_0012819
318 Ga0501036_0041048
319 Ga0501036_0069006
320 Ga0501037_0060586
321 Ga0501037_0107228
322 Ga0501037_0489330
323 Ga0501038_0001168
324 Ga0501038_0009409
325 Ga0501038_0113673
326 Ga0501039_0029113
327 Ga0501039_0466055
328 Ga0501041_0047217
329 Ga0501042_0159252
330 Ga0501043_0000737
331 Ga0501043_0103788
332 Ga0501046_0047026
333 Ga0501046_0062955
334 Ga0501048_0006891
335 Ga0501068_0079459
336 Ga0501070_0000283
337 Ga0501070_0054266
338 Ga0501080_0063082
339 Ga0501035_0008742
340 Ga0501044_0005337
341 Ga0501045_0010490
342 nmdc:mga03n38_10944_c1
343 nmdc:mga0yw44_105374_c1
344 nmdc:mga04h51_20059_c1
345 nmdc:mga07m45_35124_c1
346 nmdc:mga0a205_456456_c1
347 Ga0501084_0027674
348 Ga0501082_0045169
349 2547407840
350 2583153244
351 2585298193
352 2585305079
353 2616694690
354 2616901450
355 2644268957
356 2644436155
357 2753071590
358 2784587710
359 2785368349
360 2786669337
361 2808840983
362 2808919562
363 2809231278
364 2812481379
365 2862185852
366 2862288339
367 2862514017
368 2862582570
369 2867347301
370 2867370898
371 2867430119
372 2870729448
373 2873152892
374 2877682241
375 2912721129
376 2919468465
377 2954003948
378 2954387356
379 2954675801
380 2954688463
381 2954698191
382 2954704036
383 2954717227
384 2954727195
385 2954734597
386 2954746101
387 2954753494
388 2954765068
389 2990093709
390 3006398427
391 3006501905
392 8023630885
393 8048135887
394 8056836759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

18

278

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g4e-assembly1.cif.gz_A crystal structure of human senescence marker protein-30(smp30)(calcium bound) 0.9649 6 284
4gna-assembly1.cif.gz_A mouse smp30/gnl-xylitol complex 0.963 6 284
2ghs-assembly1.cif.gz_A crystal structure of a calcium-binding protein, regucalcin (agr_c_1268) from agrobacterium tumefaciens str. c58 at 1.55 a resolution 0.9618 9 282
7plc-assembly4.cif.gz_D caulobacter crescentus xylonolactonase with d-xylose, p21 space group 0.9496 6 283
3g4e-assembly1.cif.gz_A crystal structure of human senescence marker protein-30(smp30)(calcium bound) 0.9451 6 284
ID Description Score Start End Superfamily
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9685 6 284 2.120.10.30
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9545 6 284 2.120.10.30
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9486 6 284 2.120.10.30
5xfeA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9353 6 283 2.120.10.30
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9349 6 284 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7K2GC83-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.999 6 257 GO:0004341
GO:0005509
GO:0019853
AF-A0A2M9JZL6-F1-model_v4 Calcium-binding protein 0.9932 6 284 GO:0004341
GO:0005509
GO:0019853
AF-A0A2N3TNI1-F1-model_v4 deleted 0.9918 72 284
AF-A0A5N8WKD9-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9917 5 228 GO:0004341
GO:0005509
GO:0019853
AF-A0A371QAD9-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9839 8 189 GO:0004341
GO:0005509
GO:0019853

Map