F303190

General Info

Members Datasets Scaffolds Average Seq Length
197 159 394 275

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10006590|Ga0265318_100065904
Length 303
Sequence MRLHLVDGTYELFRAHFSKRPGHTDPSGRDVKATVGVAWSMITLLRDPEERVTHMAVAFDNPIRSFRNDLFAGYKTEEGVPLELLGQFGLVEDAMRALGIVVWSMDEWEADDALATAAALHWQDVEQVRILTPDKDLGQCLRGRRIVQVDRMRGRVLDEEGLLETRGIAPASVPDYLALVGDTADGIPGLPGFGKKTAAALLHEYGRIENVPLRASDWKPALRGAPALAATLSANLDQVYLYRRLATLVQSVPLSESLEDLRWRGVPRARFEAWCRSMDASESLVTTGLGLVGPVDIPGTDQR

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
116 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
117 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 8.12
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10006590 3300028577 Bacteria 5330
2 JGI24742J22300_10019426 3300002244 Bacteria 1153
3 rootH1_10033881 3300003323 Bacteria 4220
4 Ga0065712_10001949 3300005290 Bacteria 5275
5 Ga0070658_10053648 3300005327 Bacteria 3272
6 Ga0070683_100323368 3300005329 Bacteria 1468
7 Ga0068869_100000933 3300005334 Bacteria 16873
8 Ga0070666_10038007 3300005335 Bacteria 3202
9 Ga0068868_100015088 3300005338 Bacteria 5707
10 Ga0070689_100263683 3300005340 Unclassified 1425
11 Ga0070668_100005534 3300005347 Bacteria 9371
12 Ga0070669_100052524 3300005353 Bacteria 2982
13 Ga0070675_100000020 3300005354 Bacteria 168778
14 Ga0070667_100014053 3300005367 Bacteria 6616
15 Ga0070713_100096529 3300005436 Bacteria 2552
16 Ga0070708_100001165 3300005445 Bacteria 20240
17 Ga0070681_10310709 3300005458 Bacteria 1486
18 Ga0068867_100018490 3300005459 Bacteria 4955
19 Ga0068867_100135433 3300005459 Bacteria 1919
20 Ga0070706_100038151 3300005467 Bacteria 4436
21 Ga0070707_100129566 3300005468 Bacteria 2452
22 Ga0070707_100163650 3300005468 Unclassified 2168
23 Ga0070699_100227184 3300005518 Bacteria 1664
24 Ga0070679_100013848 3300005530 Bacteria 7727
25 Ga0070697_100023845 3300005536 Bacteria 4870
26 Ga0070697_100057182 3300005536 Bacteria 3174
27 Ga0070672_100153655 3300005543 Bacteria 1905
28 Ga0070665_100149222 3300005548 Bacteria 2341
29 Ga0068855_100162478 3300005563 Bacteria 2534
30 Ga0068852_100330516 3300005616 Bacteria 1483
31 Ga0068859_100007348 3300005617 Bacteria 11178
32 Ga0068864_100007614 3300005618 Bacteria 8917
33 Ga0068866_10029275 3300005718 Bacteria 2632
34 Ga0068861_100000763 3300005719 Bacteria 19317
35 Ga0068861_100316587 3300005719 Bacteria 1358
36 Ga0068858_100040716 3300005842 Bacteria 4310
37 Ga0068858_100654566 3300005842 Bacteria 1021
38 Ga0068860_100011356 3300005843 Bacteria 8777
39 Ga0068860_100095555 3300005843 Unclassified 2833
40 Ga0070717_10252422 3300006028 Bacteria 1559
41 Ga0075364_10212289 3300006051 Bacteria 1313
42 Ga0070712_100045483 3300006175 Bacteria 3031
43 Ga0070712_100064741 3300006175 Bacteria 2593
44 Ga0097621_100111089 3300006237 Unclassified 2316
45 Ga0068871_100207608 3300006358 Bacteria 1693
46 Ga0075428_100000920 3300006844 Bacteria 31094
47 Ga0075428_100105243 3300006844 Bacteria 3077
48 Ga0075428_100279880 3300006844 Bacteria 1795
49 Ga0075430_100001786 3300006846 Bacteria 17586
50 Ga0075430_100387367 3300006846 Bacteria 1153
51 Ga0075431_100000243 3300006847 Bacteria 41087
52 Ga0075433_10183936 3300006852 Bacteria 1859
53 Ga0075434_100008715 3300006871 Bacteria 9438
54 Ga0075434_100246899 3300006871 Bacteria 1804
55 Ga0075429_100001924 3300006880 Bacteria 17218
56 Ga0075429_100235586 3300006880 Bacteria 1603
57 Ga0075436_100011023 3300006914 Archaea 6203
58 Ga0097620_100007347 3300006931 Bacteria 11178
59 Ga0075435_100029316 3300007076 Bacteria 4319
60 Ga0075435_100104151 3300007076 Bacteria 2354
61 Ga0105251_10182183 3300009011 Bacteria 946
62 Ga0111539_10000989 3300009094 Bacteria 37233
63 Ga0111539_10415139 3300009094 Bacteria 1568
64 Ga0111539_10981325 3300009094 Bacteria 982
65 Ga0114129_10029160 3300009147 Bacteria 7818
66 Ga0114129_10220584 3300009147 Bacteria 2558
67 Ga0114129_10275554 3300009147 Bacteria 2249
68 Ga0105248_10012988 3300009177 Bacteria 9180
69 Ga0105237_10141423 3300009545 Bacteria 2401
70 Ga0157371_10089192 3300013102 Bacteria 2184
71 Ga0157374_10167257 3300013296 Bacteria 2144
72 Ga0157375_10920004 3300013308 Bacteria 1018
73 Ga0163163_10008221 3300014325 Bacteria 9259
74 Ga0157380_10405709 3300014326 Bacteria 1294
75 Ga0157377_10282258 3300014745 Bacteria 1089
76 Ga0157379_10002404 3300014968 Bacteria 15636
77 Ga0157379_10504306 3300014968 Bacteria 1122
78 Ga0157376_10059357 3300014969 Bacteria 3207
79 Ga0213876_10071071 3300021384 Bacteria 1838
80 Ga0207692_10040789 3300025898 Bacteria 2293
81 Ga0207680_10007721 3300025903 Bacteria 5259
82 Ga0207707_10048972 3300025912 Bacteria 3682
83 Ga0207707_10074568 3300025912 Bacteria 2959
84 Ga0207693_10006597 3300025915 Bacteria 9595
85 Ga0207660_10098080 3300025917 Bacteria 2185
86 Ga0207646_10117029 3300025922 Unclassified 2394
87 Ga0207646_10216891 3300025922 Bacteria 1728
88 Ga0207646_10341662 3300025922 Unclassified 1352
89 Ga0207681_10177016 3300025923 Bacteria 1621
90 Ga0207694_10206945 3300025924 Bacteria 1598
91 Ga0207700_10250305 3300025928 Bacteria 1513
92 Ga0207644_10119920 3300025931 Bacteria 2001
93 Ga0207706_10299804 3300025933 Bacteria 1400
94 Ga0207691_10120614 3300025940 Bacteria 2324
95 Ga0207711_10147450 3300025941 Bacteria 2121
96 Ga0207711_10214091 3300025941 Bacteria 1760
97 Ga0207689_10000368 3300025942 Bacteria 42563
98 Ga0207658_10014040 3300025986 Bacteria 5482
99 Ga0207703_10058303 3300026035 Bacteria 3151
100 Ga0207703_10144285 3300026035 Bacteria 2069
101 Ga0207639_10114336 3300026041 Bacteria 2206
102 Ga0207641_10038241 3300026088 Bacteria 4011
103 Ga0207648_10001630 3300026089 Bacteria 24588
104 Ga0207648_10017789 3300026089 Bacteria 6452
105 Ga0207676_10021397 3300026095 Bacteria 4744
106 Ga0207675_100000757 3300026118 Bacteria 32124
107 Ga0207683_10177851 3300026121 Bacteria 1928
108 Ga0207428_10002156 3300027907 Bacteria 19753
109 Ga0268265_10096625 3300028380 Bacteria 2375
110 Ga0268264_10003622 3300028381 Bacteria 13287
111 Ga0265320_10055089 3300031240 Bacteria 1916
112 Ga0265325_10005097 3300031241 Bacteria 8174
113 Ga0265340_10001284 3300031247 Bacteria 14403
114 Ga0265316_10004479 3300031344 Bacteria 13884
115 Ga0307408_100085948 3300031548 Bacteria 2363
116 Ga0307408_100555364 3300031548 Bacteria 1014
117 Ga0265313_10000872 3300031595 Bacteria 30443
118 Ga0265342_10076036 3300031712 Bacteria 1947
119 Ga0307516_10136647 3300031730 Bacteria 2225
120 Ga0307405_10087972 3300031731 Bacteria 2049
121 Ga0307413_10200466 3300031824 Bacteria 1441
122 Ga0307407_10151538 3300031903 Bacteria 1507
123 Ga0307416_100100323 3300032002 Bacteria 2517
124 Ga0307411_10087213 3300032005 Bacteria 2167
125 Ga0373930_0030403 3300034816 Bacteria 1109
126 Ga0373934_0048949 3300035086 Bacteria 1673
127 Ga0373949_0002474 3300035090 Bacteria 4734
128 Ga0373945_0025181 3300035116 Bacteria 2066
129 Ga0373960_0079581 3300035121 Bacteria 1029
130 Ga0373943_0023844 3300035170 Bacteria 2848
131 Ga0373955_0206973 3300035172 Bacteria 1169
132 Ga0373935_0314281 3300035692 Bacteria 1110
133 Ga0373933_0116212 3300035724 Bacteria 1672
134 Ga0373937_0190184 3300036401 Bacteria 1929
135 Ga0316582_0083513 3300036647 Bacteria 2090
136 Ga0436364_1062084 3300037853 Unclassified 3799
137 Ga0436365_0605622 3300039437 Bacteria 2328
138 Ga0436365_0858849 3300039437 Bacteria 2188
139 Ga0436361_0171071 3300039447 Bacteria 1065
140 Ga0436362_0264102 3300039453 Bacteria 4303
141 Ga0451789_0596692 3300041443 Bacteria 1935
142 Ga0451797_1033845 3300041453 Bacteria 1890
143 Ga0451802_0321982 3300041460 Bacteria 3192
144 Ga0451807_0713253 3300041486 Bacteria 2969
145 Ga0451837_0933229 3300041494 Bacteria 1079
146 Ga0439449_0002559 3300042007 Bacteria 7105
147 Ga0451577_0030483 3300042876 Bacteria 4873
148 Ga0466963_0272714 3300044694 Bacteria 1189
149 Ga0466959_0099438 3300045049 Bacteria 2083
150 Ga0451576_0018706 3300045051 Bacteria 7580
151 Ga0466967_0565067 3300045976 Bacteria 1120
152 Ga0495580_0060595 3300046472 Bacteria 2659
153 Ga0495639_0184509 3300046475 Bacteria 1017
154 Ga0495662_0066279 3300046476 Bacteria 1746
155 Ga0495665_0166111 3300046531 Bacteria 1150
156 Ga0495586_0012275 3300046535 Bacteria 4546
157 Ga0495598_0014647 3300046537 Bacteria 1965
158 Ga0495656_0002874 3300046615 Bacteria 5769
159 Ga0495588_0171174 3300046674 Bacteria 1148
160 Ga0495647_0086869 3300046681 Bacteria 1276
161 Ga0495675_0205952 3300047444 Bacteria 1196
162 Ga0496102_0132765 3300048905 Bacteria 2331
163 Ga0496102_0184165 3300048905 Bacteria 1968
164 Ga0496103_0168604 3300048906 Bacteria 1405
165 Ga0496104_0007722 3300048907 Bacteria 9526
166 Ga0496106_0067234 3300048909 Bacteria 2732
167 Ga0496108_0010348 3300048911 Bacteria 7573
168 Ga0496109_0003120 3300048912 Bacteria 13821
169 Ga0496109_0042270 3300048912 Bacteria 4128
170 Ga0496110_0714400 3300048913 Bacteria 904
171 Ga0496112_0024961 3300048915 Bacteria 5734
172 Ga0496113_0184390 3300048916 Bacteria 1655
173 Ga0496115_0020806 3300048918 Bacteria 5063
174 Ga0496121_0067893 3300048924 Bacteria 2887
175 Ga0501072_0159760 3300049588 Bacteria 1798
176 Ga0501073_0022963 3300049589 Bacteria 4486
177 Ga0501080_0061835 3300049742 Bacteria 3485
178 nmdc:mga05p37_191638_c1 3300050507 Bacteria 2482
179 nmdc:mga05p37_263651_c1 3300050507 Bacteria 2061
180 nmdc:mga05p37_3848_c1 3300050507 Bacteria 15141
181 nmdc:mga09592_755_c1 3300050508 Bacteria 24846
182 nmdc:mga09592_81975_c1 3300050508 Bacteria 2749
183 nmdc:mga0qj67_112315_c1 3300050509 Bacteria 2200
184 nmdc:mga0qj67_39023_c1 3300050509 Bacteria 3728
185 nmdc:mga06r32_219474_c1 3300050510 Bacteria 1890
186 nmdc:mga06r32_63_c1 3300050510 Bacteria 68165
187 nmdc:mga08y16_254_c1 3300050511 Bacteria 48008
188 nmdc:mga08y16_757250_c1 3300050511 Bacteria 967
189 nmdc:mga0n895_24774_c1 3300050512 Bacteria 5659
190 nmdc:mga0n895_261841_c1 3300050512 Bacteria 1755
191 nmdc:mga0n895_854580_c1 3300050512 Bacteria 898
192 nmdc:mga0rr50_41031_c1 3300050513 Bacteria 3369
193 nmdc:mga0rr50_68847_c1 3300050513 Bacteria 2692
194 nmdc:mga08x19_3858_c1 3300050514 Bacteria 8922
195 nmdc:mga0a205_104453_c1 3300050515 Unclassified 2732
196 nmdc:mga0a205_127884_c1 3300050515 Bacteria 2441
197 Ga0530510_0091800 3300061734 Bacteria 2216
198 Ga0265318_10006590
199 JGI24742J22300_10019426
200 rootH1_10033881
201 Ga0065712_10001949
202 Ga0070658_10053648
203 Ga0070683_100323368
204 Ga0068869_100000933
205 Ga0070666_10038007
206 Ga0068868_100015088
207 Ga0070689_100263683
208 Ga0070668_100005534
209 Ga0070669_100052524
210 Ga0070675_100000020
211 Ga0070667_100014053
212 Ga0070713_100096529
213 Ga0070708_100001165
214 Ga0070681_10310709
215 Ga0068867_100018490
216 Ga0068867_100135433
217 Ga0070706_100038151
218 Ga0070707_100129566
219 Ga0070707_100163650
220 Ga0070699_100227184
221 Ga0070679_100013848
222 Ga0070697_100023845
223 Ga0070697_100057182
224 Ga0070672_100153655
225 Ga0070665_100149222
226 Ga0068855_100162478
227 Ga0068852_100330516
228 Ga0068859_100007348
229 Ga0068864_100007614
230 Ga0068866_10029275
231 Ga0068861_100000763
232 Ga0068861_100316587
233 Ga0068858_100040716
234 Ga0068858_100654566
235 Ga0068860_100011356
236 Ga0068860_100095555
237 Ga0070717_10252422
238 Ga0075364_10212289
239 Ga0070712_100045483
240 Ga0070712_100064741
241 Ga0097621_100111089
242 Ga0068871_100207608
243 Ga0075428_100000920
244 Ga0075428_100105243
245 Ga0075428_100279880
246 Ga0075430_100001786
247 Ga0075430_100387367
248 Ga0075431_100000243
249 Ga0075433_10183936
250 Ga0075434_100008715
251 Ga0075434_100246899
252 Ga0075429_100001924
253 Ga0075429_100235586
254 Ga0075436_100011023
255 Ga0097620_100007347
256 Ga0075435_100029316
257 Ga0075435_100104151
258 Ga0105251_10182183
259 Ga0111539_10000989
260 Ga0111539_10415139
261 Ga0111539_10981325
262 Ga0114129_10029160
263 Ga0114129_10220584
264 Ga0114129_10275554
265 Ga0105248_10012988
266 Ga0105237_10141423
267 Ga0157371_10089192
268 Ga0157374_10167257
269 Ga0157375_10920004
270 Ga0163163_10008221
271 Ga0157380_10405709
272 Ga0157377_10282258
273 Ga0157379_10002404
274 Ga0157379_10504306
275 Ga0157376_10059357
276 Ga0213876_10071071
277 Ga0207692_10040789
278 Ga0207680_10007721
279 Ga0207707_10048972
280 Ga0207707_10074568
281 Ga0207693_10006597
282 Ga0207660_10098080
283 Ga0207646_10117029
284 Ga0207646_10216891
285 Ga0207646_10341662
286 Ga0207681_10177016
287 Ga0207694_10206945
288 Ga0207700_10250305
289 Ga0207644_10119920
290 Ga0207706_10299804
291 Ga0207691_10120614
292 Ga0207711_10147450
293 Ga0207711_10214091
294 Ga0207689_10000368
295 Ga0207658_10014040
296 Ga0207703_10058303
297 Ga0207703_10144285
298 Ga0207639_10114336
299 Ga0207641_10038241
300 Ga0207648_10001630
301 Ga0207648_10017789
302 Ga0207676_10021397
303 Ga0207675_100000757
304 Ga0207683_10177851
305 Ga0207428_10002156
306 Ga0268265_10096625
307 Ga0268264_10003622
308 Ga0265320_10055089
309 Ga0265325_10005097
310 Ga0265340_10001284
311 Ga0265316_10004479
312 Ga0307408_100085948
313 Ga0307408_100555364
314 Ga0265313_10000872
315 Ga0265342_10076036
316 Ga0307516_10136647
317 Ga0307405_10087972
318 Ga0307413_10200466
319 Ga0307407_10151538
320 Ga0307416_100100323
321 Ga0307411_10087213
322 Ga0373930_0030403
323 Ga0373934_0048949
324 Ga0373949_0002474
325 Ga0373945_0025181
326 Ga0373960_0079581
327 Ga0373943_0023844
328 Ga0373955_0206973
329 Ga0373935_0314281
330 Ga0373933_0116212
331 Ga0373937_0190184
332 Ga0316582_0083513
333 Ga0436364_1062084
334 Ga0436365_0605622
335 Ga0436365_0858849
336 Ga0436361_0171071
337 Ga0436362_0264102
338 Ga0451789_0596692
339 Ga0451797_1033845
340 Ga0451802_0321982
341 Ga0451807_0713253
342 Ga0451837_0933229
343 Ga0439449_0002559
344 Ga0451577_0030483
345 Ga0466963_0272714
346 Ga0466959_0099438
347 Ga0451576_0018706
348 Ga0466967_0565067
349 Ga0495580_0060595
350 Ga0495639_0184509
351 Ga0495662_0066279
352 Ga0495665_0166111
353 Ga0495586_0012275
354 Ga0495598_0014647
355 Ga0495656_0002874
356 Ga0495588_0171174
357 Ga0495647_0086869
358 Ga0495675_0205952
359 Ga0496102_0132765
360 Ga0496102_0184165
361 Ga0496103_0168604
362 Ga0496104_0007722
363 Ga0496106_0067234
364 Ga0496108_0010348
365 Ga0496109_0003120
366 Ga0496109_0042270
367 Ga0496110_0714400
368 Ga0496112_0024961
369 Ga0496113_0184390
370 Ga0496115_0020806
371 Ga0496121_0067893
372 Ga0501072_0159760
373 Ga0501073_0022963
374 Ga0501080_0061835
375 nmdc:mga05p37_191638_c1
376 nmdc:mga05p37_263651_c1
377 nmdc:mga05p37_3848_c1
378 nmdc:mga09592_755_c1
379 nmdc:mga09592_81975_c1
380 nmdc:mga0qj67_112315_c1
381 nmdc:mga0qj67_39023_c1
382 nmdc:mga06r32_219474_c1
383 nmdc:mga06r32_63_c1
384 nmdc:mga08y16_254_c1
385 nmdc:mga08y16_757250_c1
386 nmdc:mga0n895_24774_c1
387 nmdc:mga0n895_261841_c1
388 nmdc:mga0n895_854580_c1
389 nmdc:mga0rr50_41031_c1
390 nmdc:mga0rr50_68847_c1
391 nmdc:mga08x19_3858_c1
392 nmdc:mga0a205_104453_c1
393 nmdc:mga0a205_127884_c1
394 Ga0530510_0091800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

168

269

0.93

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

2

167

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c35-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d148n 0.8292 3 261
6c36-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d208n 0.8205 3 261
6c35-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d148n 0.8205 3 261
3zda-assembly1.cif.gz_A structure of e. coli exoix in complex with a fragment of the flap1 dna oligonucleotide, potassium and magnesium 0.8139 1 230
6c34-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease mutant d125n 0.8122 1 261
ID Description Score Start End Superfamily
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8793 3 165 3.40.50.1010
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8356 3 165 3.40.50.1010
af_P9WNU3_1_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8256 3 165 3.40.50.1010
af_Q8I7W9_262_459_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8185 2 165 3.40.50.1010
1tauA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8095 2 165 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A534DP25-F1-model_v4 deleted 0.9802 1 258
AF-A0A534HDU0-F1-model_v4 Flap endonuclease 0.9791 1 258 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7W1AN55-F1-model_v4 Flap endonuclease 0.9744 29 261 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A534GZ59-F1-model_v4 Flap endonuclease 0.9737 1 256 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7W1CVH7-F1-model_v4 Flap endonuclease 0.9732 1 259 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map